data_6GV7 # _entry.id 6GV7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6GV7 pdb_00006gv7 10.2210/pdb6gv7/pdb WWPDB D_1200009257 ? ? BMRB 34289 ? 10.13018/BMR34289 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-09-19 2 'Structure model' 1 1 2018-10-24 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_nmr_software 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status 6 4 'Structure model' pdbx_nmr_spectrometer 7 4 'Structure model' struct_conn 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_pdbx_nmr_software.name' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' 8 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 9 4 'Structure model' '_pdbx_nmr_spectrometer.model' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6GV7 _pdbx_database_status.recvd_initial_deposition_date 2018-06-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Cadmium(II) form of A44H mutant of shortened metallothionein from Pseudomonas fluorescens Q2-87 (residues 1-52)' _pdbx_database_related.db_id 34289 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Habjanic, J.' 1 0000-0002-1365-8624 'Zerbe, O.' 2 0000-0003-0475-438X 'Freisinger, E.' 3 0000-0003-3102-6329 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Metallomics _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1756-591X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 1415 _citation.page_last 1429 _citation.title 'A histidine-rich Pseudomonas metallothionein with a disordered tail displays higher binding capacity for cadmium than zinc.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/c8mt00193f _citation.pdbx_database_id_PubMed 30191219 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Habjanic, J.' 1 ? primary 'Zerbe, O.' 2 ? primary 'Freisinger, E.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man metallothionein 5834.395 1 ? ? ? ? 2 non-polymer syn 'CADMIUM ION' 112.411 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS _entity_poly.pdbx_seq_one_letter_code_can NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CADMIUM ION' _pdbx_entity_nonpoly.comp_id CD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 GLU n 1 3 LEU n 1 4 ARG n 1 5 CYS n 1 6 GLY n 1 7 CYS n 1 8 PRO n 1 9 ASP n 1 10 CYS n 1 11 HIS n 1 12 CYS n 1 13 LYS n 1 14 VAL n 1 15 ASP n 1 16 PRO n 1 17 GLU n 1 18 ARG n 1 19 VAL n 1 20 PHE n 1 21 ASN n 1 22 HIS n 1 23 ASP n 1 24 GLY n 1 25 GLU n 1 26 ALA n 1 27 TYR n 1 28 CYS n 1 29 SER n 1 30 GLN n 1 31 ALA n 1 32 CYS n 1 33 ALA n 1 34 GLU n 1 35 GLN n 1 36 HIS n 1 37 PRO n 1 38 ASN n 1 39 GLY n 1 40 GLU n 1 41 PRO n 1 42 CYS n 1 43 PRO n 1 44 HIS n 1 45 PRO n 1 46 ASP n 1 47 CYS n 1 48 HIS n 1 49 CYS n 1 50 GLU n 1 51 ARG n 1 52 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 52 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PflQ2_2045 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas fluorescens Q2-87' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1038922 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 SER 52 52 52 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CD 1 