data_6GGZ # _entry.id 6GGZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6GGZ pdb_00006ggz 10.2210/pdb6ggz/pdb WWPDB D_1200009907 ? ? BMRB 34268 ? 10.13018/BMR34268 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-30 2 'Structure model' 1 1 2019-05-08 3 'Structure model' 2 0 2020-03-11 4 'Structure model' 2 1 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Polymer sequence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_software 2 3 'Structure model' entity_poly 3 3 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6GGZ _pdbx_database_status.recvd_initial_deposition_date 2018-05-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of the scorpion toxin AmmTx3' _pdbx_database_related.db_id 34268 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Landon, C.' 1 0000-0002-0248-1990 'Meudal, H.' 2 0000-0002-9642-3643 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Bioorg. Med. Chem.' _citation.journal_id_ASTM BMECEP _citation.journal_id_CSD 1200 _citation.journal_id_ISSN 1464-3391 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 247 _citation.page_last 253 _citation.title 'Synthesis by native chemical ligation and characterization of the scorpion toxin AmmTx3.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmc.2018.12.009 _citation.pdbx_database_id_PubMed 30529150 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zoukimian, C.' 1 ? primary 'Meudal, H.' 2 ? primary 'De Waard, S.' 3 ? primary 'Ouares, K.A.' 4 ? primary 'Nicolas, S.' 5 ? primary 'Canepari, M.' 6 ? primary 'Beroud, R.' 7 ? primary 'Landon, C.' 8 ? primary 'De Waard, M.' 9 ? primary 'Boturyn, D.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Potassium channel toxin alpha-KTx 15.3' _entity.formula_weight 3834.563 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Toxin AmmTX3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP' _entity_poly.pdbx_seq_one_letter_code_can QIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP _entity_poly.pdbx_strand_id 1 _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 ILE n 1 3 GLU n 1 4 THR n 1 5 ASN n 1 6 LYS n 1 7 LYS n 1 8 CYS n 1 9 GLN n 1 10 GLY n 1 11 GLY n 1 12 SER n 1 13 CYS n 1 14 ALA n 1 15 SER n 1 16 VAL n 1 17 CYS n 1 18 ARG n 1 19 LYS n 1 20 VAL n 1 21 ILE n 1 22 GLY n 1 23 VAL n 1 24 ALA n 1 25 ALA n 1 26 GLY n 1 27 LYS n 1 28 CYS n 1 29 ILE n 1 30 ASN n 1 31 GLY n 1 32 ARG n 1 33 CYS n 1 34 VAL n 1 35 CYS n 1 36 TYR n 1 37 PRO n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 37 _pdbx_entity_src_syn.organism_scientific 'Androctonus mauritanicus mauritanicus' _pdbx_entity_src_syn.organism_common_name Scorpion _pdbx_entity_src_syn.ncbi_taxonomy_id 6860 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA 1 . n A 1 2 ILE 2 2 2 ILE ILE 1 . n A 1 3 GLU 3 3 3 GLU GLU 1 . n A 1 4 THR 4 4 4 THR THR 1 . n A 1 5 ASN 5 5 5 ASN ASN 1 . n A 1 6 LYS 6 6 6 LYS LYS 1 . n A 1 7 LYS 7 7 7 LYS LYS 1 . n A 1 8 CYS 8 8 8 CYS CYS 1 . n A 1 9 GLN 9 9 9 GLN GLN 1 . n A 1 10 GLY 10 10 10 GLY GLY 1 . n A 1 11 GLY 11 11 11 GLY GLY 1 . n A 1 12 SER 12 12 12 SER SER 1 . n A 1 13 CYS 13 13 13 CYS CYS 1 . n A 1 14 ALA 14 14 14 ALA ALA 1 . n A 1 15 SER 15 15 15 SER SER 1 . n A 1 16 VAL 16 16 16 VAL VAL 1 . n A 1 17 CYS 17 17 17 CYS CYS 1 . n A 1 18 ARG 18 18 18 ARG ARG 1 . n A 1 19 LYS 19 19 19 LYS LYS 1 . n A 1 20 VAL 20 20 20 VAL VAL 1 . n A 1 21 ILE 21 21 21 ILE ILE 1 . n A 1 22 GLY 22 22 22 GLY GLY 1 . n A 1 23 VAL 23 23 23 VAL VAL 1 . n A 1 