data_6GPZ # _entry.id 6GPZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6GPZ pdb_00006gpz 10.2210/pdb6gpz/pdb WWPDB D_1200010381 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-23 2 'Structure model' 1 1 2019-01-30 3 'Structure model' 1 2 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 27 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 28 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 29 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 30 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 31 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 32 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 33 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 34 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 35 3 'Structure model' '_pdbx_struct_conn_angle.value' 36 3 'Structure model' '_struct_conn.pdbx_dist_value' 37 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 38 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 39 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 40 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 41 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 42 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 43 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 44 3 'Structure model' '_struct_conn.ptnr1_symmetry' 45 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 46 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 47 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 48 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 49 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 50 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 51 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 52 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6GPZ _pdbx_database_status.recvd_initial_deposition_date 2018-06-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cleverley, R.M.' 1 ? 'Lewis, R.J.' 2 ? 'Rutter, Z.J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 261 _citation.page_last 261 _citation.title 'The cell cycle regulator GpsB functions as cytosolic adaptor for multiple cell wall enzymes.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-018-08056-2 _citation.pdbx_database_id_PubMed 30651563 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cleverley, R.M.' 1 ? primary 'Rutter, Z.J.' 2 ? primary 'Rismondo, J.' 3 ? primary 'Corona, F.' 4 ? primary 'Tsui, H.T.' 5 0000-0003-0849-874X primary 'Alatawi, F.A.' 6 ? primary 'Daniel, R.A.' 7 0000-0002-6483-5897 primary 'Halbedel, S.' 8 0000-0002-5575-8973 primary 'Massidda, O.' 9 0000-0001-8823-2372 primary 'Winkler, M.E.' 10 0000-0002-1482-2588 primary 'Lewis, R.J.' 11 0000-0003-2641-8643 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cell cycle protein GpsB' 7610.618 2 ? K32E ? ? 2 polymer syn LmPBPA1 1855.083 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 8 ? ? ? ? 4 non-polymer syn IMIDAZOLE 69.085 1 ? ? ? ? 5 water nat water 18.015 106 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Guiding PBP1-shuttling protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEELQQENLQLKKQLEE GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEELQQENLQLKKQLEE B,A ? 2 'polypeptide(L)' no no MADKPQTRSQYRNKQ MADKPQTRSQYRNKQ E ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 IMIDAZOLE IMD 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 LYS n 1 5 VAL n 1 6 LYS n 1 7 LEU n 1 8 SER n 1 9 ALA n 1 10 LYS n 1 11 GLU n 1 12 ILE n 1 13 LEU n 1 14 GLU n 1 15 LYS n 1 16 GLU n 1 17 PHE n 1 18 LYS n 1 19 THR n 1 20 GLY n 1 21 VAL n 1 22 ARG n 1 23 GLY n 1 24 TYR n 1 25 LYS n 1 26 GLN n 1 27 GLU n 1 28 ASP n 1 29 VAL n 1 30 ASP n 1 31 GLU n 1 32 PHE n 1 33 LEU n 1 34 ASP n 1 35 MET n 1 36 ILE n 1 37 ILE n 1 38 LYS n 1 39 ASP n 1 40 TYR n 1 41 GLU n 1 42 THR n 1 43 PHE n 1 44 HIS n 1 45 GLN n 1 46 GLU n 1 47 ILE n 1 48 GLU n 1 49 GLU n 1 50 LEU n 1 51 GLN n 1 52 GLN n 1 53 GLU n 1 54 ASN n 1 55 LEU n 1 56 GLN n 1 57 LEU n 1 58 LYS n 1 59 LYS n 1 60 GLN n 1 61 LEU n 1 62 GLU n 1 63 GLU n 2 1 MET n 2 2 ALA n 2 3 ASP n 2 4 LYS n 2 5 PRO n 2 6 GLN n 2 7 THR n 2 8 ARG n 2 9 SER n 2 10 GLN n 2 11 TYR n 2 12 ARG n 2 13 ASN n 2 14 LYS n 2 15 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 63 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'gpsB, ypsB, BSU22180' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name ' Bacillus subtilis subsp. subtilis str. 168' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Listeria monocytogenes' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1639 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY B . n A 1 2 HIS 2 -1 -1 HIS HIS B . n A 1 3 MET 3 0 0 MET MET B . n A 1 4 LYS 4 5 5 LYS LYS B . n A 1 5 VAL 5 6 6 VAL VAL B . n A 1 6 LYS 6 7 7 LYS LYS B . n A 1 7 LEU 7 8 8 LEU LEU B . n A 1 8 SER 8 9 9 SER SER B . n A 1 9 ALA 9 10 10 ALA ALA B . n A 1 10 LYS 10 11 11 LYS LYS B . n A 1 11 GLU 11 12 12 GLU GLU B . n A 1 12 ILE 12 13 13 ILE ILE B . n A 1 13 LEU 13 14 14 LEU LEU B . n A 1 14 GLU 14 15 15 GLU GLU B . n A 1 15 LYS 15 16 16 LYS LYS B . n A 1 16 GLU 16 17 17 GLU GLU B . n A 1 17 PHE 17 18 18 PHE PHE B . n A 1 18 LYS 18 19 19 LYS LYS B . n A 1 19 THR 19 20 20 THR THR B . n A 1 20 GLY 20 21 21 GLY GLY B . n A 1 21 VAL 21 22 22 VAL VAL B . n A 1 22 ARG 22 23 23 ARG ARG B . n A 1 23 GLY 23 24 24 GLY GLY B . n A 1 24 TYR 24 25 25 TYR TYR B . n A 1 25 LYS 25 26 26 LYS LYS B . n A 1 26 GLN 26 27 27 GLN GLN B . n A 1 27 GLU 27 28 28 GLU GLU B . n A 1 28 ASP 28 29 29 ASP ASP B . n A 1 29 VAL 29 30 30 VAL VAL B . n A 1 30 ASP 30 31 31 ASP ASP B . n A 1 31 GLU 31 32 32 GLU GLU B . n A 1 32 PHE 32 33 33 PHE PHE B . n A 1 33 LEU 33 34 34 LEU LEU B . n A 1 34 ASP 34 35 35 ASP ASP B . n A 1 35 MET 35 36 36 MET MET B . n A 1 36 ILE 36 37 37 ILE ILE