data_6GP6 # _entry.id 6GP6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6GP6 pdb_00006gp6 10.2210/pdb6gp6/pdb WWPDB D_1200010129 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-19 2 'Structure model' 1 1 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.pdbx_dist_value' 4 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 5 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 12 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 2 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 19 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 20 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 21 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 22 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 23 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 24 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 25 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GP6 _pdbx_database_status.recvd_initial_deposition_date 2018-06-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Barber-Zucker, S.' 1 0000-0003-1835-730X 'Zarivach, R.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'MamM CTD - Copper form' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barber-Zucker, S.' 1 ? primary 'Zarivach, R.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Magnetosome protein MamM' 11910.398 2 ? ? ? ? 2 non-polymer man 'COPPER (II) ION' 63.546 3 ? ? ? ? 3 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 4 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Magnetosome protein MamM,Cation efflux protein family,MamM protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMEAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWADMIIGVDPENTVEQAHEICEAVQAAVCGKIRRIESLHVSAEA REIGDTTKPSFSDQPLSFDEVMLSKVDN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMEAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWADMIIGVDPENTVEQAHEICEAVQAAVCGKIRRIESLHVSAEA REIGDTTKPSFSDQPLSFDEVMLSKVDN ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 BETA-MERCAPTOETHANOL BME 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLU n 1 6 ALA n 1 7 VAL n 1 8 GLN n 1 9 ASN n 1 10 ARG n 1 11 ILE n 1 12 VAL n 1 13 GLU n 1 14 ALA n 1 15 ALA n 1 16 GLU n 1 17 ARG n 1 18 VAL n 1 19 PRO n 1 20 GLY n 1 21 VAL n 1 22 ARG n 1 23 GLY n 1 24 VAL n 1 25 ILE n 1 26 HIS n 1 27 LEU n 1 28 ARG n 1 29 ALA n 1 30 ARG n 1 31 TYR n 1 32 VAL n 1 33 GLY n 1 34 GLN n 1 35 ASP n 1 36 ILE n 1 37 TRP n 1 38 ALA n 1 39 ASP n 1 40 MET n 1 41 ILE n 1 42 ILE n 1 43 GLY n 1 44 VAL n 1 45 ASP n 1 46 PRO n 1 47 GLU n 1 48 ASN n 1 49 THR n 1 50 VAL n 1 51 GLU n 1 52 GLN n 1 53 ALA n 1 54 HIS n 1 55 GLU n 1 56 ILE n 1 57 CYS n 1 58 GLU n 1 59 ALA n 1 60 VAL n 1 61 GLN n 1 62 ALA n 1 63 ALA n 1 64 VAL n 1 65 CYS n 1 66 GLY n 1 67 LYS n 1 68 ILE n 1 69 ARG n 1 70 ARG n 1 71 ILE n 1 72 GLU n 1 73 SER n 1 74 LEU n 1 75 HIS n 1 76 VAL n 1 77 SER n 1 78 ALA n 1 79 GLU n 1 80 ALA n 1 81 ARG n 1 82 GLU n 1 83 ILE n 1 84 GLY n 1 85 ASP n 1 86 THR n 1 87 THR n 1 88 LYS n 1 89 PRO n 1 90 SER n 1 91 PHE n 1 92 SER n 1 93 ASP n 1 94 GLN n 1 95 PRO n 1 96 LEU n 1 97 SER n 1 98 PHE n 1 99 ASP n 1 100 GLU n 1 101 VAL n 1 102 MET n 1 103 LEU n 1 104 SER n 1 105 LYS n 1 106 VAL n 1 107 ASP n 1 108 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 108 