101 200 CD CD A . C 2 CD 1 102 220 CD CD A . D 2 CD 1 103 240 CD CD A . E 2 CD 1 104 260 CD CD A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 52 ? O ? A SER 52 O 2 2 Y 1 A SER 52 ? O ? A SER 52 O 3 3 Y 1 A SER 52 ? O ? A SER 52 O 4 4 Y 1 A SER 52 ? O ? A SER 52 O 5 5 Y 1 A SER 52 ? O ? A SER 52 O 6 6 Y 1 A SER 52 ? O ? A SER 52 O 7 7 Y 1 A SER 52 ? O ? A SER 52 O 8 8 Y 1 A SER 52 ? O ? A SER 52 O 9 9 Y 1 A SER 52 ? O ? A SER 52 O 10 10 Y 1 A SER 52 ? O ? A SER 52 O 11 11 Y 1 A SER 52 ? O ? A SER 52 O 12 12 Y 1 A SER 52 ? O ? A SER 52 O 13 13 Y 1 A SER 52 ? O ? A SER 52 O 14 14 Y 1 A SER 52 ? O ? A SER 52 O 15 15 Y 1 A SER 52 ? O ? A SER 52 O 16 16 Y 1 A SER 52 ? O ? A SER 52 O 17 17 Y 1 A SER 52 ? O ? A SER 52 O 18 18 Y 1 A SER 52 ? O ? A SER 52 O 19 19 Y 1 A SER 52 ? O ? A SER 52 O 20 20 Y 1 A SER 52 ? O ? A SER 52 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6GV7 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6GV7 _struct.title 'Cadmium(II) form of A44H mutant of shortened metallothionein from Pseudomonas fluorescens Q2-87 (residues 1-52)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6GV7 _struct_keywords.text 'metallothionein, cadmium(II) ion, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code J2EKT7_PSEFL _struct_ref.pdbx_db_accession J2EKT7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPAPDCHCERS _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6GV7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession J2EKT7 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 53 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 52 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6GV7 _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 44 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code J2EKT7 _struct_ref_seq_dif.db_mon_id ALA _struct_ref_seq_dif.pdbx_seq_db_seq_num 45 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 44 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 15 ? VAL A 19 ? ASP A 15 VAL A 19 5 ? 5 HELX_P HELX_P2 AA2 SER A 29 ? GLU A 34 ? SER A 29 GLU A 34 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 5 SG ? ? ? 1_555 E CD . CD ? ? A CYS 5 A CD 104 1_555 ? ? ? ? ? ? ? 2.457 ? ? metalc2 metalc ? ? A CYS 7 SG ? ? ? 1_555 B CD . CD ? ? A CYS 7 A CD 101 1_555 ? ? ? ? ? ? ? 2.603 ? ? metalc3 metalc ? ? A CYS 10 SG ? ? ? 1_555 C CD . CD ? ? A CYS 10 A CD 102 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc4 metalc ? ? A CYS 10 SG ? ? ? 1_555 E CD . CD ? ? A CYS 10 A CD 104 1_555 ? ? ? ? ? ? ? 2.640 ? ? metalc5 metalc ? ? A CYS 12 SG ? ? ? 1_555 D CD . CD ? ? A CYS 12 A CD 103 1_555 ? ? ? ? ? ? ? 2.564 ? ? metalc6 metalc ? ? A CYS 28 SG ? ? ? 1_555 D CD . CD ? ? A CYS 28 A CD 103 1_555 ? ? ? ? ? ? ? 2.429 ? ? metalc7 metalc ? ? A CYS 28 SG ? ? ? 1_555 E CD . CD ? ? A CYS 28 A CD 104 1_555 ? ? ? ? ? ? ? 2.577 ? ? metalc8 metalc ? ? A CYS 32 SG ? ? ? 1_555 B CD . CD ? ? A CYS 32 A CD 101 1_555 ? ? ? ? ? ? ? 2.418 ? ? metalc9 metalc ? ? A CYS 32 SG ? ? ? 1_555 E CD . CD ? ? A CYS 32 A CD 104 1_555 ? ? ? ? ? ? ? 2.581 ? ? metalc10 metalc ? ? A HIS 36 NE2 ? ? ? 