B . n A 1 37 ILE 37 38 38 ILE ILE B . n A 1 38 LYS 38 39 39 LYS LYS B . n A 1 39 ASP 39 40 40 ASP ASP B . n A 1 40 TYR 40 41 41 TYR TYR B . n A 1 41 GLU 41 42 42 GLU GLU B . n A 1 42 THR 42 43 43 THR THR B . n A 1 43 PHE 43 44 44 PHE PHE B . n A 1 44 HIS 44 45 45 HIS HIS B . n A 1 45 GLN 45 46 46 GLN GLN B . n A 1 46 GLU 46 47 47 GLU GLU B . n A 1 47 ILE 47 48 48 ILE ILE B . n A 1 48 GLU 48 49 49 GLU GLU B . n A 1 49 GLU 49 50 50 GLU GLU B . n A 1 50 LEU 50 51 51 LEU LEU B . n A 1 51 GLN 51 52 52 GLN GLN B . n A 1 52 GLN 52 53 53 GLN GLN B . n A 1 53 GLU 53 54 54 GLU GLU B . n A 1 54 ASN 54 55 55 ASN ASN B . n A 1 55 LEU 55 56 56 LEU LEU B . n A 1 56 GLN 56 57 57 GLN GLN B . n A 1 57 LEU 57 58 58 LEU LEU B . n A 1 58 LYS 58 59 59 LYS LYS B . n A 1 59 LYS 59 60 60 LYS LYS B . n A 1 60 GLN 60 61 61 GLN GLN B . n A 1 61 LEU 61 62 62 LEU LEU B . n A 1 62 GLU 62 63 63 GLU GLU B . n A 1 63 GLU 63 64 ? ? ? B . n B 1 1 GLY 1 -2 -2 GLY GLY A . n B 1 2 HIS 2 -1 -1 HIS HIS A . n B 1 3 MET 3 0 0 MET MET A . n B 1 4 LYS 4 5 5 LYS LYS A . n B 1 5 VAL 5 6 6 VAL VAL A . n B 1 6 LYS 6 7 7 LYS LYS A . n B 1 7 LEU 7 8 8 LEU LEU A . n B 1 8 SER 8 9 9 SER SER A . n B 1 9 ALA 9 10 10 ALA ALA A . n B 1 10 LYS 10 11 11 LYS LYS A . n B 1 11 GLU 11 12 12 GLU GLU A . n B 1 12 ILE 12 13 13 ILE ILE A . n B 1 13 LEU 13 14 14 LEU LEU A . n B 1 14 GLU 14 15 15 GLU GLU A . n B 1 15 LYS 15 16 16 LYS LYS A . n B 1 16 GLU 16 17 17 GLU GLU A . n B 1 17 PHE 17 18 18 PHE PHE A . n B 1 18 LYS 18 19 19 LYS LYS A . n B 1 19 THR 19 20 20 THR THR A . n B 1 20 GLY 20 21 21 GLY GLY A . n B 1 21 VAL 21 22 22 VAL VAL A . n B 1 22 ARG 22 23 23 ARG ARG A . n B 1 23 GLY 23 24 24 GLY GLY A . n B 1 24 TYR 24 25 25 TYR TYR A . n B 1 25 LYS 25 26 26 LYS LYS A . n B 1 26 GLN 26 27 27 GLN GLN A . n B 1 27 GLU 27 28 28 GLU GLU A . n B 1 28 ASP 28 29 29 ASP ASP A . n B 1 29 VAL 29 30 30 VAL VAL A . n B 1 30 ASP 30 31 31 ASP ASP A . n B 1 31 GLU 31 32 32 GLU GLU A . n B 1 32 PHE 32 33 33 PHE PHE A . n B 1 33 LEU 33 34 34 LEU LEU A . n B 1 34 ASP 34 35 35 ASP ASP A . n B 1 35 MET 35 36 36 MET MET A . n B 1 36 ILE 36 37 37 ILE ILE A . n B 1 37 ILE 37 38 38 ILE ILE A . n B 1 38 LYS 38 39 39 LYS LYS A . n B 1 39 ASP 39 40 40 ASP ASP A . n B 1 40 TYR 40 41 41 TYR TYR A . n B 1 41 GLU 41 42 42 GLU GLU A . n B 1 42 THR 42 43 43 THR THR A . n B 1 43 PHE 43 44 44 PHE PHE A . n B 1 44 HIS 44 45 45 HIS HIS A . n B 1 45 GLN 45 46 46 GLN GLN A . n B 1 46 GLU 46 47 47 GLU GLU A . n B 1 47 ILE 47 48 48 ILE ILE A . n B 1 48 GLU 48 49 49 GLU GLU A . n B 1 49 GLU 49 50 50 GLU GLU A . n B 1 50 LEU 50 51 51 LEU LEU A . n B 1 51 GLN 51 52 52 GLN GLN A . n B 1 52 GLN 52 53 53 GLN GLN A . n B 1 53 GLU 53 54 54 GLU GLU A . n B 1 54 ASN 54 55 55 ASN ASN A . n B 1 55 LEU 55 56 56 LEU LEU A . n B 1 56 GLN 56 57 57 GLN GLN A . n B 1 57 LEU 57 58 58 LEU LEU A . n B 1 58 LYS 58 59 59 LYS LYS A . n B 1 59 LYS 59 60 60 LYS LYS A . n B 1 60 GLN 60 61 61 GLN GLN A . n B 1 61 LEU 61 62 62 LEU LEU A . n B 1 62 GLU 62 63 63 GLU GLU A . n B 1 63 GLU 63 64 64 GLU GLU A . n C 2 1 MET 1 1 ? ? ? E . n C 2 2 ALA 2 2 ? ? ? E . n C 2 3 ASP 3 3 ? ? ? E . n C 2 4 LYS 4 4 ? ? ? E . n C 2 5 PRO 5 5 ? ? ? E . n C 2 6 GLN 6 6 ? ? ? E . n C 2 7 THR 7 7 7 THR THR E . n C 2 8 ARG 8 8 8 ARG ARG E . n C 2 9 SER 9 9 9 SER SER E . n C 2 10 GLN 10 10 ? ? ? E . n C 2 11 TYR 11 11 ? ? ? E . n C 2 12 ARG 12 12 ? ? ? E . n C 2 13 ASN 13 13 ? ? ? E . n C 2 14 LYS 14 14 ? ? ? E . n C 2 15 GLN 15 15 ? ? ? E . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 ZN 1 101 24 ZN ZN B . E 3 ZN 1 102 28 ZN ZN B . F 3 ZN 1 103 29 ZN ZN B . G 3 ZN 1 104 33 ZN ZN B . H 3 ZN 1 105 39 ZN ZN B . I 4 IMD 1 106 1 IMD IMD B . J 3 ZN 1 101 37 ZN ZN A . K 3 ZN 1 102 40 ZN ZN A . L 3 ZN 1 103 41 ZN ZN A . M 5 HOH 1 201 48 HOH HOH B . M 5 HOH 2 202 61 HOH HOH B . M 5 HOH 3 203 73 HOH HOH B . M 5 HOH 4 204 94 HOH HOH B . M 5 HOH 5 205 72 HOH HOH B . M 5 HOH 6 206 1 HOH HOH B . M 5 HOH 7 207 10 HOH HOH B . M 5 HOH 8 208 33 HOH HOH B . M 5 HOH 9 209 7 HOH HOH B . M 5 HOH 10 210 28 HOH HOH B . M 5 HOH 11 211 13 HOH HOH B . M 5 HOH 12 212 31 HOH HOH B . M 5 HOH 13 213 11 HOH HOH B . M 5 HOH 14 214 98 HOH HOH B . M 5 HOH 15 215 47 HOH HOH B . M 5 HOH 16 216 30 HOH HOH B . M 5 HOH 17 217 93 HOH HOH B . M 5 HOH 18 218 96 HOH HOH B . M 5 HOH 19 219 42 HOH HOH B . M 5 HOH 20 220 16 HOH HOH B . M 5 HOH 21 221 49 HOH HOH B . M 5 HOH 22 222 27 HOH HOH B . M 5 HOH 23 223 66 HOH HOH B . M 5 HOH 24 224 9 HOH HOH B . M 5 HOH 25 225 53 HOH HOH B . M 5 HOH 26 226 108 HOH HOH B . M 5 HOH 27 227 77 HOH HOH B . M 5 HOH 28 228 111 HOH HOH B . M 5 HOH 29 229 63 HOH HOH B . M 5 HOH 30 230 6 HOH HOH B . M 5 HOH 31 231 60 HOH HOH B . M 5 HOH 32 232 64 HOH HOH B . M 5 HOH 33 233 70 HOH HOH B . M 5 HOH 34 234 89 HOH HOH B . M 5 HOH 35 235 80 HOH HOH B . M 5 HOH 36 236 90 HOH HOH B . M 5 HOH 37 237 36 HOH HOH B . M 5 HOH 38 238 86 HOH HOH B . M 5 HOH 39 239 75 HOH HOH B . M 5 HOH 40 240 97 HOH HOH B . M 5 HOH 41 241 112 HOH HOH B . M 5 HOH 42 242 95 HOH HOH B . M 5 HOH 43 243 35 HOH HOH B . M 5 HOH 44 244 69 HOH HOH B . M 5 HOH 45 245 99 HOH HOH B . M 5 HOH 46 246 76 HOH HOH B . M 5 HOH 47 247 79 HOH HOH B . M 5 HOH 48 248 19 HOH HOH B . M 5 HOH 49 249 81 HOH HOH B . M 5 HOH 50 250 46 HOH HOH B . M 5 HOH 51 251 110 HOH HOH B . M 5 HOH 52 252 114 HOH HOH B . M 5 HOH 53 253 50 HOH HOH B . N 5 HOH 1 201 43 HOH HOH A . N 5 HOH 2 202 45 HOH HOH A . N 5 HOH 3 203 21 HOH HOH A . N 5 HOH 4 204 58 HOH HOH A . N 5 HOH 5 205 34 HOH HOH A . N 5 HOH 6 206 22 HOH HOH A . N 5 HOH 7 207 29 HOH HOH A . N 5 HOH 8 208 24 HOH HOH A . N 5 HOH 9 209 17 HOH HOH A . N 5 HOH 10 210 57 HOH HOH A . N 5 HOH 11 211 23 HOH HOH A . N 5 HOH 12 212 103 HOH HOH A . N 5 HOH 13 213 55 HOH HOH A . N 5 HOH 14 214 113 HOH HOH A . N 5 HOH 15 215 12 HOH HOH A . N 5 