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mamM, mgI491, MGR_4095' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Magnetospirillum gryphiswaldense MSR-1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 431944 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Rosetta _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 211 ? ? ? A . n A 1 2 SER 2 212 212 SER SER A . n A 1 3 HIS 3 213 213 HIS HIS A . n A 1 4 MET 4 214 214 MET MET A . n A 1 5 GLU 5 215 215 GLU GLU A . n A 1 6 ALA 6 216 216 ALA ALA A . n A 1 7 VAL 7 217 217 VAL VAL A . n A 1 8 GLN 8 218 218 GLN GLN A . n A 1 9 ASN 9 219 219 ASN ASN A . n A 1 10 ARG 10 220 220 ARG ARG A . n A 1 11 ILE 11 221 221 ILE ILE A . n A 1 12 VAL 12 222 222 VAL VAL A . n A 1 13 GLU 13 223 223 GLU GLU A . n A 1 14 ALA 14 224 224 ALA ALA A . n A 1 15 ALA 15 225 225 ALA ALA A . n A 1 16 GLU 16 226 226 GLU GLU A . n A 1 17 ARG 17 227 227 ARG ARG A . n A 1 18 VAL 18 228 228 VAL VAL A . n A 1 19 PRO 19 229 229 PRO PRO A . n A 1 20 GLY 20 230 230 GLY GLY A . n A 1 21 VAL 21 231 231 VAL VAL A . n A 1 22 ARG 22 232 232 ARG ARG A . n A 1 23 GLY 23 233 233 GLY GLY A . n A 1 24 VAL 24 234 234 VAL VAL A . n A 1 25 ILE 25 235 235 ILE ILE A . n A 1 26 HIS 26 236 236 HIS HIS A . n A 1 27 LEU 27 237 237 LEU LEU A . n A 1 28 ARG 28 238 238 ARG ARG A . n A 1 29 ALA 29 239 239 ALA ALA A . n A 1 30 ARG 30 240 240 ARG ARG A . n A 1 31 TYR 31 241 241 TYR TYR A . n A 1 32 VAL 32 242 242 VAL VAL A . n A 1 33 GLY 33 243 243 GLY GLY A . n A 1 34 GLN 34 244 244 GLN GLN A . n A 1 35 ASP 35 245 245 ASP ASP A . n A 1 36 ILE 36 246 246 ILE ILE A . n A 1 37 TRP 37 247 247 TRP TRP A . n A 1 38 ALA 38 248 248 ALA ALA A . n A 1 39 ASP 39 249 249 ASP ASP A . n A 1 40 MET 40 250 250 MET MET A . n A 1 41 ILE 41 251 251 ILE ILE A . n A 1 42 ILE 42 252 252 ILE ILE A . n A 1 43 GLY 43 253 253 GLY GLY A . n A 1 44 VAL 44 254 254 VAL VAL A . n A 1 45 ASP 45 255 255 ASP ASP A . n A 1 46 PRO 46 256 256 PRO PRO A . n A 1 47 GLU 47 257 257 GLU GLU A . n A 1 48 ASN 48 258 258 ASN ASN A . n A 1 49 THR 49 259 259 THR THR A . n A 1 50 VAL 50 260 260 VAL VAL A . n A 1 51 GLU 51 261 261 GLU GLU A . n A 1 52 GLN 52 262 262 GLN GLN A . n A 1 53 ALA 53 263 263 ALA ALA A . n A 1 54 HIS 54 264 264 HIS HIS A . n A 1 55 GLU 55 265 265 GLU GLU A . n A 1 56 ILE 56 266 266 ILE ILE A . n A 1 57 CYS 57 267 267 CYS CYS A . n A 1 58 GLU 58 268 268 GLU GLU A . n A 1 59 ALA 59 269 269 ALA ALA A . n A 1 60 VAL 60 270 270 VAL VAL A . n A 1 61 GLN 61 271 271 GLN GLN A . n A 1 62 ALA 62 272 272 ALA ALA A . n A 1 63 ALA 63 273 273 ALA ALA A . n A 1 64 VAL 64 274 274 VAL VAL A . n A 1 65 CYS 65 275 275 CYS CYS A . n A 1 66 GLY 66 276 276 GLY GLY A . n A 1 67 LYS 67 277 277 LYS LYS A . n A 1 68 ILE 68 278 278 ILE ILE A . n A 1 69 ARG 69 279 279 ARG ARG A . n A 1 70 ARG 70 280 280 ARG ARG A . n A 1 71 ILE 71 281 281 ILE ILE A . n A 1 72 GLU 72 282 282 GLU GLU A . n A 1 73 SER 73 283 283 SER SER A . n A 1 74 LEU 74 284 284 LEU LEU A . n A 1 75 HIS 75 285 285 HIS HIS A . n A 1 76 VAL 76 286 286 VAL VAL A . n A 1 77 SER 77 287 287 SER SER A . n A 1 78 ALA 78 288 288 ALA ALA A . n A 1 79 GLU 79 289 289 GLU GLU A . n A 1 80 ALA 80 290 290 ALA ALA A . n A 1 81 ARG 81 291 291 ARG ARG A . n A 1 82 GLU 82 292 292 GLU GLU A . n A 1 83 ILE 83 293 293 ILE ILE A . n A 1 84 GLY 84 294 294 GLY GLY A . n A 1 85 ASP 