data_6H0I # _entry.id 6H0I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6H0I pdb_00006h0i 10.2210/pdb6h0i/pdb WWPDB D_1200010836 ? ? BMRB 34298 ? 10.13018/BMR34298 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-22 2 'Structure model' 1 1 2018-10-31 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2019-12-18 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Data collection' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Database references' 11 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_nmr_software 4 4 'Structure model' citation 5 4 'Structure model' citation_author 6 4 'Structure model' pdbx_nmr_spectrometer 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_database_status 9 6 'Structure model' chem_comp_atom 10 6 'Structure model' chem_comp_bond 11 6 'Structure model' database_2 12 6 'Structure model' pdbx_entry_details 13 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_nmr_software.name' 2 4 'Structure model' '_citation.country' 3 4 'Structure model' '_citation.journal_abbrev' 4 4 'Structure model' '_citation.journal_id_CSD' 5 4 'Structure model' '_citation.journal_id_ISSN' 6 4 'Structure model' '_citation.journal_volume' 7 4 'Structure model' '_citation.page_first' 8 4 'Structure model' '_citation.page_last' 9 4 'Structure model' '_citation.pdbx_database_id_DOI' 10 4 'Structure model' '_citation.pdbx_database_id_PubMed' 11 4 'Structure model' '_citation.title' 12 4 'Structure model' '_citation.year' 13 4 'Structure model' '_pdbx_nmr_spectrometer.model' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' 16 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 17 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6H0I _pdbx_database_status.recvd_initial_deposition_date 2018-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of Melampsora larici-populina MlpP4.1' _pdbx_database_related.db_id 34298 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tsan, P.' 1 ? 'Petre, B.' 2 ? 'Hecker, A.' 3 ? 'Rouhier, N.' 4 ? 'Duplessis, S.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 18084 _citation.page_last 18084 _citation.title ;Structural genomics applied to the rust fungus Melampsora larici-populina reveals two candidate effector proteins adopting cystine knot and NTF2-like protein folds. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-019-53816-9 _citation.pdbx_database_id_PubMed 31792250 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'de Guillen, K.' 1 ? primary 'Lorrain, C.' 2 ? primary 'Tsan, P.' 3 ? primary 'Barthe, P.' 4 ? primary 'Petre, B.' 5 ? primary 'Saveleva, N.' 6 ? primary 'Rouhier, N.' 7 ? primary 'Duplessis, S.' 8 ? primary 'Padilla, A.' 9 ? primary 'Hecker, A.