HOH 16 216 83 HOH HOH A . N 5 HOH 17 217 15 HOH HOH A . N 5 HOH 18 218 39 HOH HOH A . N 5 HOH 19 219 74 HOH HOH A . N 5 HOH 20 220 20 HOH HOH A . N 5 HOH 21 221 54 HOH HOH A . N 5 HOH 22 222 2 HOH HOH A . N 5 HOH 23 223 59 HOH HOH A . N 5 HOH 24 224 8 HOH HOH A . N 5 HOH 25 225 18 HOH HOH A . N 5 HOH 26 226 65 HOH HOH A . N 5 HOH 27 227 14 HOH HOH A . N 5 HOH 28 228 26 HOH HOH A . N 5 HOH 29 229 3 HOH HOH A . N 5 HOH 30 230 40 HOH HOH A . N 5 HOH 31 231 91 HOH HOH A . N 5 HOH 32 232 109 HOH HOH A . N 5 HOH 33 233 82 HOH HOH A . N 5 HOH 34 234 56 HOH HOH A . N 5 HOH 35 235 67 HOH HOH A . N 5 HOH 36 236 44 HOH HOH A . N 5 HOH 37 237 4 HOH HOH A . N 5 HOH 38 238 62 HOH HOH A . N 5 HOH 39 239 32 HOH HOH A . N 5 HOH 40 240 37 HOH HOH A . N 5 HOH 41 241 25 HOH HOH A . N 5 HOH 42 242 5 HOH HOH A . N 5 HOH 43 243 104 HOH HOH A . N 5 HOH 44 244 38 HOH HOH A . N 5 HOH 45 245 41 HOH HOH A . N 5 HOH 46 246 68 HOH HOH A . N 5 HOH 47 247 78 HOH HOH A . N 5 HOH 48 248 51 HOH HOH A . N 5 HOH 49 249 52 HOH HOH A . N 5 HOH 50 250 106 HOH HOH A . N 5 HOH 51 251 87 HOH HOH A . N 5 HOH 52 252 100 HOH HOH A . O 5 HOH 1 101 84 HOH HOH E . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B LYS 5 ? CG ? A LYS 4 CG 2 1 Y 1 B LYS 5 ? CD ? A LYS 4 CD 3 1 Y 1 B LYS 5 ? CE ? A LYS 4 CE 4 1 Y 1 B LYS 5 ? NZ ? A LYS 4 NZ 5 1 Y 1 B LYS 7 ? CD ? A LYS 6 CD 6 1 Y 1 B LYS 7 ? CE ? A LYS 6 CE 7 1 Y 1 B LYS 7 ? NZ ? A LYS 6 NZ 8 1 Y 1 B LYS 11 ? CD ? A LYS 10 CD 9 1 Y 1 B LYS 11 ? CE ? A LYS 10 CE 10 1 Y 1 B LYS 11 ? NZ ? A LYS 10 NZ 11 1 Y 1 B GLU 12 ? CG ? A GLU 11 CG 12 1 Y 1 B GLU 12 ? CD ? A GLU 11 CD 13 1 Y 1 B GLU 12 ? OE1 ? A GLU 11 OE1 14 1 Y 1 B GLU 12 ? OE2 ? A GLU 11 OE2 15 1 Y 1 B GLU 17 ? CD ? A GLU 16 CD 16 1 Y 1 B GLU 17 ? OE1 ? A GLU 16 OE1 17 1 Y 1 B GLU 17 ? OE2 ? A GLU 16 OE2 18 1 Y 1 B LYS 26 ? CE ? A LYS 25 CE 19 1 Y 1 B LYS 26 ? NZ ? A LYS 25 NZ 20 1 Y 1 B LYS 39 ? CD ? A LYS 38 CD 21 1 Y 1 B LYS 39 ? CE ? A LYS 38 CE 22 1 Y 1 B LYS 39 ? NZ ? A LYS 38 NZ 23 1 Y 1 B GLN 46 ? CD ? A GLN 45 CD 24 1 Y 1 B GLN 46 ? OE1 ? A GLN 45 OE1 25 1 Y 1 B GLN 46 ? NE2 ? A GLN 45 NE2 26 1 Y 1 B GLN 53 ? CD ? A GLN 52 CD 27 1 Y 1 B GLN 53 ? OE1 ? A GLN 52 OE1 28 1 Y 1 B GLN 53 ? NE2 ? A GLN 52 NE2 29 1 Y 1 B GLN 57 ? CG ? A GLN 56 CG 30 1 Y 1 B GLN 57 ? CD ? A GLN 56 CD 31 1 Y 1 B GLN 57 ? OE1 ? A GLN 56 OE1 32 1 Y 1 B GLN 57 ? NE2 ? A GLN 56 NE2 33 1 Y 1 B LYS 59 ? CE ? A LYS 58 CE 34 1 Y 1 B LYS 59 ? NZ ? A LYS 58 NZ 35 1 Y 1 B LYS 60 ? CG ? A LYS 59 CG 36 1 Y 1 B LYS 60 ? CD ? A LYS 59 CD 37 1 Y 1 B LYS 60 ? CE ? A LYS 59 CE 38 1 Y 1 B LYS 60 ? NZ ? A LYS 59 NZ 39 1 Y 1 B GLN 61 ? CD ? A GLN 60 CD 40 1 Y 1 B GLN 61 ? OE1 ? A GLN 60 OE1 41 1 Y 1 B GLN 61 ? NE2 ? A GLN 60 NE2 42 1 Y 1 A LYS 5 ? CG ? B LYS 4 CG 43 1 Y 1 A LYS 5 ? CD ? B LYS 4 CD 44 1 Y 1 A LYS 5 ? CE ? B LYS 4 CE 45 1 Y 1 A LYS 5 ? NZ ? B LYS 4 NZ 46 1 Y 1 A LYS 19 ? CD ? B LYS 18 CD 47 1 Y 1 A LYS 19 ? CE ? B LYS 18 CE 48 1 Y 1 A LYS 19 ? NZ ? B LYS 18 NZ 49 1 Y 1 A GLU 42 ? CD ? B GLU 41 CD 50 1 Y 1 A GLU 42 ? OE1 ? B GLU 41 OE1 51 1 Y 1 A GLU 42 ? OE2 ? B GLU 41 OE2 52 1 Y 1 A GLU 49 ? CD ? B GLU 48 CD 53 1 Y 1 A GLU 49 ? OE1 ? B GLU 48 OE1 54 1 Y 1 A GLU 49 ? OE2 ? B GLU 48 OE2 55 1 Y 1 A GLN 53 ? CD ? B GLN 52 CD 56 1 Y 1 A GLN 53 ? OE1 ? B GLN 52 OE1 57 1 Y 1 A GLN 53 ? NE2 ? B GLN 52 NE2 58 1 Y 1 A GLN 57 ? CG ? B GLN 56 CG 59 1 Y 1 A GLN 57 ? CD ? B GLN 56 CD 60 1 Y 1 A GLN 57 ? OE1 ? B GLN 56 OE1 61 1 Y 1 A GLN 57 ? NE2 ? B GLN 56 NE2 62 1 Y 1 A LYS 59 ? CD ? B LYS 58 CD 63 1 Y 1 A LYS 59 ? CE ? B LYS 58 CE 64 1 Y 1 A LYS 59 ? NZ ? B LYS 58 NZ 65 1 Y 1 A LYS 60 ? CG ? B LYS 59 CG 66 1 Y 1 A LYS 60 ? CD ? B LYS 59 CD 67 1 Y 1 A LYS 60 ? CE ? B LYS 59 CE 68 1 Y 1 A LYS 60 ? NZ ? B LYS 59 NZ 69 1 Y 1 A GLU 64 ? CG ? B GLU 63 CG 70 1 Y 1 A GLU 64 ? CD ? B GLU 63 CD 71 1 Y 1 A GLU 64 ? OE1 ? B GLU 63 OE1 72 1 Y 1 A GLU 64 ? OE2 ? B GLU 63 OE2 73 1 Y 1 E SER 9 ? C ? C SER 9 C 74 1 Y 1 E SER 9 ? O ? C SER 9 O 75 1 Y 1 E SER 9 ? CB ? C SER 9 CB 76 1 Y 1 E SER 9 ? OG ? C SER 9 OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12_2829: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 92.41 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6GPZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 26.577 _cell.length_a_esd ? _cell.length_b 31.415 _cell.length_b_esd ? _cell.length_c 81.032 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6GPZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GPZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M imidazole pH 8, 0.2M zinc acetate, 20% PEG 3000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-01-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6GPZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 31.42 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17944 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.044 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 902 _reflns_shell.percent_possible_all 99.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.386 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.743 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6GPZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.600 _refine.ls_d_res_low 29.288 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17912 _refine.ls_number_reflns_R_free 835 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.71 _refine.ls_percent_reflns_R_free 4.66 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1747 _refine.ls_R_factor_R_free 0.2040 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1732 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6GP7 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.82 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1006 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 1125 _refine_hist.d_res_high 1.600 _refine_hist.d_res_low 29.288 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.016 ? 