85 295 295 ASP ASP A . n A 1 86 THR 86 296 296 THR THR A . n A 1 87 THR 87 297 297 THR THR A . n A 1 88 LYS 88 298 298 LYS LYS A . n A 1 89 PRO 89 299 299 PRO PRO A . n A 1 90 SER 90 300 300 SER SER A . n A 1 91 PHE 91 301 301 PHE PHE A . n A 1 92 SER 92 302 302 SER SER A . n A 1 93 ASP 93 303 303 ASP ASP A . n A 1 94 GLN 94 304 304 GLN GLN A . n A 1 95 PRO 95 305 305 PRO PRO A . n A 1 96 LEU 96 306 306 LEU LEU A . n A 1 97 SER 97 307 307 SER SER A . n A 1 98 PHE 98 308 308 PHE PHE A . n A 1 99 ASP 99 309 309 ASP ASP A . n A 1 100 GLU 100 310 310 GLU GLU A . n A 1 101 VAL 101 311 311 VAL VAL A . n A 1 102 MET 102 312 312 MET MET A . n A 1 103 LEU 103 313 313 LEU LEU A . n A 1 104 SER 104 314 314 SER SER A . n A 1 105 LYS 105 315 ? ? ? A . n A 1 106 VAL 106 316 ? ? ? A . n A 1 107 ASP 107 317 ? ? ? A . n A 1 108 ASN 108 318 ? ? ? A . n B 1 1 GLY 1 211 211 GLY GLY B . n B 1 2 SER 2 212 212 SER SER B . n B 1 3 HIS 3 213 213 HIS HIS B . n B 1 4 MET 4 214 214 MET MET B . n B 1 5 GLU 5 215 215 GLU GLU B . n B 1 6 ALA 6 216 216 ALA ALA B . n B 1 7 VAL 7 217 217 VAL VAL B . n B 1 8 GLN 8 218 218 GLN GLN B . n B 1 9 ASN 9 219 219 ASN ASN B . n B 1 10 ARG 10 220 220 ARG ARG B . n B 1 11 ILE 11 221 221 ILE ILE B . n B 1 12 VAL 12 222 222 VAL VAL B . n B 1 13 GLU 13 223 223 GLU GLU B . n B 1 14 ALA 14 224 224 ALA ALA B . n B 1 15 ALA 15 225 225 ALA ALA B . n B 1 16 GLU 16 226 226 GLU GLU B . n B 1 17 ARG 17 227 227 ARG ARG B . n B 1 18 VAL 18 228 228 VAL VAL B . n B 1 19 PRO 19 229 229 PRO PRO B . n B 1 20 GLY 20 230 230 GLY GLY B . n B 1 21 VAL 21 231 231 VAL VAL B . n B 1 22 ARG 22 232 232 ARG ARG B . n B 1 23 GLY 23 233 233 GLY GLY B . n B 1 24 VAL 24 234 234 VAL VAL B . n B 1 25 ILE 25 235 235 ILE ILE B . n B 1 26 HIS 26 236 236 HIS HIS B . n B 1 27 LEU 27 237 237 LEU LEU B . n B 1 28 ARG 28 238 238 ARG ARG B . n B 1 29 ALA 29 239 239 ALA ALA B . n B 1 30 ARG 30 240 240 ARG ARG B . n B 1 31 TYR 31 241 241 TYR TYR B . n B 1 32 VAL 32 242 242 VAL VAL B . n B 1 33 GLY 33 243 243 GLY GLY B . n B 1 34 GLN 34 244 244 GLN GLN B . n B 1 35 ASP 35 245 245 ASP ASP B . n B 1 36 ILE 36 246 246 ILE ILE B . n B 1 37 TRP 37 247 247 TRP TRP B . n B 1 38 ALA 38 248 248 ALA ALA B . n B 1 39 ASP 39 249 249 ASP ASP B . n B 1 40 MET 40 250 250 MET MET B . n B 1 41 ILE 41 251 251 ILE ILE B . n B 1 42 ILE 42 252 252 ILE ILE B . n B 1 43 GLY 43 253 253 GLY GLY B . n B 1 44 VAL 44 254 254 VAL VAL B . n B 1 45 ASP 45 255 255 ASP ASP B . n B 1 46 PRO 46 256 256 PRO PRO B . n B 1 47 GLU 47 257 257 GLU GLU B . n B 1 48 ASN 48 258 258 ASN ASN B . n B 1 49 THR 49 259 259 THR THR B . n B 1 50 VAL 50 260 260 VAL VAL B . n B 1 51 GLU 51 261 261 GLU GLU B . n B 1 52 GLN 52 262 262 GLN GLN B . n B 1 53 ALA 53 263 263 ALA ALA B . n B 1 54 HIS 54 264 264 HIS HIS B . n B 1 55 GLU 55 265 265 GLU GLU B . n B 1 56 ILE 56 266 266 ILE ILE B . n B 1 57 CYS 57 267 267 CYS CYS B . n B 1 58 GLU 58 268 268 GLU GLU B . n B 1 59 ALA 59 269 269 ALA ALA B . n B 1 60 VAL 60 270 270 VAL VAL B . n B 1 61 GLN 61 271 271 GLN GLN B . n B 1 62 ALA 62 272 272 ALA ALA B . n B 1 63 ALA 63 273 273 ALA ALA B . n B 1 64 VAL 64 274 274 VAL VAL B . n B 1 65 CYS 65 275 275 CYS CYS B . n B 1 66 GLY 66 276 276 GLY GLY B . n B 1 67 LYS 67 277 277 LYS LYS B . n B 1 68 ILE 68 278 278 ILE ILE B . n B 1 69 ARG 69 279 279 ARG ARG