24 ALA 24 24 24 ALA ALA 1 . n A 1 25 ALA 25 25 25 ALA ALA 1 . n A 1 26 GLY 26 26 26 GLY GLY 1 . n A 1 27 LYS 27 27 27 LYS LYS 1 . n A 1 28 CYS 28 28 28 CYS CYS 1 . n A 1 29 ILE 29 29 29 ILE ILE 1 . n A 1 30 ASN 30 30 30 ASN ASN 1 . n A 1 31 GLY 31 31 31 GLY GLY 1 . n A 1 32 ARG 32 32 32 ARG ARG 1 . n A 1 33 CYS 33 33 33 CYS CYS 1 . n A 1 34 VAL 34 34 34 VAL VAL 1 . n A 1 35 CYS 35 35 35 CYS CYS 1 . n A 1 36 TYR 36 36 36 TYR TYR 1 . n A 1 37 PRO 37 37 37 PRO PRO 1 . n # _software.classification refinement _software.name ARIA _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GGZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6GGZ _struct.title 'NMR structure of the scorpion toxin AmmTx3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GGZ _struct_keywords.text 'scorpion toxin CSab fold, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KA153_ANDMA _struct_ref.pdbx_db_accession P60208 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GGZ _struct_ref_seq.pdbx_strand_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P60208 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 37 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6GGZ _struct_ref_seq_dif.mon_id PCA _struct_ref_seq_dif.pdbx_pdb_strand_id 1 _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P60208 _struct_ref_seq_dif.db_mon_id GLN _struct_ref_seq_dif.pdbx_seq_db_seq_num 1 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 2540 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ;the molecule is a monomer NO QUATERNARY STRUCTURE ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 21 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id 1 _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id 1 _struct_conf.end_auth_seq_id 21 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 28 SG ? ? 1 CYS 8 1 CYS 28 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 33 SG ? ? 1 CYS 13 1 CYS 33 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 35 SG ? ? 1 CYS 17 1 CYS 35 1_555 ? ? ? ? ? ? ? 2.027 ? ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A ILE 2 N ? ? 1 PCA 1 1 ILE 2 1_555 ? ? ? ? ? ? ? 1.327 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PCA A 1 ? . . . . PCA 1 1 ? 1_555 . . . . . . . GLN 1 PCA 'Pyrrolidone carboxylic acid' 'Named protein modification' 2 CYS A 8 ? CYS A 28 ? CYS 1 8 ? 1_555 CYS 1 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 13 ? CYS A 33 ? CYS 1 13 ? 1_555 CYS 1 33 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 17 ? CYS A 35 ? CYS 1 17 ? 1_555 CYS 1 35 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 2 ? LYS A 7 ? ILE 1 2 LYS 1 7 AA1 2 ARG A 32 ? CYS A 35 ? ARG 1 32 CYS 1 35 AA1 3 GLY A 26 ? ILE A 29 ? GLY 1 26 ILE 1 29 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 2 ? N ILE 1 2 O CYS A 35 ? O CYS 1 35 AA1 2 3 O ARG A 32 ? O ARG 1 32 N ILE A 29 ? N ILE 1 29 # _pdbx_entry_details.entry_id 6GGZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA 1 24 ? ? -92.71 42.32 2 1 TYR 1 36 ? ? -119.77 79.66 3 2 ASN 1 5 ? ? -81.73 48.77 4 2 CYS 1 13 ? ? -142.30 28.72 5 2 ALA 1 24 ? ? -97.45 38.90 6 3 ALA 1 24 ? ? -91.20 48.42 7 4 ASN 1 5 ? ? -83.30 37.35 8 4 ALA 1 24 ? ? -94.15 39.64 9 5 ALA 1 24 ? ? -96.32 33.30 10 6 CYS 1 13 ? ? -143.73 29.26 11 6 ALA 1 24 ? ? -93.97 38.85 12 7 ALA 1 24 ? ? -92.74 46.07 13 8 GLN 1 9 ? ? -106.41 68.43 14 8 SER 1 12 ? ? -114.67 -161.98 15 8 CYS 1 13 ? ? -144.93 28.49 16 9 GLN 1 9 ? ? -118.05 69.59 17 9 ALA 1 