1022 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.372 ? 1368 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 4.798 ? 620 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.078 ? 154 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 178 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6000 1.7003 . . 138 2813 99.00 . . . 0.2574 . 0.2226 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7003 1.8315 . . 120 2831 100.00 . . . 0.2226 . 0.1965 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8315 2.0158 . . 137 2820 100.00 . . . 0.2164 . 0.1687 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0158 2.3074 . . 127 2853 100.00 . . . 0.2051 . 0.1516 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3074 2.9067 . . 161 2845 100.00 . . . 0.1824 . 0.1790 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9067 29.2926 . . 152 2915 100.00 . . . 0.2032 . 0.1695 . . . . . . . . . . # _struct.entry_id 6GPZ _struct.title 'Cell division regulator GpsB in complex with peptide fragment of L. monocytogenes Penicillin Binding Protein PBPA1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GPZ _struct_keywords.text ;Bacterial cell division regulator, peptidoglycan synthesis regulator, penicillin binding protein interaction partner, protein-peptide complex, CELL CYCLE ; _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 4 ? J N N 3 ? K N N 3 ? L N N 3 ? M N N 5 ? N N N 5 ? O N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GPSB_BACSU P0CI74 ? 1 KVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKKQLEE 5 2 PDB 6GPZ 6GPZ ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6GPZ B 4 ? 63 ? P0CI74 5 ? 64 ? 5 64 2 1 6GPZ A 4 ? 63 ? P0CI74 5 ? 64 ? 5 64 3 2 6GPZ E 1 ? 15 ? 6GPZ 1 ? 15 ? 1 15 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6GPZ GLY B 1 ? UNP P0CI74 ? ? 'expression tag' -2 1 1 6GPZ HIS B 2 ? UNP P0CI74 ? ? 'expression tag' -1 2 1 6GPZ MET B 3 ? UNP P0CI74 ? ? 'expression tag' 0 3 1 6GPZ GLU B 31 ? UNP P0CI74 LYS 32 'engineered mutation' 32 4 2 6GPZ GLY A 1 ? UNP P0CI74 ? ? 'expression tag' -2 5 2 6GPZ HIS A 2 ? UNP P0CI74 ? ? 'expression tag' -1 6 2 6GPZ MET A 3 ? UNP P0CI74 ? ? 'expression tag' 0 7 2 6GPZ GLU A 31 ? UNP P0CI74 LYS 32 'engineered mutation' 32 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5970 ? 1 MORE -234 ? 1 'SSA (A^2)' 7960 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Interaction of LmPBPA1 to GpsB confirmed by fluorescence polarisation' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 8 ? LYS A 15 ? SER B 9 LYS B 16 1 ? 8 HELX_P HELX_P2 AA2 LYS A 25 ? GLU A 62 ? LYS B 26 GLU B 63 1 ? 38 HELX_P HELX_P3 AA3 SER B 8 ? LYS B 15 ? SER A 9 LYS A 16 1 ? 8 HELX_P HELX_P4 AA4 LYS B 25 ? GLU B 63 ? LYS A 26 GLU A 64 1 ? 39 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLY 1 N ? ? ? 1_555 D ZN . ZN ? ? B GLY -2 B ZN 101 1_555 ? ? ? ? ? ? ? 2.035 ? ? metalc2 metalc ? ? A GLY 1 O ? ? ? 1_555 D ZN . ZN ? ? B GLY -2 B ZN 101 1_555 ? ? ? ? ? ? ? 2.146 ? ? metalc3 metalc ? ? A HIS 2 ND1 ? ? ? 1_555 E ZN . ZN ? ? B HIS -1 B ZN 102 1_555 ? ? ? ? ? ? ? 2.045 ? ? metalc4 metalc ? ? A GLU 14 OE1 ? ? ? 1_555 L ZN . ZN ? ? B GLU 15 A ZN 103 1_545 ? ? ? ? ? ? ? 2.166 ? ? metalc5 metalc ? ? A GLU 14 OE2 ? ? ? 1_555 L ZN . ZN ? ? B GLU 15 A ZN 103 1_545 ? ? ? ? ? ? ? 2.459 ? ? metalc6 metalc ? ? A GLU 27 OE1 ? ? ? 1_555 J ZN . ZN ? ? B GLU 28 A ZN 101 2_546 ? ? ? ? ? ? ? 1.962 ? ? metalc7 metalc ? ? A GLU 31 OE1 ? ? ? 1_555 G ZN . ZN ? ? B GLU 32 B ZN 104 1_555 ? ? ? ? ? ? ? 2.380 ? ? metalc8 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 G ZN . ZN ? ? B GLU 32 B ZN 104 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc9 metalc ? ? A HIS 44 NE2 ? ? ? 1_555 H ZN . ZN ? ? B HIS 45 B ZN 105 1_555 ? ? ? ? ? ? ? 1.981 ? ? metalc10 metalc ? ? A GLU 46 OE1 ? ? ? 1_555 F ZN . ZN ? ? B GLU 47 B ZN 103 1_555 ? ? ? ? ? ? ? 2.120 ? ? metalc11 metalc ? ? A GLU 48 OE1 ? ? ? 1_555 H ZN . ZN ? ? B GLU 49 B ZN 105 1_555 ? ? ? ? ? ? ? 2.419 ? ? metalc12 metalc ? ? A GLU 49 OE1 ? ? ? 1_555 F ZN . ZN ? ? B GLU 50 B ZN 103 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc13 metalc ? ? A GLN 51 OE1 ? ? ? 1_555 E ZN . ZN ? ? B GLN 52 B ZN 102 1_555 ? ? ? ? ? ? ? 1.988 ? ? metalc14 metalc ? ? A GLU 62 OE1 ? ? ? 1_555 H ZN . ZN ? ? B GLU 63 B ZN 105 2_655 ? ? ? ? ? ? ? 2.179 ? ? metalc15 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 H ZN . ZN ? ? B GLU 63 B ZN 105 2_655 ? ? ? ? ? ? ? 2.230 ? ? metalc16 metalc ? ? D ZN . ZN ? ? ? 1_455 B HIS 2 NE2 ? ? B ZN 101 A HIS -1 1_555 ? ? ? ? ? ? ? 1.830 ? ? metalc17 metalc ? ? D ZN . ZN ? ? ? 1_555 B GLU 49 OE1 ? ? B ZN 101 A GLU 50 1_555 ? ? ? ? ? ? ? 2.469 ? ? metalc18 metalc ? ? D ZN . ZN ? ? ? 1_555 B GLU 49 OE2 ? ? B ZN 101 A GLU 50 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc19 metalc ? ? D ZN . ZN ? ? ? 1_555 N HOH . O ? ? B ZN 101 A HOH 219 1_655 ? ? ? ? ? ? ? 2.206 ? ? metalc20 metalc ? ? E ZN . ZN ? ? ? 1_555 I IMD . N1 ? ? B ZN 102 B IMD 106 1_555 ? ? ? ? ? ? ? 1.999 ? ? metalc21 metalc ? ? E ZN . ZN ? ? ? 1_555 B GLU 46 OE1 ? ? B ZN 102 A GLU 47 1_555 ? ? ? ? ? ? ? 1.898 ? ? metalc22 metalc ? ? F ZN . ZN ? ? ? 1_555 B GLY 1 O ? ? B ZN 103 A GLY -2 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc23 metalc ? ? G ZN . ZN ? ? ? 1_655 B GLU 27 OE1 ? ? B ZN 104 A GLU 28 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc24 metalc ? ? G ZN . ZN ? ? ? 1_655 B GLU 31 OE1 ? ? B ZN 104 A GLU 32 1_555 ? ? ? ? ? ? ? 1.931 ? ? metalc25 metalc ? ? G ZN . ZN ? ? ? 1_655 B GLU 31 OE2 ? ? B ZN 104 A GLU 32 1_555 ? ? ? ? ? ? ? 2.685 ? ? metalc26 metalc ? ? G ZN . ZN ? ? ? 1_555 N HOH . O ? ? B ZN 104 A HOH 239 1_455 ? ? ? ? ? ? ? 