B . n B 1 70 ARG 70 280 280 ARG ARG B . n B 1 71 ILE 71 281 281 ILE ILE B . n B 1 72 GLU 72 282 282 GLU GLU B . n B 1 73 SER 73 283 283 SER SER B . n B 1 74 LEU 74 284 284 LEU LEU B . n B 1 75 HIS 75 285 285 HIS HIS B . n B 1 76 VAL 76 286 286 VAL VAL B . n B 1 77 SER 77 287 287 SER SER B . n B 1 78 ALA 78 288 288 ALA ALA B . n B 1 79 GLU 79 289 289 GLU GLU B . n B 1 80 ALA 80 290 290 ALA ALA B . n B 1 81 ARG 81 291 291 ARG ARG B . n B 1 82 GLU 82 292 292 GLU GLU B . n B 1 83 ILE 83 293 293 ILE ILE B . n B 1 84 GLY 84 294 294 GLY GLY B . n B 1 85 ASP 85 295 295 ASP ASP B . n B 1 86 THR 86 296 296 THR THR B . n B 1 87 THR 87 297 297 THR THR B . n B 1 88 LYS 88 298 298 LYS LYS B . n B 1 89 PRO 89 299 299 PRO PRO B . n B 1 90 SER 90 300 300 SER SER B . n B 1 91 PHE 91 301 301 PHE PHE B . n B 1 92 SER 92 302 ? ? ? B . n B 1 93 ASP 93 303 ? ? ? B . n B 1 94 GLN 94 304 ? ? ? B . n B 1 95 PRO 95 305 ? ? ? B . n B 1 96 LEU 96 306 ? ? ? B . n B 1 97 SER 97 307 ? ? ? B . n B 1 98 PHE 98 308 ? ? ? B . n B 1 99 ASP 99 309 ? ? ? B . n B 1 100 GLU 100 310 ? ? ? B . n B 1 101 VAL 101 311 ? ? ? B . n B 1 102 MET 102 312 ? ? ? B . n B 1 103 LEU 103 313 ? ? ? B . n B 1 104 SER 104 314 ? ? ? B . n B 1 105 LYS 105 315 ? ? ? B . n B 1 106 VAL 106 316 ? ? ? B . n B 1 107 ASP 107 317 ? ? ? B . n B 1 108 ASN 108 318 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CU 1 401 2 CU CU A . D 2 CU 1 402 4 CU CU A . E 3 BME 1 403 1 BME BME A . F 2 CU 1 401 3 CU CU B . G 4 HOH 1 501 19 HOH HOH A . G 4 HOH 2 502 15 HOH HOH A . G 4 HOH 3 503 14 HOH HOH A . G 4 HOH 4 504 2 HOH HOH A . G 4 HOH 5 505 20 HOH HOH A . G 4 HOH 6 506 16 HOH HOH A . G 4 HOH 7 507 1 HOH HOH A . G 4 HOH 8 508 21 HOH HOH A . G 4 HOH 9 509 9 HOH HOH A . G 4 HOH 10 510 10 HOH HOH A . G 4 HOH 11 511 5 HOH HOH A . G 4 HOH 12 512 13 HOH HOH A . G 4 HOH 13 513 6 HOH HOH A . G 4 HOH 14 514 18 HOH HOH A . H 4 HOH 1 501 7 HOH HOH B . H 4 HOH 2 502 17 HOH HOH B . H 4 HOH 3 503 4 HOH HOH B . H 4 HOH 4 504 11 HOH HOH B . H 4 HOH 5 505 8 HOH HOH B . H 4 HOH 6 506 12 HOH HOH B . H 4 HOH 7 507 3 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6GP6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 28.930 _cell.length_a_esd ? _cell.length_b 73.750 _cell.length_b_esd ? _cell.length_c 89.410 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GP6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 2 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GP6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M NaCl, 0.1M Tris pH=8.7, 25% PEG 3350, 1.7 mM CuSO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-23 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96771 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96771 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 31.350 _reflns.entry_id 6GP6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.140 _reflns.d_resolution_low 44.710 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11127 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.800 _reflns.pdbx_Rmerge_I_obs 0.106 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.118 _reflns.pdbx_Rpim_I_all 0.049 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 64227 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.140 2.200 ? ? 5042 ? ? ? 864 96.900 ? ? ? ? 1.863 ? ? ? ? ? ? ? ? 5.800 ? ? ? 