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Secreted protein' _entity.formula_weight 7978.616 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MCEFIEDSEDIQGLKSLRKSHTSLEDDDDGSRGGDCEGCSGTACSSDAQCRARGCDGCSTSGVCVLSSLHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MCEFIEDSEDIQGLKSLRKSHTSLEDDDDGSRGGDCEGCSGTACSSDAQCRARGCDGCSTSGVCVLSSLHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 CYS n 1 3 GLU n 1 4 PHE n 1 5 ILE n 1 6 GLU n 1 7 ASP n 1 8 SER n 1 9 GLU n 1 10 ASP n 1 11 ILE n 1 12 GLN n 1 13 GLY n 1 14 LEU n 1 15 LYS n 1 16 SER n 1 17 LEU n 1 18 ARG n 1 19 LYS n 1 20 SER n 1 21 HIS n 1 22 THR n 1 23 SER n 1 24 LEU n 1 25 GLU n 1 26 ASP n 1 27 ASP n 1 28 ASP n 1 29 ASP n 1 30 GLY n 1 31 SER n 1 32 ARG n 1 33 GLY n 1 34 GLY n 1 35 ASP n 1 36 CYS n 1 37 GLU n 1 38 GLY n 1 39 CYS n 1 40 SER n 1 41 GLY n 1 42 THR n 1 43 ALA n 1 44 CYS n 1 45 SER n 1 46 SER n 1 47 ASP n 1 48 ALA n 1 49 GLN n 1 50 CYS n 1 51 ARG n 1 52 ALA n 1 53 ARG n 1 54 GLY n 1 55 CYS n 1 56 ASP n 1 57 GLY n 1 58 CYS n 1 59 SER n 1 60 THR n 1 61 SER n 1 62 GLY n 1 63 VAL n 1 64 CYS n 1 65 VAL n 1 66 LEU n 1 67 SER n 1 68 SER n 1 69 LEU n 1 70 HIS n 1 71 HIS n 1 72 HIS n 1 73 HIS n 1 74 HIS n 1 75 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 75 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MELLADRAFT_124266 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Melampsora larici-populina 98AG31' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 747676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 HIS 75 75 75 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6H0I _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6H0I _struct.title 'Solution structure of Melampsora larici-populina MlpP4.1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6H0I _struct_keywords.text 'cysteine knot protein, poplar rust, effector, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F4RME6_MELLP _struct_ref.pdbx_db_accession F4RME6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MCEFIEDSEDIQGLKSLRKSHTSLEDDDDGSRGGDCEGCSGTACSSDAQCRARGCDGCSTSGVCVLSSL _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6H0I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F4RME6 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 69 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6H0I HIS A 70 ? UNP F4RME6 ? ? 'expression tag' 70 1 1 6H0I HIS A 71 ? UNP F4RME6 ? ? 'expression tag' 71 2 1 6H0I HIS A 72 ? UNP F4RME6 ? ? 'expression tag' 72 3 1 6H0I HIS A 73 ? UNP F4RME6 ? ? 'expression tag' 73 4 1 6H0I HIS A 74 ? UNP F4RME6 ? ? 'expression tag' 74 5 1 6H0I HIS A 75 ? UNP F4RME6 ? ? 'expression tag' 75 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 17 ? SER A 23 ? LEU A 17 SER A 23 1 ? 