1_555 B CD . CD ? ? A HIS 36 A CD 101 1_555 ? ? ? ? ? ? ? 2.378 ? ? metalc11 metalc ? ? A CYS 42 SG ? ? ? 1_555 C CD . CD ? ? A CYS 42 A CD 102 1_555 ? ? ? ? ? ? ? 2.528 ? ? metalc12 metalc ? ? A CYS 42 SG ? ? ? 1_555 D CD . CD ? ? A CYS 42 A CD 103 1_555 ? ? ? ? ? ? ? 2.595 ? ? metalc13 metalc ? ? A HIS 44 ND1 ? ? ? 1_555 D CD . CD ? ? A HIS 44 A CD 103 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc14 metalc ? ? A CYS 47 SG ? ? ? 1_555 C CD . CD ? ? A CYS 47 A CD 102 1_555 ? ? ? ? ? ? ? 2.604 ? ? metalc15 metalc ? ? A CYS 49 SG ? ? ? 1_555 B CD . CD ? ? A CYS 49 A CD 101 1_555 ? ? ? ? ? ? ? 2.480 ? ? metalc16 metalc ? ? A CYS 49 SG ? ? ? 1_555 C CD . CD ? ? A CYS 49 A CD 102 1_555 ? ? ? ? ? ? ? 2.595 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 5 ? A CYS 5 ? 1_555 CD ? E CD . ? A CD 104 ? 1_555 SG ? A CYS 10 ? A CYS 10 ? 1_555 109.9 ? 2 SG ? A CYS 5 ? A CYS 5 ? 1_555 CD ? E CD . ? A CD 104 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 107.1 ? 3 SG ? A CYS 10 ? A CYS 10 ? 1_555 CD ? E CD . ? A CD 104 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 112.1 ? 4 SG ? A CYS 5 ? A CYS 5 ? 1_555 CD ? E CD . ? A CD 104 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 109.2 ? 5 SG ? A CYS 10 ? A CYS 10 ? 1_555 CD ? E CD . ? A CD 104 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 111.3 ? 6 SG ? A CYS 28 ? A CYS 28 ? 1_555 CD ? E CD . ? A CD 104 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 107.1 ? 7 SG ? A CYS 7 ? A CYS 7 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 108.6 ? 8 SG ? A CYS 7 ? A CYS 7 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 NE2 ? A HIS 36 ? A HIS 36 ? 1_555 112.1 ? 9 SG ? A CYS 32 ? A CYS 32 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 NE2 ? A HIS 36 ? A HIS 36 ? 1_555 110.5 ? 10 SG ? A CYS 7 ? A CYS 7 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 112.1 ? 11 SG ? A CYS 32 ? A CYS 32 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 106.3 ? 12 NE2 ? A HIS 36 ? A HIS 36 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 107.1 ? 13 SG ? A CYS 10 ? A CYS 10 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 106.0 ? 14 SG ? A CYS 10 ? A CYS 10 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 109.2 ? 15 SG ? A CYS 42 ? A CYS 42 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 110.7 ? 16 SG ? A CYS 10 ? A CYS 10 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 107.6 ? 17 SG ? A CYS 42 ? A CYS 42 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 110.9 ? 18 SG ? A CYS 47 ? A CYS 47 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 112.3 ? 19 SG ? A CYS 12 ? A CYS 12 ? 1_555 CD ? D CD . ? A CD 103 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 107.1 ? 20 SG ? A CYS 12 ? A CYS 12 ? 1_555 CD ? D CD . ? A CD 103 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 113.6 ? 21 SG ? A CYS 28 ? A CYS 28 ? 1_555 CD ? D CD . ? A CD 103 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 107.3 ? 22 SG ? A CYS 12 ? A CYS 12 ? 1_555 CD ? D CD . ? A CD 103 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 106.8 ? 