1.969 ? ? metalc27 metalc ? ? I IMD . N3 ? ? ? 1_555 K ZN . ZN ? ? B IMD 106 A ZN 102 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc28 metalc ? ? M HOH . O ? ? ? 1_565 L ZN . ZN ? ? B HOH 239 A ZN 103 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc29 metalc ? ? B GLU 16 OE1 ? ? ? 1_555 J ZN . ZN ? ? A GLU 17 A ZN 101 1_555 ? ? ? ? ? ? ? 2.197 ? ? metalc30 metalc ? ? B GLU 16 OE2 ? ? ? 1_555 J ZN . ZN ? ? A GLU 17 A ZN 101 1_555 ? ? ? ? ? ? ? 2.192 ? ? metalc31 metalc ? ? B GLU 27 OE1 ? ? ? 1_555 J ZN . ZN ? ? A GLU 28 A ZN 101 2_646 ? ? ? ? ? ? ? 2.653 ? ? metalc32 metalc ? ? B GLU 27 OE2 ? ? ? 1_555 J ZN . ZN ? ? A GLU 28 A ZN 101 2_646 ? ? ? ? ? ? ? 1.974 ? ? metalc33 metalc ? ? B HIS 44 NE2 ? ? ? 1_555 L ZN . ZN ? ? A HIS 45 A ZN 103 1_555 ? ? ? ? ? ? ? 2.447 ? ? metalc34 metalc ? ? B GLU 49 OE1 ? ? ? 1_555 K ZN . ZN ? ? A GLU 50 A ZN 102 1_555 ? ? ? ? ? ? ? 2.148 ? ? metalc35 metalc ? ? B GLU 53 OE1 ? ? ? 1_555 K ZN . ZN ? ? A GLU 54 A ZN 102 1_555 ? ? ? ? ? ? ? 2.593 ? ? metalc36 metalc ? ? B GLU 53 OE2 ? ? ? 1_555 K ZN . ZN ? ? A GLU 54 A ZN 102 1_555 ? ? ? ? ? ? ? 2.222 ? ? metalc37 metalc ? ? B GLU 63 O ? ? ? 1_555 K ZN . ZN ? ? A GLU 64 A ZN 102 2_655 ? ? ? ? ? ? ? 2.157 ? ? metalc38 metalc ? ? B GLU 63 OXT ? ? ? 1_555 K ZN . ZN ? ? A GLU 64 A ZN 102 2_655 ? ? ? ? ? ? ? 2.621 ? ? metalc39 metalc ? ? J ZN . ZN ? ? ? 1_555 N HOH . O ? ? A ZN 101 A HOH 208 1_555 ? ? ? ? ? ? ? 1.911 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? A GLY 1 ? B GLY -2 ? 1_555 86.0 ? 2 N ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 2 ? A HIS -1 ? 1_555 118.6 ? 3 O ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 NE2 ? B HIS 2 ? A HIS -1 ? 1_555 73.6 ? 4 N ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 79.3 ? 5 O ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 81.3 ? 6 NE2 ? B HIS 2 ? A HIS -1 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 41.3 ? 7 N ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE2 ? B GLU 49 ? A GLU 50 ? 1_555 135.8 ? 8 O ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE2 ? B GLU 49 ? A GLU 50 ? 1_555 89.8 ? 9 NE2 ? B HIS 2 ? A HIS -1 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE2 ? B GLU 49 ? A GLU 50 ? 1_555 21.6 ? 10 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 OE2 ? B GLU 49 ? A GLU 50 ? 1_555 56.6 ? 11 N ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? N HOH . ? A HOH 219 ? 1_655 82.7 ? 12 O ? A GLY 1 ? B GLY -2 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? N HOH . ? A HOH 219 ? 1_655 167.1 ? 13 NE2 ? B HIS 2 ? A HIS -1 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? N HOH . ? A HOH 219 ? 1_655 106.6 ? 14 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? N HOH . ? A HOH 219 ? 1_655 90.5 ? 15 OE2 ? B GLU 49 ? A GLU 50 ? 1_555 ZN ? D ZN . ? B ZN 101 ? 1_555 O ? N HOH . ? A HOH 219 ? 1_655 94.0 ? 16 ND1 ? A HIS 2 ? B HIS -1 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 OE1 ? A GLN 51 ? B GLN 52 ? 1_555 87.3 ? 17 ND1 ? A HIS 2 ? B HIS -1 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 N1 ? I IMD . ? B IMD 106 ? 1_555 121.8 ? 18 OE1 ? A GLN 51 ? B GLN 52 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 N1 ? I IMD . ? B IMD 106 ? 1_555 113.0 ? 19 ND1 ? A HIS 2 ? B HIS -1 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 OE1 ? B GLU 46 ? A GLU 47 ? 1_555 105.9 ? 20 OE1 ? A GLN 51 ? B GLN 52 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 OE1 ? B GLU 46 ? A GLU 47 ? 1_555 93.5 ? 21 N1 ? I IMD . ? B IMD 106 ? 1_555 ZN ? E ZN . ? B ZN 102 ? 1_555 OE1 ? B GLU 46 ? A GLU 47 ? 1_555 125.0 ? 22 OE1 ? A GLU 14 ? B GLU 15 ? 1_555 ZN ? L ZN . ? A ZN 103 ? 1_545 OE2 ? A GLU 14 ? B GLU 15 ? 1_555 56.7 ? 23 OE1 ? A GLU 14 ? B GLU 15 ? 1_555 ZN ? L ZN . ? A ZN 103 ? 1_545 O ? M HOH . ? B HOH 239 ? 1_565 50.4 ? 24 OE2 ? A GLU 14 ? B GLU 15 ? 1_555 ZN ? L ZN . ? A ZN 103 ? 1_545 O ? M HOH . ? B HOH 239 ? 1_565 44.7 ? 25 OE1 ? A GLU 14 ? B GLU 15 ? 1_555 ZN ? L ZN . ? A ZN 103 ? 1_545 NE2 ? B HIS 44 ? A HIS 45 ? 1_555 45.7 ? 26 OE2 ? A GLU 14 ? B GLU 15 ? 1_555 ZN ? L ZN . ? A ZN 103 ? 1_545 NE2 ? B HIS 44 ? A HIS 45 ? 1_555 38.8 ? 27 O ? M HOH . ? B HOH 239 ? 1_565 ZN ? L ZN . ? A ZN 103 ? 1_545 NE2 ? B HIS 44 ? A HIS 45 ? 1_555 7.2 ? 28 OE1 ? A GLU 27 ? B GLU 28 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE1 ? B GLU 16 ? A GLU 17 ? 1_555 58.1 ? 29 OE1 ? A GLU 27 ? B GLU 28 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE2 ? B GLU 16 ? A GLU 17 ? 1_555 61.1 ? 30 OE1 ? B GLU 16 ? A GLU 17 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE2 ? B GLU 16 ? A GLU 17 ? 1_555 5.9 ? 31 OE1 ? A GLU 27 ? B GLU 28 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 13.2 ? 32 OE1 ? B GLU 16 ? A GLU 17 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 48.7 ? 33 OE2 ? B GLU 16 ? A GLU 17 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 52.6 ? 34 OE1 ? A GLU 27 ? B GLU 28 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE2 ? B GLU 27 ? A GLU 28 ? 1_555 15.9 ? 35 OE1 ? B GLU 16 ? A GLU 17 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE2 ? B GLU 27 ? A GLU 28 ? 1_555 49.3 ? 36 OE2 ? B GLU 16 ? A GLU 17 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE2 ? B GLU 27 ? A GLU 28 ? 1_555 53.6 ? 37 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 OE2 ? B GLU 27 ? A GLU 28 ? 1_555 3.8 ? 38 OE1 ? A GLU 27 ? B GLU 28 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 O ? N HOH . ? A HOH 208 ? 1_555 63.6 ? 39 OE1 ? B GLU 16 ? A GLU 17 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 O ? N HOH . ? A HOH 208 ? 1_555 6.3 ? 40 OE2 ? B GLU 16 ? A GLU 17 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 O ? N HOH . ? A HOH 208 ? 1_555 8.6 ? 41 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 O ? N HOH . ? A HOH 208 ? 