7 HELX_P HELX_P2 AA2 ASP A 47 ? ARG A 53 ? ASP A 47 ARG A 53 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 39 A CYS 55 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf2 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 44 A CYS 58 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf3 disulf ? ? A CYS 50 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 50 A CYS 64 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 39 ? CYS A 55 ? CYS A 39 ? 1_555 CYS A 55 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 44 ? CYS A 58 ? CYS A 44 ? 1_555 CYS A 58 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 50 ? CYS A 64 ? CYS A 50 ? 1_555 CYS A 64 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 57 ? CYS A 58 ? GLY A 57 CYS A 58 AA1 2 CYS A 64 ? VAL A 65 ? CYS A 64 VAL A 65 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLY _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 57 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 57 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 65 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 65 # _pdbx_entry_details.entry_id 6H0I _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG A CYS 2 ? ? OE1 A GLU 6 ? ? 1.56 2 1 H A SER 40 ? ? O A CYS 64 ? ? 1.59 3 6 H1 A MET 1 ? ? OE1 A GLU 3 ? ? 1.60 4 10 OD2 A ASP 7 ? ? HZ2 A LYS 15 ? ? 1.57 5 10 OD2 A ASP 10 ? ? HZ1 A LYS 15 ? ? 1.58 6 10 OD1 A ASP 56 ? ? HD1 A HIS 70 ? ? 1.60 7 19 HZ2 A LYS 19 ? ? OE2 A GLU 25 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 2 ? ? -161.18 87.81 2 1 PHE A 4 ? ? -156.01 46.15 3 1 ILE A 5 ? ? -140.79 -69.35 4 1 ASP A 29 ? ? 72.98 -19.32 5 1 GLU A 37 ? ? -164.76 59.69 6 1 CYS A 39 ? ? -65.98 -84.35 7 1 SER A 40 ? ? 68.33 -54.01 8 1 CYS A 55 ? ? -69.99 -81.26 9 1 ASP A 56 ? ? -176.83 -61.94 10 1 SER A 67 ? ? -52.80 108.86 11 1 HIS A 71 ? ? 67.71 71.23 12 1 HIS A 72 ? ? 64.38 -167.60 13 2 CYS A 2 ? ? -147.73 39.53 14 2 GLU A 6 ? ? -170.55 -22.34 15 2 THR A 22 ? ? -64.83 13.08 16 2 ARG A 32 ? ? -40.81 104.35 17 2 SER A 40 ? ? 84.26 -62.20 18 2 CYS A 55 ? ? -73.05 -79.67 19 2 ASP A 56 ? ? 178.94 -58.57 20 2 LEU A 69 ? ? -161.19 -51.01 21 2 HIS A 72 ? ? -78.63 44.13 22 3 ILE A 5 ? ? -139.31 -70.83 23 3 SER A 16 ? ? -79.25 31.81 24 3 SER A 23 ? ? -168.31 46.93 25 3 GLU A 25 ? ? -163.03 89.81 26 3 SER A 31 ? ? -77.20 25.22 27 3 CYS A 39 ? ? 61.57 81.68 28 3 SER A 40 ? ? 166.88 -40.57 29 3 CYS A 55 ? ? -88.28 -91.02 30 3 ASP A 56 ? ? -167.75 -57.90 31 3 HIS A 70 ? ? -98.22 -82.16 32 3 HIS A 71 ? ? 44.41 -109.77 33 4 ARG A 18 ? ? -112.42 76.82 34 4 SER A 20 ? ? -137.80 -46.04 35 4 LEU A 24 ? ? -155.43 -36.94 36 4 ASP A 26 ? ? 67.81 -157.85 37 4 CYS A 36 ? ? -59.55 97.92 38 4 GLU A 37 ? ? 78.43 -21.47 39 4 CYS A 39 ? ? -82.26 43.33 40 4 CYS A 55 ? ? -68.28 -83.88 41 4 ASP A 56 ? ? 