23 SG ? A CYS 28 ? A CYS 28 ? 1_555 CD ? D CD . ? A CD 103 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 113.4 ? 24 SG ? A CYS 42 ? A CYS 42 ? 1_555 CD ? D CD . ? A CD 103 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 108.8 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 3 ? ARG A 4 ? LEU A 3 ARG A 4 AA1 2 LYS A 13 ? VAL A 14 ? LYS A 13 VAL A 14 AA2 1 PHE A 20 ? HIS A 22 ? PHE A 20 HIS A 22 AA2 2 GLU A 25 ? TYR A 27 ? GLU A 25 TYR A 27 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 3 ? N LEU A 3 O VAL A 14 ? O VAL A 14 AA2 1 2 N HIS A 22 ? N HIS A 22 O GLU A 25 ? O GLU A 25 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CD 101 ? 4 'binding site for residue CD A 101' AC2 Software A CD 102 ? 4 'binding site for residue CD A 102' AC3 Software A CD 103 ? 4 'binding site for residue CD A 103' AC4 Software A CD 104 ? 4 'binding site for residue CD A 104' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 7 ? CYS A 7 . ? 1_555 ? 2 AC1 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 3 AC1 4 HIS A 36 ? HIS A 36 . ? 1_555 ? 4 AC1 4 CYS A 49 ? CYS A 49 . ? 1_555 ? 5 AC2 4 CYS A 10 ? CYS A 10 . ? 1_555 ? 6 AC2 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 7 AC2 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 8 AC2 4 CYS A 49 ? CYS A 49 . ? 1_555 ? 9 AC3 4 CYS A 12 ? CYS A 12 . ? 1_555 ? 10 AC3 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 11 AC3 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 12 AC3 4 HIS A 44 ? HIS A 44 . ? 1_555 ? 13 AC4 4 CYS A 5 ? CYS A 5 . ? 1_555 ? 14 AC4 4 CYS A 10 ? CYS A 10 . ? 1_555 ? 15 AC4 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 16 AC4 4 CYS A 32 ? CYS A 32 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 HE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HIS _pdbx_validate_close_contact.auth_seq_id_1 11 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 46 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? 58.95 -91.75 2 1 HIS A 36 ? ? 56.35 73.23 3 1 PRO A 45 ? ? -78.67 23.92 4 1 HIS A 48 ? ? -141.16 44.46 5 2 GLU A 2 ? ? -89.04 -87.69 6 2 ARG A 18 ? ? -142.01 38.85 7 2 HIS A 36 ? ? 60.84 77.40 8 2 PRO A 43 ? ? -73.54 46.54 9 2 HIS A 48 ? ? -151.17 65.52 10 2 CYS A 49 ? ? -80.21 -152.89 11 2 GLU A 50 ? ? 73.16 -59.32 12 3 PRO A 43 ? ? -72.06 37.77 13 4 HIS A 36 ? ? 60.55 72.18 14 4 PRO A 43 ? ? -71.37 43.58 15 4 HIS A 48 ? ? -153.71 44.22 16 4 GLU A 50 ? ? 178.49 -57.17 17 5 HIS A 36 ? ? 58.56 71.56 18 5 GLU A 50 ? ? -179.00 -55.27 19 6 GLU A 2 ? ? 52.98 -90.39 20 6 HIS A 36 ? ? 61.88 77.50 21 6 PRO A 43 ? ? -75.46 49.08 22 6 HIS A 48 ? ? -152.77 60.97 23 6 CYS A 49 ? ? -72.74 -162.45 24 6 GLU A 50 ? ? 74.53 -54.93 25 7 PRO A 43 ? ? -69.71 40.22 26 7 CYS A 47 ? ? -111.76 -159.98 27 7 HIS A 48 ? ? -160.56 49.13 28 7 CYS A 49 ? ? -77.80 -166.27 29 7 GLU A 50 ? ? 77.20 -66.77 30 8 ARG A 18 ? ? -142.88 55.45 31 8 HIS A 36 ? ? 57.13 70.59 32 8 PRO A 43 ? ? -70.77 41.86 33 8 PRO A 45 ? ? -82.07 31.01 34 8 CYS A 47 ? ? -127.23 -166.99 35 8 HIS A 48 ? ? -153.10 72.15 36 9 GLU A 2 ? ? -70.79 -76.20 37 9 ARG A 18 ? ? -145.95 42.45 38 9 HIS A 36 ? ? 