24 ? ? -91.54 44.23 18 10 ASN 1 5 ? ? -81.14 31.22 19 10 VAL 1 20 ? ? -70.77 -70.28 20 10 ALA 1 24 ? ? -95.64 40.65 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id 1 _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_nmr_ensemble.entry_id 6GGZ _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6GGZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2 mM AmmTx3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label AmmTx3 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component AmmTx3 _pdbx_nmr_exptl_sample.concentration 1.2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure atm _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label AmmTx3 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '15N Sofast HMQC' 1 isotropic # _pdbx_nmr_refine.entry_id 6GGZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 5 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LYS N N N N 143 LYS CA C N S 144 LYS C C N N 145 LYS O O N N 146 LYS CB C N N 147 LYS CG C N N 148 LYS CD C N N 149 LYS CE C N N 150 LYS NZ N N N 151 LYS OXT O N N 152 LYS H H N N 153 LYS H2 H N N 154 LYS HA H N N 155 LYS HB2 H N N 156 LYS HB3 H N N 157 LYS HG2 H N N 158 LYS HG3 H N N 159 LYS HD2 H N N 160 LYS HD3 H N N 161 LYS HE2 H N N 162 LYS HE3 H N N 163 LYS HZ1 H N N 164 LYS HZ2 H N N 165 LYS HZ3 H N N 166 LYS HXT H N N 167 PCA N N N N 168 PCA CA C N S 169 PCA CB C N N 170 PCA CG C N N 171 PCA CD C N N 172 PCA OE O N N 173 PCA C C N N 174 PCA O O N N 175 PCA OXT O N N 176 PCA H H N N 177 PCA HA H N N 178 PCA HB2 H N N 179 PCA HB3 H N N 180 PCA HG2 H N N 181 PCA HG3 H N N 182 PCA HXT H N N 183 PRO N N N N 184 PRO CA C N S 185 PRO C C N N 186 PRO O O N N 187 PRO CB C N N 188 PRO CG C N N 189 PRO CD C N N 190 PRO OXT O N N 191 PRO H H N N 192 PRO HA H N N 193 PRO HB2 H N N 194 PRO HB3 H N N 195 PRO HG2 H N N 196 PRO HG3 H N N 197 PRO HD2 H N N 198 PRO HD3 H N N 199 PRO HXT H N N 200 SER N N N N 201 SER CA C N S 202 SER C C N N 203 SER O O N N 204 SER CB C N N 205 SER OG O N N 206 SER OXT O N N 207 SER H H N N 208 SER H2 H N N 209 SER HA H N N 210 SER HB2 H N N 211 SER HB3 H N N 212 SER HG H N N 213 SER HXT H N N 214 THR N N N N 215 THR CA C N S 216 THR C C N N 217 THR O O N N 218 THR CB C N R 219 THR OG1 O N N 220 THR CG2 C N N 221 THR OXT O N N 222 THR H H N N 223 THR H2 H N N 224 THR HA H N N 225 THR HB H N N 226 THR HG1 H N N 227 THR HG21 H N N 228 THR HG22 H N N 229 THR HG23 H N N 230 THR HXT H N N 231 TYR N N N N 232 TYR CA C N S 233 TYR C C N N 234 TYR O O N N 235 TYR CB C N N 236 TYR CG C Y N 237 TYR CD1 C Y N 238 TYR CD2 C Y N 239 TYR CE1 C Y N 240 TYR CE2 C Y N 241 TYR CZ C Y N 242 TYR OH O N N 243 TYR OXT O N N 244 TYR H H N N 245 TYR H2 H N N 246 TYR HA H N N 247 TYR HB2 H N N 248 TYR HB3 H N N 249 TYR HD1 H N N 250 TYR HD2 H N N 251 TYR HE1 H N N 252 TYR HE2 H N N 253 TYR HH H N N 254 TYR HXT H N N 255 VAL N N N N 256 VAL CA C N S 257 VAL C C N N 258 VAL O O N N 259 VAL CB C N N 260 VAL CG1 C N N 261 VAL CG2 C N N 262 VAL OXT O N N 263 VAL H H N N 264 VAL H2 H N N 265 VAL HA H N N 266 VAL HB H N N 267 VAL HG11 H N N 268 VAL HG12 H N N 269 VAL HG13 H N N 270 VAL HG21 H N N 271 VAL HG22 H N N 272 VAL HG23 H N N 273 VAL HXT H N N 274 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 ILE N CA sing N N 114 ILE N H sing N N 115 ILE N H2 sing N N 116 ILE CA C sing N N 117 ILE CA CB sing N N 118 ILE CA HA sing N N 119 ILE C O doub N N 120 ILE C OXT sing N N 121 ILE CB CG1 sing N N 122 