175.07 -59.96 42 4 THR A 60 ? ? -57.45 0.20 43 4 HIS A 71 ? ? -92.75 59.91 44 5 GLU A 3 ? ? -178.45 120.81 45 5 GLU A 6 ? ? -96.38 53.22 46 5 ASP A 10 ? ? 58.75 19.89 47 5 ASP A 26 ? ? 77.70 156.24 48 5 ASP A 35 ? ? -160.84 -19.81 49 5 CYS A 39 ? ? -166.08 -89.68 50 5 CYS A 55 ? ? -84.19 -93.11 51 5 ASP A 56 ? ? -175.96 -62.94 52 5 THR A 60 ? ? -61.73 3.75 53 5 HIS A 73 ? ? -93.92 48.11 54 6 ILE A 5 ? ? -75.16 29.31 55 6 ASP A 7 ? ? -66.47 16.47 56 6 GLU A 9 ? ? -35.21 -21.92 57 6 LEU A 14 ? ? 71.98 98.92 58 6 SER A 16 ? ? -130.47 -64.03 59 6 LEU A 17 ? ? -132.88 -40.54 60 6 THR A 22 ? ? -67.80 14.64 61 6 GLU A 25 ? ? -164.61 89.35 62 6 ASP A 28 ? ? -60.05 -70.03 63 6 ASP A 35 ? ? -77.97 41.14 64 6 GLU A 37 ? ? -117.57 66.21 65 6 CYS A 39 ? ? -92.12 53.05 66 6 ASP A 56 ? ? 162.57 -58.15 67 6 THR A 60 ? ? -59.30 6.14 68 6 HIS A 70 ? ? 64.26 88.29 69 7 SER A 20 ? ? -133.42 -30.95 70 7 LEU A 24 ? ? -91.07 38.92 71 7 SER A 40 ? ? 69.92 -59.59 72 7 CYS A 55 ? ? -76.83 -81.57 73 7 ASP A 56 ? ? -178.18 -68.25 74 7 SER A 67 ? ? -45.08 106.56 75 7 HIS A 74 ? ? -90.90 -73.64 76 8 ILE A 5 ? ? 70.66 -15.41 77 8 ASP A 10 ? ? 72.38 -14.26 78 8 LEU A 14 ? ? -119.70 61.64 79 8 ARG A 18 ? ? -48.02 102.83 80 8 SER A 20 ? ? -125.70 -61.80 81 8 ASP A 29 ? ? 39.78 45.78 82 8 GLU A 37 ? ? -155.20 68.94 83 8 CYS A 39 ? ? -167.29 73.47 84 8 ASP A 56 ? ? 143.33 -41.90 85 8 HIS A 70 ? ? -128.01 -68.65 86 9 CYS A 2 ? ? 66.69 177.55 87 9 ASP A 10 ? ? -47.48 91.04 88 9 LYS A 19 ? ? -99.23 41.84 89 9 LEU A 24 ? ? 73.68 -11.60 90 9 ASP A 28 ? ? -36.78 -70.65 91 9 ARG A 32 ? ? -166.20 99.75 92 9 CYS A 39 ? ? -160.90 65.75 93 9 SER A 40 ? ? 150.56 -55.86 94 9 CYS A 55 ? ? -69.17 -86.98 95 9 ASP A 56 ? ? 173.03 -57.56 96 9 THR A 60 ? ? -62.30 1.95 97 9 HIS A 72 ? ? -143.34 21.82 98 10 CYS A 2 ? ? -115.20 61.71 99 10 SER A 20 ? ? -116.50 -82.38 100 10 SER A 23 ? ? -141.25 -15.01 101 10 GLU A 25 ? ? 58.15 85.14 102 10 GLU A 37 ? ? -170.62 64.70 103 10 SER A 40 ? ? 81.41 -47.29 104 10 CYS A 55 ? ? -59.97 -75.69 105 10 ASP A 56 ? ? 171.43 -57.29 106 10 THR A 60 ? ? -61.52 5.11 107 10 SER A 68 ? ? 58.39 -97.87 108 10 HIS A 74 ? ? -170.15 148.08 109 11 GLU A 3 ? ? 58.74 70.64 110 11 ILE A 5 ? ? -153.92 -77.12 111 11 GLU A 6 ? ? 175.06 -48.99 112 11 SER A 16 ? ? -130.54 -40.07 113 11 THR A 22 ? ? -67.66 13.26 114 11 GLU A 25 ? ? 70.86 98.49 115 11 ASP A 29 ? ? 74.69 128.64 116 11 CYS A 39 ? ? -75.99 -74.16 117 11 SER A 40 ? ? 57.46 -75.10 118 11 CYS A 55 ? ? -87.81 -91.28 119 11 ASP A 56 ? ? -162.18 -61.49 120 11 SER A 67 ? ? -43.54 107.87 121 11 LEU A 69 ? ? -148.57 50.35 122 11 HIS A 71 ? ? -135.41 -147.40 123 12 CYS A 2 ? ? -157.43 47.81 124 12 SER A 20 ? ? -132.18 -51.80 125 12 LEU A 24 ? ? 71.45 -43.87 126 12 SER A 31 ? ? -79.85 24.05 127 12 SER A 40 ? ? 