53.43 70.50 39 9 PRO A 43 ? ? -70.77 36.68 40 9 CYS A 47 ? ? -128.66 -167.55 41 9 HIS A 48 ? ? -155.22 69.35 42 10 GLU A 2 ? ? -152.21 54.02 43 10 HIS A 36 ? ? 59.64 73.77 44 10 PRO A 43 ? ? -73.17 48.84 45 10 HIS A 48 ? ? -146.00 46.64 46 10 GLU A 50 ? ? -163.03 96.81 47 11 HIS A 36 ? ? 58.03 72.13 48 11 PRO A 43 ? ? -74.17 45.68 49 11 GLU A 50 ? ? 71.39 107.12 50 12 HIS A 36 ? ? 60.98 76.70 51 12 PRO A 43 ? ? -74.53 48.53 52 12 HIS A 48 ? ? -166.53 57.58 53 12 CYS A 49 ? ? -71.62 -165.14 54 12 GLU A 50 ? ? 74.84 -64.84 55 13 ARG A 18 ? ? -141.19 48.52 56 13 PRO A 43 ? ? -72.98 49.25 57 14 PRO A 43 ? ? -72.35 48.89 58 15 HIS A 36 ? ? 58.80 70.36 59 15 PRO A 43 ? ? -74.56 46.26 60 15 GLU A 50 ? ? 177.08 166.98 61 16 GLU A 2 ? ? -79.03 -79.95 62 16 ARG A 18 ? ? -144.04 36.39 63 16 HIS A 36 ? ? 58.21 70.46 64 16 PRO A 43 ? ? -72.52 40.72 65 16 HIS A 48 ? ? -156.62 77.17 66 16 CYS A 49 ? ? -102.62 -158.72 67 16 GLU A 50 ? ? 67.82 -172.51 68 17 CYS A 10 ? ? -161.81 116.54 69 17 HIS A 36 ? ? 57.99 73.23 70 17 PRO A 43 ? ? -73.43 39.66 71 17 GLU A 50 ? ? -176.12 115.06 72 18 ARG A 18 ? ? -140.25 22.61 73 18 HIS A 36 ? ? 62.65 73.00 74 18 PRO A 43 ? ? -71.71 33.25 75 18 HIS A 48 ? ? -156.60 72.66 76 18 GLU A 50 ? ? -178.56 137.99 77 19 GLU A 2 ? ? -103.94 -66.97 78 19 ARG A 18 ? ? -141.76 29.54 79 19 HIS A 36 ? ? 58.10 72.61 80 19 PRO A 43 ? ? -71.01 44.28 81 19 HIS A 48 ? ? -152.40 60.23 82 20 GLU A 2 ? ? -97.58 -80.81 83 20 PRO A 43 ? ? -73.64 44.87 84 20 HIS A 48 ? ? -152.18 51.27 85 20 GLU A 50 ? ? 72.57 -61.83 # _pdbx_nmr_ensemble.entry_id 6GV7 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6GV7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-13C; U-15N] metallothionein, 2 mM CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C15N_sample solution ? 2 '1 mM metallothionein, 4 mM [U-113Cd] CADMIUM ION, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 90% H2O/10% D2O' '90% H2O/10% D2O' 113Cd_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 metallothionein 0.5 ? mM '[U-13C; U-15N]' 1 'CADMIUM ION' 2 ? mM 'natural abundance' 1 TRIS 50 ? mM '[U-2H]' 1 'sodium chloride' 50 ? mM 'natural abundance' 2 metallothionein 1 ? mM 'natural abundance' 2 'CADMIUM ION' 4 ? mM '[U-113Cd]' 2 TRIS 50 ? mM '[U-2H]' 2 'sodium chloride' 50 ? mM 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 atm 1 7.4 50 ? ? mM conditions_1 0.1 pH ? ? K 2 320 atm 1 7.4 50 ? ? mM conditions_2 0.1 pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HN(CO)CA' 1 isotropic 6 1 1 '3D HNCACB' 1 isotropic 7 1 1 '3D CBCA(CO)NH' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 9 1 1 '3D HCCH-TOCSY' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 3 isotropic 11 1 1 '3D 1H-13C NOESY aliphatic' 3 isotropic 12 1 1 '3D 1H-13C NOESY aromatic' 3 isotropic 13 2 2 '1D 113Cd' 2 isotropic 14 2 2 '2D 1H-113Cd HSQC-TOCSY' 2 isotropic # _pdbx_nmr_refine.entry_id 6GV7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 4.0 'Bruker Biospin' 2 processing TopSpin 3.5 'Bruker Biospin' 3 