ILE CB CG2 sing N N 123 ILE CB HB sing N N 124 ILE CG1 CD1 sing N N 125 ILE CG1 HG12 sing N N 126 ILE CG1 HG13 sing N N 127 ILE CG2 HG21 sing N N 128 ILE CG2 HG22 sing N N 129 ILE CG2 HG23 sing N N 130 ILE CD1 HD11 sing N N 131 ILE CD1 HD12 sing N N 132 ILE CD1 HD13 sing N N 133 ILE OXT HXT sing N N 134 LYS N CA sing N N 135 LYS N H sing N N 136 LYS N H2 sing N N 137 LYS CA C sing N N 138 LYS CA CB sing N N 139 LYS CA HA sing N N 140 LYS C O doub N N 141 LYS C OXT sing N N 142 LYS CB CG sing N N 143 LYS CB HB2 sing N N 144 LYS CB HB3 sing N N 145 LYS CG CD sing N N 146 LYS CG HG2 sing N N 147 LYS CG HG3 sing N N 148 LYS CD CE sing N N 149 LYS CD HD2 sing N N 150 LYS CD HD3 sing N N 151 LYS CE NZ sing N N 152 LYS CE HE2 sing N N 153 LYS CE HE3 sing N N 154 LYS NZ HZ1 sing N N 155 LYS NZ HZ2 sing N N 156 LYS NZ HZ3 sing N N 157 LYS OXT HXT sing N N 158 PCA N CA sing N N 159 PCA N CD sing N N 160 PCA N H sing N N 161 PCA CA CB sing N N 162 PCA CA C sing N N 163 PCA CA HA sing N N 164 PCA CB CG sing N N 165 PCA CB HB2 sing N N 166 PCA CB HB3 sing N N 167 PCA CG CD sing N N 168 PCA CG HG2 sing N N 169 PCA CG HG3 sing N N 170 PCA CD OE doub N N 171 PCA C O doub N N 172 PCA C OXT sing N N 173 PCA OXT HXT sing N N 174 PRO N CA sing N N 175 PRO N CD sing N N 176 PRO N H sing N N 177 PRO CA C sing N N 178 PRO CA CB sing N N 179 PRO CA HA sing N N 180 PRO C O doub N N 181 PRO C OXT sing N N 182 PRO CB CG sing N N 183 PRO CB HB2 sing N N 184 PRO CB HB3 sing N N 185 PRO CG CD sing N N 186 PRO CG HG2 sing N N 187 PRO CG HG3 sing N N 188 PRO CD HD2 sing N N 189 PRO CD HD3 sing N N 190 PRO OXT HXT sing N N 191 SER N CA sing N N 192 SER N H sing N N 193 SER N H2 sing N N 194 SER CA C sing N N 195 SER CA CB sing N N 196 SER CA HA sing N N 197 SER C O doub N N 198 SER C OXT sing N N 199 SER CB OG sing N N 200 SER CB HB2 sing N N 201 SER CB HB3 sing N N 202 SER OG HG sing N N 203 SER OXT HXT sing N N 204 THR N CA sing N N 205 THR N H sing N N 206 THR N H2 sing N N 207 THR CA C sing N N 208 THR CA CB sing N N 209 THR CA HA sing N N 210 THR C O doub N N 211 THR C OXT sing N N 212 THR CB OG1 sing N N 213 THR CB CG2 sing N N 214 THR CB HB sing N N 215 THR OG1 HG1 sing N N 216 THR CG2 HG21 sing N N 217 THR CG2 HG22 sing N N 218 THR CG2 HG23 sing N N 219 THR OXT HXT sing N N 220 TYR N CA sing N N 221 TYR N H sing N N 222 TYR N H2 sing N N 223 TYR CA C sing N N 224 TYR CA CB sing N N 225 TYR CA HA sing N N 226 TYR C O doub N N 227 TYR C OXT sing N N 228 TYR CB CG sing N N 229 TYR CB HB2 sing N N 230 TYR CB HB3 sing N N 231 TYR CG CD1 doub Y N 232 TYR CG CD2 sing Y N 233 TYR CD1 CE1 sing Y N 234 TYR CD1 HD1 sing N N 235 TYR CD2 CE2 doub Y N 236 TYR CD2 HD2 sing N N 237 TYR CE1 CZ doub Y N 238 TYR CE1 HE1 sing N N 239 TYR CE2 CZ sing Y N 240 TYR CE2 HE2 sing N N 241 TYR CZ OH sing N N 242 TYR OH HH sing N N 243 TYR OXT HXT sing N N 244 VAL N CA sing N N 245 VAL N H sing N N 246 VAL N H2 sing N N 247 VAL CA C sing N N 248 VAL CA CB sing N N 249 VAL CA HA sing N N 250 VAL C O doub N N 251 VAL C OXT sing N N 252 VAL CB CG1 sing N N 253 VAL CB CG2 sing N N 254 VAL CB HB sing N N 255 VAL CG1 HG11 sing N N 256 VAL CG1 HG12 sing N N 257 VAL CG1 HG13 sing N N 258 VAL CG2 HG21 sing N N 259 VAL CG2 HG22 sing N N 260 VAL CG2 HG23 sing N N 261 VAL OXT HXT sing N N 262 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details 'TCI cryoprobe' # _atom_sites.entry_id 6GGZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_