1.000 2.044 0.828 ? 1 1 0.436 ? 9.080 44.710 ? ? 841 ? ? ? 184 98.100 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 4.600 ? ? ? 22.100 0.055 0.024 ? 2 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 144.300 _refine.B_iso_mean 43.6275 _refine.B_iso_min 17.880 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GP6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1460 _refine.ls_d_res_low 44.7050 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8919 _refine.ls_number_reflns_R_free 419 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 80.6700 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2231 _refine.ls_R_factor_R_free 0.2751 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2201 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3W5X _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.3900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1460 _refine_hist.d_res_low 44.7050 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1523 _refine_hist.pdbx_number_residues_total 194 _refine_hist.pdbx_B_iso_mean_ligand 62.01 _refine_hist.pdbx_B_iso_mean_solvent 41.44 _refine_hist.pdbx_number_atoms_protein 1495 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1537 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.076 ? 2081 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.065 ? 237 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 278 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.662 ? 1103 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 751 15.820 ? ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 751 15.820 ? ? ? ? ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1465 2.4571 1557 . 71 1486 43.0000 . . . 0.3451 0.0000 0.2561 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.4571 3.0956 3551 . 167 3384 98.0000 . . . 0.3182 0.0000 0.2680 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.0956 44.7147 3811 . 181 3630 100.0000 . . . 0.2514 0.0000 0.1957 . . . . . . 3 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 '(chain A and (resid 212 through 237 or resid 239 through 258 or resid 260 through 301))' 1 2 '(chain B and (resid 212 through 237 or resid 239 through 258 or resid 260 through 301))' # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 2 . A LEU 27 . A SER 212 A LEU 237 ? '(chain A and (resid 212 through 237 or resid 239 through 258 or resid 260 through 301))' 1 1 2 A ALA 29 . A ASN 48 . A ALA 239 A ASN 258 ? '(chain A and (resid 212 through 237 or resid 239 through 258 or resid 260 through 301))' 1 1 3 A VAL 50 . A PHE 91 . A VAL 260 A PHE 301 ? '(chain A and (resid 212 through 237 or resid 239 through 258 or resid 260 through 301))' 1 2 1 B SER 2 . B LEU 27 . B SER 212 B LEU 237 ? '(chain B and (resid 212 through 237 or resid 239 through 258 or resid 260 through 301))' 1 2 2 B ALA 29 . B ASN 48 . B ALA 239 B ASN 258 ? '(chain B and (resid 212 through 237 or resid 239 through 258 or resid 260 through 301))' 1 2 3 B VAL 50 . B PHE 91 . B VAL 260 B PHE 301 ? '(chain B and (resid 212 through 237 or resid 239 through 258 or resid 260 through 301))' # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6GP6 _struct.title 'MamM CTD - Copper form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GP6 _struct_keywords.text 'Cation diffusion facilitator, magnetotactic bacteria, METAL TRANSPORT' _struct_keywords.pdbx_keywords 'METAL TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 2 ? G N N 4 ? H N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6NE57_9PROT _struct_ref.pdbx_db_accession Q6NE57 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWADMIIGVDPENTVEQAHEICEAVQAAVCGKIRRIESLHVSAEAREIG DTTKPSFSDQPLSFDEVMLSKVDN ; _struct_ref.pdbx_align_begin 215 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6GP6 A 5 ? 