'chemical shift assignment' CARA 1.9.1.5 'Keller and Wuthrich' 4 'peak picking' UNIO 2.02 Hermann 5 'structure calculation' CYANA 3.97 'Guntert, Mumenthaler and Wuthrich' 6 refinement Xplor-NIH 4.0 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CD CD CD N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 PRO N N N N 229 PRO CA C N S 230 PRO C C N N 231 PRO O O N N 232 PRO CB C N N 233 PRO CG C N N 234 PRO CD C N N 235 PRO OXT O N N 236 PRO H H N N 237 PRO HA H N N 238 PRO HB2 H N N 239 PRO HB3 H N N 240 PRO HG2 H N N 241 PRO HG3 H N N 242 PRO HD2 H N N 243 PRO HD3 H N N 244 PRO HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 TYR N N N N 260 TYR CA C N S 261 TYR C C N N 262 TYR O O N N 263 TYR CB C N N 264 TYR CG C Y N 265 TYR CD1 C Y N 266 TYR CD2 C Y N 267 TYR CE1 C Y N 268 TYR CE2 C Y N 269 TYR CZ C Y N 270 TYR OH O N N 271 TYR OXT O N N 272 TYR H H N N 273 TYR H2 H N N 274 TYR HA H N N 275 TYR HB2 H N N 276 TYR HB3 H N N 277 TYR HD1 H N N 278 TYR HD2 H N N 279 TYR HE1 H N N 280 TYR HE2 H N N 281 TYR HH H N N 282 TYR HXT H N N 283 VAL N N N N 284 VAL CA C N S 285 VAL C C N N 286 VAL O O N N 287 VAL CB C N N 288 VAL CG1 C N N 289 VAL CG2 C N N 290 VAL OXT O N N 291 VAL H H N N 292 VAL H2 H N N 293 VAL HA H N N 294 VAL HB H N N 295 VAL HG11 H N N 296 VAL HG12 H N N 297 VAL HG13 H N N 298 VAL HG21 H N N 299 VAL HG22 H N N 300 VAL HG23 H N N 301 VAL HXT H N N 302 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 TYR N CA sing N N 248 TYR N H sing N N 249 TYR N H2 sing N N 250 TYR CA C sing N N 251 TYR CA CB sing N N 252 TYR CA HA sing N N 253 TYR C O doub N N 254 TYR C OXT sing N N 255 TYR CB CG sing N N 256 TYR CB HB2 sing N N 257 TYR CB HB3 sing N N 258 TYR CG CD1 doub Y N 259 TYR CG CD2 sing Y N 260 TYR CD1 CE1 sing Y N 261 TYR CD1 HD1 sing N N 262 TYR CD2 CE2 doub Y N 263 TYR CD2 HD2 sing N N 264 TYR CE1 CZ doub Y N 265 TYR CE1 HE1 sing N N 266 TYR CE2 CZ sing Y N 267 TYR CE2 HE2 sing N N 268 TYR CZ OH sing N N 269 TYR OH HH sing N N 270 TYR OXT HXT sing N N 271 VAL N CA sing N N 272 VAL N H sing N N 273 VAL N H2 sing N N 274 VAL CA C sing N N 275 VAL CA CB sing N N 276 VAL CA HA sing N N 277 VAL C O doub N N 278 VAL C OXT sing N N 279 VAL CB CG1 sing N N 280 VAL CB CG2 sing N N 281 VAL CB HB sing N N 282 VAL CG1 HG11 sing N N 283 VAL CG1 HG12 sing N N 284 VAL CG1 HG13 sing N N 285 VAL CG2 HG21 sing N N 286 VAL CG2 HG22 sing N N 287 VAL CG2 HG23 sing N N 288 VAL OXT HXT sing N N 289 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Other government' Switzerland FK-15-085 1 'Other government' Switzerland FK-17-091 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 'CRYO TCI inverse triple-resonance (1H; 13C; 15N) with a cold 13C-Channel and an actively shielded z-gradient coil' 3 AVANCE ? Bruker 700 'CRYO TXI inverse triple-resonance (1H; 13C; 15N) with an actively shielded z-gradient coil' 2 'AVANCE II' ? Bruker 500 'CRYO 5 mm QNP (1H,13C,31P,19F) with an actively shielded z-gradient coil and ATM' # _atom_sites.entry_id 6GV7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CD H N O S # loop_