175.79 131.45 128 12 CYS A 55 ? ? -77.40 -89.51 129 12 ASP A 56 ? ? -176.59 -54.41 130 12 HIS A 71 ? ? -167.22 -66.90 131 12 HIS A 72 ? ? -175.48 -63.42 132 12 HIS A 73 ? ? -157.89 69.82 133 13 ILE A 5 ? ? -76.15 32.42 134 13 CYS A 55 ? ? -60.66 -81.84 135 13 ASP A 56 ? ? 164.18 -54.01 136 13 THR A 60 ? ? -64.50 4.96 137 13 SER A 67 ? ? -45.08 108.20 138 14 ASP A 10 ? ? 72.46 -72.05 139 14 ARG A 18 ? ? -149.96 57.80 140 14 SER A 20 ? ? -148.57 -52.56 141 14 SER A 40 ? ? -179.88 -50.88 142 14 CYS A 55 ? ? -57.72 -73.64 143 14 ASP A 56 ? ? 168.22 -52.55 144 14 THR A 60 ? ? -65.33 5.94 145 14 HIS A 70 ? ? -107.63 77.93 146 15 CYS A 2 ? ? 72.46 -5.74 147 15 GLU A 3 ? ? 65.43 178.46 148 15 PHE A 4 ? ? -119.87 62.34 149 15 ILE A 5 ? ? -179.47 -60.49 150 15 ASP A 10 ? ? -54.10 95.73 151 15 LEU A 14 ? ? 66.40 60.20 152 15 LYS A 19 ? ? -156.03 17.66 153 15 SER A 20 ? ? -136.03 -96.82 154 15 SER A 23 ? ? -130.44 -57.63 155 15 ASP A 26 ? ? 62.89 -170.11 156 15 GLU A 37 ? ? -166.12 67.72 157 15 CYS A 39 ? ? -169.49 69.23 158 15 CYS A 55 ? ? -66.20 -85.32 159 15 ASP A 56 ? ? 170.46 -50.76 160 15 SER A 67 ? ? -49.39 108.55 161 15 SER A 68 ? ? -105.29 74.19 162 15 HIS A 74 ? ? 67.26 -80.30 163 16 CYS A 2 ? ? -165.82 71.90 164 16 GLU A 3 ? ? -79.43 29.04 165 16 ILE A 5 ? ? -152.63 -72.16 166 16 ASP A 10 ? ? 61.01 -93.08 167 16 ARG A 18 ? ? 67.65 -72.66 168 16 SER A 20 ? ? 168.63 -82.87 169 16 SER A 31 ? ? -75.35 24.66 170 16 CYS A 39 ? ? -175.71 -175.83 171 16 SER A 40 ? ? 56.80 -86.12 172 16 CYS A 55 ? ? -58.44 -76.38 173 16 ASP A 56 ? ? 165.81 -59.66 174 16 HIS A 73 ? ? 66.04 115.81 175 16 HIS A 74 ? ? 72.09 133.44 176 17 CYS A 2 ? ? 52.49 -104.59 177 17 GLU A 3 ? ? -93.70 56.85 178 17 PHE A 4 ? ? -159.10 76.50 179 17 LEU A 14 ? ? 63.51 98.53 180 17 THR A 22 ? ? -67.07 12.77 181 17 ASP A 29 ? ? 62.89 99.50 182 17 ASP A 35 ? ? -101.35 50.40 183 17 CYS A 36 ? ? -69.29 98.71 184 17 CYS A 39 ? ? -88.96 45.07 185 17 ASP A 56 ? ? 149.29 -49.69 186 17 SER A 67 ? ? -51.80 108.91 187 17 HIS A 74 ? ? 64.46 90.03 188 18 CYS A 2 ? ? -93.50 57.98 189 18 LYS A 19 ? ? -92.62 31.39 190 18 LEU A 24 ? ? -177.67 -42.92 191 18 GLU A 25 ? ? -136.73 -52.09 192 18 ASP A 26 ? ? 62.19 142.97 193 18 GLU A 37 ? ? -108.36 63.43 194 18 CYS A 39 ? ? -90.14 49.83 195 18 CYS A 55 ? ? -64.56 -78.22 196 18 ASP A 56 ? ? 178.44 -65.44 197 18 THR A 60 ? ? -60.64 6.27 198 18 SER A 67 ? ? -47.04 108.73 199 18 HIS A 72 ? ? -141.26 -68.11 200 18 HIS A 73 ? ? 177.60 142.29 201 19 SER A 16 ? ? -77.15 30.73 202 19 GLU A 37 ? ? 169.59 69.42 203 19 SER A 40 ? ? -174.46 -66.40 204 19 CYS A 55 ? ? -64.03 -83.37 205 19 ASP A 56 ? ? 175.43 -55.14 206 19 HIS A 70 ? ? 59.25 -85.49 207 19 HIS A 72 ? ? 61.06 67.33 208 20 GLU A 3 ? ? 