108 ? Q6NE57 215 ? 318 ? 215 318 2 1 6GP6 B 5 ? 108 ? Q6NE57 215 ? 318 ? 215 318 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6GP6 GLY A 1 ? UNP Q6NE57 ? ? 'expression tag' 211 1 1 6GP6 SER A 2 ? UNP Q6NE57 ? ? 'expression tag' 212 2 1 6GP6 HIS A 3 ? UNP Q6NE57 ? ? 'expression tag' 213 3 1 6GP6 MET A 4 ? UNP Q6NE57 ? ? 'expression tag' 214 4 2 6GP6 GLY B 1 ? UNP Q6NE57 ? ? 'expression tag' 211 5 2 6GP6 SER B 2 ? UNP Q6NE57 ? ? 'expression tag' 212 6 2 6GP6 HIS B 3 ? UNP Q6NE57 ? ? 'expression tag' 213 7 2 6GP6 MET B 4 ? UNP Q6NE57 ? ? 'expression tag' 214 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2090 ? 1 MORE -36 ? 1 'SSA (A^2)' 10590 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 4 ? ARG A 17 ? MET A 214 ARG A 227 1 ? 14 HELX_P HELX_P2 AA2 THR A 49 ? ARG A 69 ? THR A 259 ARG A 279 1 ? 21 HELX_P HELX_P3 AA3 SER A 97 ? SER A 104 ? SER A 307 SER A 314 1 ? 8 HELX_P HELX_P4 AA4 HIS B 3 ? ARG B 17 ? HIS B 213 ARG B 227 1 ? 15 HELX_P HELX_P5 AA5 THR B 49 ? ILE B 68 ? THR B 259 ILE B 278 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 264 A CU 401 1_555 ? ? ? ? ? ? ? 2.162 ? ? metalc2 metalc ? ? A HIS 75 NE2 ? ? ? 1_555 D CU . CU ? ? A HIS 285 A CU 402 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc3 metalc ? ? C CU . CU ? ? ? 1_555 H HOH . O ? ? A CU 401 B HOH 506 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc4 metalc ? ? D CU . CU ? ? ? 1_555 B HIS 75 NE2 ? ? A CU 402 B HIS 285 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc5 metalc ? ? D CU . CU ? ? ? 1_555 H HOH . O ? ? A CU 402 B HOH 507 1_555 ? ? ? ? ? ? ? 2.700 ? ? metalc6 metalc ? ? B HIS 54 NE2 ? ? ? 1_555 F CU . CU ? ? B HIS 264 B CU 401 1_555 ? ? ? ? ? ? ? 2.487 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 54 ? A HIS 264 ? 1_555 CU ? C CU . ? A CU 401 ? 1_555 O ? H HOH . ? B HOH 506 ? 1_555 153.2 ? 2 NE2 ? A HIS 75 ? A HIS 285 ? 1_555 CU ? D CU . ? A CU 402 ? 1_555 NE2 ? B HIS 75 ? B HIS 285 ? 1_555 90.5 ? 3 NE2 ? A HIS 75 ? A HIS 285 ? 1_555 CU ? D CU . ? A CU 402 ? 1_555 O ? H HOH . ? B HOH 507 ? 1_555 141.6 ? 4 NE2 ? B HIS 75 ? B HIS 285 ? 1_555 CU ? D CU . ? A CU 402 ? 1_555 O ? H HOH . ? B HOH 507 ? 1_555 106.2 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 71 ? ALA A 80 ? ILE A 281 ALA A 290 AA1 2 ASP A 35 ? VAL A 44 ? ASP A 245 VAL A 254 AA1 3 VAL A 24 ? VAL A 32 ? VAL A 234 VAL A 242 AA1 4 SER A 90 ? SER A 92 ? SER A 300 SER A 302 AA2 1 VAL B 24 ? VAL B 32 ? VAL B 234 VAL B 242 AA2 2 ASP B 35 ? VAL B 44 ? ASP B 245 VAL B 254 AA2 3 ILE B 71 ? ALA B 80 ? ILE B 281 ALA B 290 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 75 ? O HIS A 285 N MET A 40 ? N MET A 250 AA1 2 3 O TRP A 37 ? O TRP A 247 N ARG A 30 ? N ARG A 240 AA1 3 4 N ILE A 25 ? N ILE A 235 O SER A 90 ? O SER A 300 AA2 1 2 N HIS B 26 ? N HIS B 236 O ILE B 41 ? O ILE B 251 AA2 2 3 N VAL B 44 ? N VAL B 254 O GLU B 79 ? O GLU B 289 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU 401 ? 