1_555 53.6 ? 42 OE2 ? B GLU 27 ? A GLU 28 ? 1_555 ZN ? J ZN . ? A ZN 101 ? 2_546 O ? N HOH . ? A HOH 208 ? 1_555 53.8 ? 43 OE1 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE2 ? A GLU 31 ? B GLU 32 ? 1_555 58.9 ? 44 OE1 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 57.0 ? 45 OE2 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 57.6 ? 46 OE1 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE1 ? B GLU 31 ? A GLU 32 ? 1_555 50.8 ? 47 OE2 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE1 ? B GLU 31 ? A GLU 32 ? 1_555 59.3 ? 48 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE1 ? B GLU 31 ? A GLU 32 ? 1_555 7.2 ? 49 OE1 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE2 ? B GLU 31 ? A GLU 32 ? 1_555 49.5 ? 50 OE2 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE2 ? B GLU 31 ? A GLU 32 ? 1_555 54.4 ? 51 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE2 ? B GLU 31 ? A GLU 32 ? 1_555 7.7 ? 52 OE1 ? B GLU 31 ? A GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 OE2 ? B GLU 31 ? A GLU 32 ? 1_555 4.9 ? 53 OE1 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 O ? N HOH . ? A HOH 239 ? 1_455 90.9 ? 54 OE2 ? A GLU 31 ? B GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 O ? N HOH . ? A HOH 239 ? 1_455 114.1 ? 55 OE1 ? B GLU 27 ? A GLU 28 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 O ? N HOH . ? A HOH 239 ? 1_455 56.9 ? 56 OE1 ? B GLU 31 ? A GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 O ? N HOH . ? A HOH 239 ? 1_455 56.8 ? 57 OE2 ? B GLU 31 ? A GLU 32 ? 1_555 ZN ? G ZN . ? B ZN 104 ? 1_555 O ? N HOH . ? A HOH 239 ? 1_455 61.5 ? 58 NE2 ? A HIS 44 ? B HIS 45 ? 1_555 ZN ? H ZN . ? B ZN 105 ? 1_555 OE1 ? A GLU 48 ? B GLU 49 ? 1_555 121.6 ? 59 NE2 ? A HIS 44 ? B HIS 45 ? 1_555 ZN ? H ZN . ? B ZN 105 ? 1_555 OE1 ? A GLU 62 ? B GLU 63 ? 1_555 110.1 ? 60 OE1 ? A GLU 48 ? B GLU 49 ? 1_555 ZN ? H ZN . ? B ZN 105 ? 1_555 OE1 ? A GLU 62 ? B GLU 63 ? 1_555 45.6 ? 61 NE2 ? A HIS 44 ? B HIS 45 ? 1_555 ZN ? H ZN . ? B ZN 105 ? 1_555 OE2 ? A GLU 62 ? B GLU 63 ? 1_555 113.8 ? 62 OE1 ? A GLU 48 ? B GLU 49 ? 1_555 ZN ? H ZN . ? B ZN 105 ? 1_555 OE2 ? A GLU 62 ? B GLU 63 ? 1_555 46.3 ? 63 OE1 ? A GLU 62 ? B GLU 63 ? 1_555 ZN ? H ZN . ? B ZN 105 ? 1_555 OE2 ? A GLU 62 ? B GLU 63 ? 1_555 4.3 ? 64 OE1 ? A GLU 46 ? B GLU 47 ? 1_555 ZN ? F ZN . ? B ZN 103 ? 1_555 OE1 ? A GLU 49 ? B GLU 50 ? 1_555 100.4 ? 65 OE1 ? A GLU 46 ? B GLU 47 ? 1_555 ZN ? F ZN . ? B ZN 103 ? 1_555 O ? B GLY 1 ? A GLY -2 ? 1_555 98.4 ? 66 OE1 ? A GLU 49 ? B GLU 50 ? 1_555 ZN ? F ZN . ? B ZN 103 ? 1_555 O ? B GLY 1 ? A GLY -2 ? 1_555 130.9 ? 67 N3 ? I IMD . ? B IMD 106 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 110.7 ? 68 N3 ? I IMD . ? B IMD 106 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OE1 ? B GLU 53 ? A GLU 54 ? 1_555 163.6 ? 69 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OE1 ? B GLU 53 ? A GLU 54 ? 1_555 79.1 ? 70 N3 ? I IMD . ? B IMD 106 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OE2 ? B GLU 53 ? A GLU 54 ? 1_555 110.6 ? 71 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OE2 ? B GLU 53 ? A GLU 54 ? 1_555 121.2 ? 72 OE1 ? B GLU 53 ? A GLU 54 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OE2 ? B GLU 53 ? A GLU 54 ? 1_555 53.4 ? 73 N3 ? I IMD . ? B IMD 106 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 O ? B GLU 63 ? A GLU 64 ? 1_555 119.7 ? 74 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 O ? B GLU 63 ? A GLU 64 ? 1_555 126.4 ? 75 OE1 ? B GLU 53 ? A GLU 54 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 O ? B GLU 63 ? A GLU 64 ? 1_555 47.8 ? 76 OE2 ? B GLU 53 ? A GLU 54 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 O ? B GLU 63 ? A GLU 64 ? 1_555 23.2 ? 77 N3 ? I IMD . ? B IMD 106 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OXT ? B GLU 63 ? A GLU 64 ? 1_555 124.0 ? 78 OE1 ? B GLU 49 ? A GLU 50 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OXT ? B GLU 63 ? A GLU 64 ? 1_555 122.1 ? 79 OE1 ? B GLU 53 ? A GLU 54 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OXT ? B GLU 63 ? A GLU 64 ? 1_555 43.4 ? 80 OE2 ? B GLU 53 ? A GLU 54 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OXT ? B GLU 63 ? A GLU 64 ? 1_555 24.3 ? 81 O ? B GLU 63 ? A GLU 64 ? 1_555 ZN ? K ZN . ? A ZN 102 ? 1_555 OXT ? B GLU 63 ? A GLU 64 ? 1_555 4.4 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 19 ? VAL A 21 ? THR B 20 VAL B 22 AA1 2 ARG B 22 ? TYR B 24 ? ARG A 23 TYR A 25 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLY _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_1_auth_asym_id B _pdbx_struct_sheet_hbond.range_1_auth_seq_id 21 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 23 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 24 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software B ZN 101 ? 4 'binding site for residue ZN B 101' AC2 Software B ZN 102 ? 4 'binding site for residue ZN B 102' AC3 Software B ZN 103 ? 3 'binding site for residue ZN B 103' AC4 Software B ZN 104 ? 4 'binding site for residue ZN B 104' AC5 Software B ZN 105 ? 2 'binding site for residue ZN B 105' AC6 Software B IMD 106 ? 8 'binding site for residue IMD B 106' AC7 Software A ZN 101 ? 2 'binding site for residue ZN A 101' AC8 Software A ZN 102 ? 3 'binding site for residue ZN A 102' AC9 Software A ZN 103 ? 3 'binding site for residue ZN A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS B 2 ? HIS A -1 . ? 1_655 ? 2 AC1 4 GLU B 49 ? GLU A 50 . ? 1_555 ? 3 AC1 4 HOH N . ? HOH A 219 . ? 1_655 ? 4 AC1 4 GLY A 1 ? GLY B -2 . ? 1_555 ? 5 AC2 4 GLU B 46 ? GLU A 47 . ? 1_555 ? 6 AC2 4 HIS A 2 ? HIS B -1 . ? 1_555 ? 7 AC2 4 GLN A 51 ? GLN B 52 . ? 1_555 ? 8 AC2 4 IMD I . ? IMD B 106 . ? 1_555 ? 9 AC3 3 GLY B 1 ? GLY A -2 . ? 1_555 ? 