71.97 167.38 209 20 SER A 20 ? ? -169.91 -88.82 210 20 THR A 22 ? ? -66.28 13.46 211 20 LEU A 24 ? ? -128.40 -50.78 212 20 GLU A 25 ? ? -168.92 112.27 213 20 ASP A 29 ? ? 49.82 74.81 214 20 ARG A 32 ? ? 23.25 97.25 215 20 CYS A 55 ? ? -55.46 -73.45 216 20 ASP A 56 ? ? 170.63 -64.97 217 20 SER A 67 ? ? -45.88 107.32 218 20 SER A 68 ? ? -47.00 -79.06 219 20 HIS A 70 ? ? -101.79 -65.01 220 20 HIS A 71 ? ? 53.88 79.95 221 20 HIS A 74 ? ? -153.46 -69.03 # _pdbx_nmr_ensemble.entry_id 6H0I _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6H0I _pdbx_nmr_representative.conformer_id 14 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50 mM potassium phosphate, 0.02 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'potassium phosphate' 50 ? mM 'natural abundance' 1 'sodium azide' 0.02 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 1 '3D 1H-15N TOCSY' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HNHA' 1 isotropic 5 1 1 '3D HNHB' 1 isotropic # _pdbx_nmr_refine.entry_id 6H0I _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 processing TopSpin ? 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 VAL N N N N 284 VAL CA C N S 285 VAL C C N N 286 VAL O O N N 287 VAL CB C N N 288 VAL CG1 C N N 289 VAL CG2 C N N 290 VAL OXT O N N 291 VAL H H N N 292 VAL H2 H N N 293 VAL HA H N N 294 VAL HB H N N 295 VAL HG11 H N N 296 VAL HG12 H N N 297 VAL HG13 H N N 298 VAL HG21 H N N 299 VAL HG22 H N N 300 VAL HG23 H N N 301 VAL HXT H N N 302 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 SER N CA sing N N 242 SER N H sing N N 243 SER N H2 sing N N 244 SER CA C sing N N 245 SER CA CB sing N N 246 SER CA HA sing N N 247 SER C O doub N N 248 SER C OXT sing N N 249 SER CB OG sing N N 250 SER CB HB2 sing N N 251 SER CB HB3 sing N N 252 SER OG HG sing N N 253 SER OXT HXT sing N N 254 THR N CA sing N N 255 THR N H sing N N 256 THR N H2 sing N N 257 THR CA C sing N N 258 THR CA CB sing N N 259 THR CA HA sing N N 260 THR C O doub N N 261 THR C OXT sing N N 262 THR CB OG1 sing N N 263 THR CB CG2 sing N N 264 THR CB HB sing N N 265 THR OG1 HG1 sing N N 266 THR CG2 HG21 sing N N 267 THR CG2 HG22 sing N N 268 THR CG2 HG23 sing N N 269 THR OXT HXT sing N N 270 VAL N CA sing N N 271 VAL N H sing N N 272 VAL N H2 sing N N 273 VAL CA C sing N N 274 VAL CA CB sing N N 275 VAL CA HA sing N N 276 VAL C O doub N N 277 VAL C OXT sing N N 278 VAL CB CG1 sing N N 279 VAL CB CG2 sing N N 280 VAL CB HB sing N N 281 VAL CG1 HG11 sing N N 282 VAL CG1 HG12 sing N N 283 VAL CG1 HG13 sing N N 284 VAL CG2 HG21 sing N N 285 VAL CG2 HG22 sing N N 286 VAL CG2 HG23 sing N N 287 VAL OXT HXT sing N N 288 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6H0I _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_