3 'binding site for residue CU A 401' AC2 Software A CU 402 ? 3 'binding site for residue CU A 402' AC3 Software A BME 403 ? 4 'binding site for residue BME A 403' AC4 Software B CU 401 ? 2 'binding site for residue CU B 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 54 ? HIS A 264 . ? 1_555 ? 2 AC1 3 HOH G . ? HOH A 514 . ? 1_555 ? 3 AC1 3 HOH H . ? HOH B 506 . ? 1_555 ? 4 AC2 3 HIS A 75 ? HIS A 285 . ? 1_555 ? 5 AC2 3 HIS B 75 ? HIS B 285 . ? 1_555 ? 6 AC2 3 HOH H . ? HOH B 507 . ? 1_555 ? 7 AC3 4 HIS A 54 ? HIS A 264 . ? 1_555 ? 8 AC3 4 CYS A 57 ? CYS A 267 . ? 1_555 ? 9 AC3 4 SER A 77 ? SER A 287 . ? 1_555 ? 10 AC3 4 ALA A 78 ? ALA A 288 . ? 1_555 ? 11 AC4 2 HIS B 54 ? HIS B 264 . ? 1_555 ? 12 AC4 2 GLU B 58 ? GLU B 268 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HIS 213 ? ? O A HOH 501 ? ? 2.05 2 1 NH1 A ARG 291 ? ? O A THR 296 ? ? 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 232 ? ? -98.18 57.81 2 1 ARG A 279 ? ? 65.61 -15.81 3 1 THR A 296 ? ? -109.76 -94.80 4 1 THR A 297 ? ? 52.37 96.24 5 1 ARG B 232 ? ? -102.15 57.89 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -1.6872 _pdbx_refine_tls.origin_y -15.8303 _pdbx_refine_tls.origin_z 34.7260 _pdbx_refine_tls.T[1][1] 0.2509 _pdbx_refine_tls.T[2][2] 0.1884 _pdbx_refine_tls.T[3][3] 0.2661 _pdbx_refine_tls.T[1][2] 0.0162 _pdbx_refine_tls.T[1][3] 0.1285 _pdbx_refine_tls.T[2][3] -0.0177 _pdbx_refine_tls.L[1][1] 0.8908 _pdbx_refine_tls.L[2][2] 2.4589 _pdbx_refine_tls.L[3][3] 2.5525 _pdbx_refine_tls.L[1][2] -0.1281 _pdbx_refine_tls.L[1][3] 0.2964 _pdbx_refine_tls.L[2][3] -0.4686 _pdbx_refine_tls.S[1][1] 0.0593 _pdbx_refine_tls.S[2][2] 0.0352 _pdbx_refine_tls.S[3][3] -0.0706 _pdbx_refine_tls.S[1][2] -0.1085 _pdbx_refine_tls.S[1][3] 0.1033 _pdbx_refine_tls.S[2][3] 0.0053 _pdbx_refine_tls.S[2][1] 0.2721 _pdbx_refine_tls.S[3][1] -0.0215 _pdbx_refine_tls.S[3][2] -0.1851 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 212 A 314 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 B 211 B 301 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 C 2 C 2 all ? ? ? ? ? 'X-RAY DIFFRACTION' 4 1 C 3 C 4 all ? ? ? ? ? 'X-RAY DIFFRACTION' 5 1 D 1 D 21 all ? ? ? ? ? 'X-RAY DIFFRACTION' 6 1 E 1 E 1 all ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 211 ? A GLY 1 2 1 Y 1 A LYS 315 ? A LYS 105 3 1 Y 1 A VAL 316 ? A VAL 106 4 1 Y 1 A ASP 317 ? A ASP 107 5 1 Y 1 A ASN 318 ? A ASN 108 6 1 Y 1 B SER 302 ? B SER 92 7 1 Y 1 B ASP 303 ? B ASP 93 8 1 Y 1 B GLN 304 ? B GLN 94 9 1 Y 1 B PRO 305 ? B PRO 95 10 1 Y 1 B LEU 306 ? B LEU 96 11 1 Y 1 B SER 307 ? B SER 97 12 1 Y 1 B PHE 308 ? B PHE 98 13 1 Y 1 B ASP 309 ? B ASP 99 14 1 Y 1 B GLU 310 ? B GLU 100 15 1 Y 1 B VAL 311 ? B VAL 101 16 1 Y 1 B MET 312 ? B MET 102 17 1 Y 1 B LEU 313 ? B LEU 103 18 1 Y 1 B SER 314 ? B SER 104 19 1 Y 1 B LYS 315 ? B LYS 105 20 1 Y 1 B VAL 316 ? B VAL 106 21 1 Y 1 B ASP 317 ? B ASP 107 22 1 Y 1 B ASN 318 ? B ASN 108 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BME C1 C N N 74 BME C2 C N N 75 BME O1 O N N 76 BME S2 S N N 77 BME H11 H N N 78 BME H12 H N N 79 BME H21 H N N 80 BME H22 H N N 81 BME HO1 H N N 82 BME HS2 H N N 83 CU CU CU N N 84 CYS N N N N 85 CYS CA C N R 86 CYS C C N N 87 CYS O O N