10 AC3 3 GLU A 46 ? GLU B 47 . ? 1_555 ? 11 AC3 3 GLU A 49 ? GLU B 50 . ? 1_555 ? 12 AC4 4 GLU B 27 ? GLU A 28 . ? 1_455 ? 13 AC4 4 GLU B 31 ? GLU A 32 . ? 1_455 ? 14 AC4 4 HOH N . ? HOH A 239 . ? 1_455 ? 15 AC4 4 GLU A 31 ? GLU B 32 . ? 1_555 ? 16 AC5 2 HIS A 44 ? HIS B 45 . ? 1_555 ? 17 AC5 2 GLU A 48 ? GLU B 49 . ? 1_555 ? 18 AC6 8 GLU B 46 ? GLU A 47 . ? 1_555 ? 19 AC6 8 GLU B 49 ? GLU A 50 . ? 1_555 ? 20 AC6 8 LEU B 50 ? LEU A 51 . ? 1_555 ? 21 AC6 8 GLU B 53 ? GLU A 54 . ? 1_555 ? 22 AC6 8 ZN K . ? ZN A 102 . ? 1_555 ? 23 AC6 8 HIS A 2 ? HIS B -1 . ? 1_555 ? 24 AC6 8 GLN A 51 ? GLN B 52 . ? 1_555 ? 25 AC6 8 ZN E . ? ZN B 102 . ? 1_555 ? 26 AC7 2 GLU B 16 ? GLU A 17 . ? 1_555 ? 27 AC7 2 HOH N . ? HOH A 208 . ? 1_555 ? 28 AC8 3 GLU B 49 ? GLU A 50 . ? 1_555 ? 29 AC8 3 GLU B 53 ? GLU A 54 . ? 1_555 ? 30 AC8 3 IMD I . ? IMD B 106 . ? 1_555 ? 31 AC9 3 HIS B 44 ? HIS A 45 . ? 1_555 ? 32 AC9 3 GLU A 14 ? GLU B 15 . ? 1_565 ? 33 AC9 3 HOH M . ? HOH B 239 . ? 1_565 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id MET _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 0 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -114.68 _pdbx_validate_torsion.psi 70.22 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 11.2246 -3.3522 17.8819 0.2807 0.1997 0.1439 -0.0173 -0.0172 -0.0527 7.0607 2.2273 5.5730 0.7679 -3.4224 -2.7220 0.1856 0.4038 0.0416 -0.2720 -0.1469 -0.1217 0.2273 0.1645 -0.1517 'X-RAY DIFFRACTION' 2 ? refined 8.7864 -11.8946 37.5422 0.1280 0.0375 0.1084 -0.0055 0.0145 0.0100 5.1239 7.2375 5.4018 0.1990 5.1411 -1.1515 -0.0134 0.0205 -0.0544 -0.1767 0.0203 0.0455 0.0241 0.1992 -0.0589 'X-RAY DIFFRACTION' 3 ? refined 4.5578 2.2399 14.8097 0.2019 0.2159 0.1281 -0.0380 -0.0194 -0.0145 2.1971 3.7888 7.1939 1.6375 -2.8890 -4.5436 -0.1332 0.4881 0.0446 -0.3892 0.2631 0.0403 0.2587 -0.4854 -0.1508 'X-RAY DIFFRACTION' 4 ? refined 3.7521 0.0374 32.5442 0.1732 0.0995 0.1297 0.0034 -0.0240 0.0078 2.0877 1.5774 2.0372 -0.2142 -0.1225 -0.2925 0.0088 0.2044 0.1237 -0.1968 0.0362 0.2585 -0.1811 -0.1339 -0.0438 'X-RAY DIFFRACTION' 5 ? refined 11.0969 7.8098 17.2553 0.2246 0.1995 0.1474 -0.0181 -0.0013 0.0349 1.0394 6.5142 8.3335 -1.0888 1.0305 -7.0396 -0.0330 0.3930 0.1586 -0.2426 -0.3113 -0.3345 -0.0081 0.3056 0.3513 'X-RAY DIFFRACTION' 6 ? refined 0.1726 -11.0522 26.2501 0.2716 0.3044 0.4034 -0.0554 -0.1193 -0.0350 8.3889 3.8992 2.5618 5.4763 2.3270 0.7339 0.7335 -0.8862 -1.4868 -0.5825 -0.4349 1.2348 0.9092 -1.3510 -0.3806 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid -2 through 15 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 16 through 26 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 27 through 63 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 5 through 26 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 27 through 64 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'E' and (resid 7 through 8 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B GLU 64 ? A GLU 63 2 1 Y 1 E MET 1 ? C MET 1 3 1 Y 1 E ALA 2 ? C ALA 2 4 1 Y 1 E ASP 3 ? C ASP 3 5 1 Y 1 E LYS 4 ? C LYS 4 6 1 Y 1 E PRO 5 ? C PRO 5 7 1 Y 1 E GLN 6 ? C GLN 6 8 1 Y 1 E GLN 10 ? C GLN 10 9 1 Y 1 E TYR 11 ? C TYR 11 10 1 Y 1 E ARG 12 ? C ARG 12 11 1 Y 1 E ASN 13 ? C ASN 13 12 1 Y 1 E LYS 14 ? C LYS 14 13 1 Y 1 E GLN 15 ? C GLN 15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 IMD N1 N Y N 169 IMD C2 C Y N 170 IMD N3 N Y N 171 IMD C4 C Y N 172 IMD C5 C Y N 173 IMD HN1 H N N 174 IMD H2 H N N 175 IMD HN3 H N N 176 IMD H4 H N N 177 IMD H5 H N N 178 LEU N N N N 179 LEU CA C N S 180 LEU C C N N 181 LEU O O N N 182 LEU CB C N N 183 LEU CG C N N 184 LEU CD1 C N N 185 LEU CD2 C N N 186 LEU OXT O N N 187 LEU H H N N 188 LEU H2 H N N 189 LEU HA H N N 190 LEU HB2 H N N 191 LEU HB3 H N N 192 LEU HG H N N 193 LEU HD11 H N N 194 LEU HD12 H N N 195 LEU HD13 H N N 196 LEU HD21 H N N 197 LEU HD22 H N N 198 LEU HD23 H N N 199 LEU HXT H N N 200 LYS N N N N 201 LYS CA C N S 202 LYS C C N N 203 LYS O O N N 204 LYS CB C N N 205 LYS CG C N N 206 LYS CD C N N 207 LYS CE C N N 208 LYS NZ N N N 209 LYS OXT O N N 210 LYS H H N N 211 LYS H2 H N N 212 LYS HA H N N 213 LYS HB2 H N N 214 LYS HB3 H N N 215 LYS HG2 H N N 216 LYS HG3 H N N 217 LYS HD2 H N N 218 LYS HD3 H N N 219 LYS HE2 H N N 220 LYS HE3 H N N 221 LYS HZ1 H N N 222 LYS HZ2 H N N 223 LYS HZ3 H N N 224 LYS HXT H N N 225 MET N N N N 226 MET CA C N S 227 MET C C N N 228 MET O O N N 229 MET CB C N N 230 MET CG C N N 231 MET SD S N N 232 MET CE C N N 233 MET OXT O N N 234 MET H H N N 235 MET H2 H N N 236 MET HA H N N 237 MET HB2 H N N 238 MET HB3 H N N 239 MET HG2 H N N 240 MET HG3 H N N 241 MET HE1 H N N 242 MET HE2 H N N 243 MET HE3 H N N 244 MET HXT H N N 245 PHE N N N N 246 PHE CA C N S 247 PHE C C N N 248 PHE O O N N 249 PHE CB C N N 250 PHE CG C Y N 251 PHE CD1 C Y N 252 PHE CD2 C Y N 253 PHE CE1 C Y N 254 PHE CE2 C Y N 255 PHE CZ C Y N 256 PHE OXT O N N 257 PHE H H N N 258 PHE H2 H N N 259 PHE HA H N N 260 PHE HB2 H N N 261 PHE HB3 H N N 262 PHE HD1 H N N 263 PHE HD2 H N N 264 PHE HE1 H N N 265 PHE HE2 H N N 266 PHE HZ H N N 267 PHE HXT H N N 268 PRO N N N N 269 PRO CA C N S 270 PRO C C N N 271 PRO O O N N 272 PRO CB C N N 273 PRO CG C N N 274 PRO CD C N N 275 PRO OXT O N N 276 PRO H H N N 277 PRO HA H N N 278 PRO HB2 H N N 279 PRO HB3 H N N 280 PRO HG2 H N N 281 PRO HG3 H N N 282 PRO HD2 H N N 283 PRO HD3 H N N 284 PRO HXT H N N 285 SER N N N N 286 SER CA C N S 287 SER C C N N 288 SER O O N N 289 SER CB C N N 290 SER OG O N N 291 SER OXT O N N 292 SER H H N N 293 SER H2 H N N 294 SER HA H N N 295 SER HB2 H N N 296 SER HB3 H N N 297 SER HG H N N 298 SER HXT H N N 299 THR N N N N 300 THR CA C N S 301 THR C C N N 302 THR O O N N 303 THR CB C N R 304 THR OG1 O N N 305 THR CG2 C N N 306 THR OXT O N N 307 THR H H N N 