N 88 CYS CB C N N 89 CYS SG S N N 90 CYS OXT O N N 91 CYS H H N N 92 CYS H2 H N N 93 CYS HA H N N 94 CYS HB2 H N N 95 CYS HB3 H N N 96 CYS HG H N N 97 CYS HXT H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PRO N N N N 284 PRO CA C N S 285 PRO C C N N 286 PRO O O N N 287 PRO CB C N N 288 PRO CG C N N 289 PRO CD C N N 290 PRO OXT O N N 291 PRO H H N N 292 PRO HA H N N 293 PRO HB2 H N N 294 PRO HB3 H N N 295 PRO HG2 H N N 296 PRO HG3 H N N 297 PRO HD2 H N N 298 PRO HD3 H N N 299 PRO HXT H N N 300 SER N N N N 301 SER CA C N S 302 SER C C N N 303 SER O O N N 304 SER CB C N N 305 SER OG O N N 306 SER OXT O N N 307 SER H H N N 308 SER H2 H N N 309 SER HA H N N 310 SER HB2 H N N 311 SER HB3 H N N 312 SER HG H N N 313 SER HXT H N N 314 THR N N N N 315 THR CA C N S 316 THR C C N N 317 THR O O N N 318 THR CB C N R 319 THR OG1 O N N 320 THR CG2 C N N 321 THR OXT O N N 322 THR H H N N 323 THR H2 H N N 324 THR HA H N N 325 THR HB H N N 326 THR HG1 H N N 327 THR HG21 H N N 328 THR HG22 H N N 329 THR HG23 H N N 330 THR HXT H N N 331 TRP N N N N 332 TRP CA C N S 333 TRP C C N N 334 TRP O O N N 335 TRP CB C N N 336 TRP CG C Y N 337 TRP CD1 C Y N 338 TRP CD2 C Y N 339 TRP NE1 N Y N 340 TRP CE2 C Y N 341 TRP CE3 C Y N 342 TRP CZ2 C Y N 343 TRP CZ3 C Y N 344 TRP CH2 C Y N 345 TRP OXT O N N 346 TRP H H N N 347 TRP H2 H N N 348 TRP HA H N N 349 TRP HB2 H N N 350 TRP HB3 H N N 351 TRP HD1 H N N 352 TRP HE1 H N N 353 TRP HE3 H N N 354 TRP HZ2 H N N 355 TRP HZ3 H N N 356 TRP HH2 H N N 357 TRP HXT H N N 358 TYR N N N N 359 TYR CA C N S 360 TYR C C N N 361 TYR O O N N 362 TYR CB C N N 363 TYR CG C Y N 364 TYR CD1 C Y N 365 TYR CD2 C Y N 366 TYR CE1 C Y N 367 TYR CE2 C Y N 368 TYR CZ C Y N 369 TYR OH O N N 370 TYR OXT O N N 371 TYR H H N N 372 TYR H2 H N N 373 TYR HA H N N 374 TYR HB2 H N N 375 TYR HB3 H N N 376 TYR HD1 H N N 377 TYR HD2 H N N 378 TYR HE1 H N N 379 TYR HE2 H N N 380 TYR HH H N N 381 TYR HXT H N N 382 VAL N N N N 383 VAL CA C N S 384 VAL C C N N 385 VAL O O N N 386 VAL CB C N N 387 VAL CG1 C N N 388 VAL CG2 C N N 389 VAL OXT O N N 390 VAL H H N N 391 VAL H2 H N N 392 VAL HA H N N 393 VAL HB H N N 394 VAL HG11 H N N 395 VAL HG12 H N N 396 VAL HG13 H N N 397 VAL HG21 H N N 398 VAL HG22 H N N 399 VAL HG23 H N N 400 VAL HXT H N N 401 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BME C1 C2 sing N N 70 BME C1 O1 sing N N 71 BME C1 H11 sing N N 72 BME C1 H12 sing N N 73 BME C2 S2 sing N N 74 BME C2 H21 sing N N 75 BME C2 H22 sing N N 76 BME O1 HO1 sing N N 77 BME S2 HS2 sing N N 78 CYS N CA sing N N 79 CYS N H sing N N 80 CYS N H2 sing N N 81 CYS CA C sing N N 82 CYS CA CB sing N N 83 CYS CA HA sing N N 84 CYS C O doub N N 85 CYS C OXT sing N N 86 CYS CB SG sing N N 87 CYS CB HB2 sing N N 88 CYS CB HB3 sing N N 89 CYS SG HG sing N N 90 CYS OXT HXT sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal ? Israel 'Israel Science Foundation 167/16' 1 ? Israel 'Israel Ministry of Science, Technology and Space' 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3W5X _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6GP6 _atom_sites.fract_transf_matrix[1][1] 0.034566 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013559 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011184 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CU N O S # loop_