308 THR H2 H N N 309 THR HA H N N 310 THR HB H N N 311 THR HG1 H N N 312 THR HG21 H N N 313 THR HG22 H N N 314 THR HG23 H N N 315 THR HXT H N N 316 TYR N N N N 317 TYR CA C N S 318 TYR C C N N 319 TYR O O N N 320 TYR CB C N N 321 TYR CG C Y N 322 TYR CD1 C Y N 323 TYR CD2 C Y N 324 TYR CE1 C Y N 325 TYR CE2 C Y N 326 TYR CZ C Y N 327 TYR OH O N N 328 TYR OXT O N N 329 TYR H H N N 330 TYR H2 H N N 331 TYR HA H N N 332 TYR HB2 H N N 333 TYR HB3 H N N 334 TYR HD1 H N N 335 TYR HD2 H N N 336 TYR HE1 H N N 337 TYR HE2 H N N 338 TYR HH H N N 339 TYR HXT H N N 340 VAL N N N N 341 VAL CA C N S 342 VAL C C N N 343 VAL O O N N 344 VAL CB C N N 345 VAL CG1 C N N 346 VAL CG2 C N N 347 VAL OXT O N N 348 VAL H H N N 349 VAL H2 H N N 350 VAL HA H N N 351 VAL HB H N N 352 VAL HG11 H N N 353 VAL HG12 H N N 354 VAL HG13 H N N 355 VAL HG21 H N N 356 VAL HG22 H N N 357 VAL HG23 H N N 358 VAL HXT H N N 359 ZN ZN ZN N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 IMD N1 C2 sing Y N 160 IMD N1 C5 sing Y N 161 IMD N1 HN1 sing N N 162 IMD C2 N3 doub Y N 163 IMD C2 H2 sing N N 164 IMD N3 C4 sing Y N 165 IMD N3 HN3 sing N N 166 IMD C4 C5 doub Y N 167 IMD C4 H4 sing N N 168 IMD C5 H5 sing N N 169 LEU N CA sing N N 170 LEU N H sing N N 171 LEU N H2 sing N N 172 LEU CA C sing N N 173 LEU CA CB sing N N 174 LEU CA HA sing N N 175 LEU C O doub N N 176 LEU C OXT sing N N 177 LEU CB CG sing N N 178 LEU CB HB2 sing N N 179 LEU CB HB3 sing N N 180 LEU CG CD1 sing N N 181 LEU CG CD2 sing N N 182 LEU CG HG sing N N 183 LEU CD1 HD11 sing N N 184 LEU CD1 HD12 sing N N 185 LEU CD1 HD13 sing N N 186 LEU CD2 HD21 sing N N 187 LEU CD2 HD22 sing N N 188 LEU CD2 HD23 sing N N 189 LEU OXT HXT sing N N 190 LYS N CA sing N N 191 LYS N H sing N N 192 LYS N H2 sing N N 193 LYS CA C sing N N 194 LYS CA CB sing N N 195 LYS CA HA sing N N 196 LYS C O doub N N 197 LYS C OXT sing N N 198 LYS CB CG sing N N 199 LYS CB HB2 sing N N 200 LYS CB HB3 sing N N 201 LYS CG CD sing N N 202 LYS CG HG2 sing N N 203 LYS CG HG3 sing N N 204 LYS CD CE sing N N 205 LYS CD HD2 sing N N 206 LYS CD HD3 sing N N 207 LYS CE NZ sing N N 208 LYS CE HE2 sing N N 209 LYS CE HE3 sing N N 210 LYS NZ HZ1 sing N N 211 LYS NZ HZ2 sing N N 212 LYS NZ HZ3 sing N N 213 LYS OXT HXT sing N N 214 MET N CA sing N N 215 MET N H sing N N 216 MET N H2 sing N N 217 MET CA C sing N N 218 MET CA CB sing N N 219 MET CA HA sing N N 220 MET C O doub N N 221 MET C OXT sing N N 222 MET CB CG sing N N 223 MET CB HB2 sing N N 224 MET CB HB3 sing N N 225 MET CG SD sing N N 226 MET CG HG2 sing N N 227 MET CG HG3 sing N N 228 MET SD CE sing N N 229 MET CE HE1 sing N N 230 MET CE HE2 sing N N 231 MET CE HE3 sing N N 232 MET OXT HXT sing N N 233 PHE N CA sing N N 234 PHE N H sing N N 235 PHE N H2 sing N N 236 PHE CA C sing N N 237 PHE CA CB sing N N 238 PHE CA HA sing N N 239 PHE C O doub N N 240 PHE C OXT sing N N 241 PHE CB CG sing N N 242 PHE CB HB2 sing N N 243 PHE CB HB3 sing N N 244 PHE CG CD1 doub Y N 245 PHE CG CD2 sing Y N 246 PHE CD1 CE1 sing Y N 247 PHE CD1 HD1 sing N N 248 PHE CD2 CE2 doub Y N 249 PHE CD2 HD2 sing N N 250 PHE CE1 CZ doub Y N 251 PHE CE1 HE1 sing N N 252 PHE CE2 CZ sing Y N 253 PHE CE2 HE2 sing N N 254 PHE CZ HZ sing N N 255 PHE OXT HXT sing N N 256 PRO N CA sing N N 257 PRO N CD sing N N 258 PRO N H sing N N 259 PRO CA C sing N N 260 PRO CA CB sing N N 261 PRO CA HA sing N N 262 PRO C O doub N N 263 PRO C OXT sing N N 264 PRO CB CG sing N N 265 PRO CB HB2 sing N N 266 PRO CB HB3 sing N N 267 PRO CG CD sing N N 268 PRO CG HG2 sing N N 269 PRO CG HG3 sing N N 270 PRO CD HD2 sing N N 271 PRO CD HD3 sing N N 272 PRO OXT HXT sing N N 273 SER N CA sing N N 274 SER N H sing N N 275 SER N H2 sing N N 276 SER CA C sing N N 277 SER CA CB sing N N 278 SER CA HA sing N N 279 SER C O doub N N 280 SER C OXT sing N N 281 SER CB OG sing N N 282 SER CB HB2 sing N N 283 SER CB HB3 sing N N 284 SER OG HG sing N N 285 SER OXT HXT sing N N 286 THR N CA sing N N 287 THR N H sing N N 288 THR N H2 sing N N 289 THR CA C sing N N 290 THR CA CB sing N N 291 THR CA HA sing N N 292 THR C O doub N N 293 THR C OXT sing N N 294 THR CB OG1 sing N N 295 THR CB CG2 sing N N 296 THR CB HB sing N N 297 THR OG1 HG1 sing N N 298 THR CG2 HG21 sing N N 299 THR CG2 HG22 sing N N 300 THR CG2 HG23 sing N N 301 THR OXT HXT sing N N 302 TYR N CA sing N N 303 TYR N H sing N N 304 TYR N H2 sing N N 305 TYR CA C sing N N 306 TYR CA CB sing N N 307 TYR CA HA sing N N 308 TYR C O doub N N 309 TYR C OXT sing N N 310 TYR CB CG sing N N 311 TYR CB HB2 sing N N 312 TYR CB HB3 sing N N 313 TYR CG CD1 doub Y N 314 TYR CG CD2 sing Y N 315 TYR CD1 CE1 sing Y N 316 TYR CD1 HD1 sing N N 317 TYR CD2 CE2 doub Y N 318 TYR CD2 HD2 sing N N 319 TYR CE1 CZ doub Y N 320 TYR CE1 HE1 sing N N 321 TYR CE2 CZ sing Y N 322 TYR CE2 HE2 sing N N 323 TYR CZ OH sing N N 324 TYR OH HH sing N N 325 TYR OXT HXT sing N N 326 VAL N CA sing N N 327 VAL N H sing N N 328 VAL N H2 sing N N 329 VAL CA C sing N N 330 VAL CA CB sing N N 331 VAL CA HA sing N N 332 VAL C O doub N N 333 VAL C OXT sing N N 334 VAL CB CG1 sing N N 335 VAL CB CG2 sing N N 336 VAL CB HB sing N N 337 VAL CG1 HG11 sing N N 338 VAL CG1 HG12 sing N N 339 VAL CG1 HG13 sing N N 340 VAL CG2 HG21 sing N N 341 VAL CG2 HG22 sing N N 342 VAL CG2 HG23 sing N N 343 VAL OXT HXT sing N N 344 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number BB/M001180/1 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6GP7 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6GPZ _atom_sites.fract_transf_matrix[1][1] 0.037626 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001585 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.031832 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012352 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_