data_6HIR # _entry.id 6HIR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6HIR WWPDB D_1000179833 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4HIR _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 6HIR _pdbx_database_status.recvd_initial_deposition_date 1990-01-09 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Gronenborn, A.M.' 2 # _citation.id primary _citation.title ;Solution structure of recombinant hirudin and the Lys-47----Glu mutant: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 28 _citation.page_first 2601 _citation.page_last 2617 _citation.year 1989 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 2567183 _citation.pdbx_database_id_DOI 10.1021/bi00432a038 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Folkers, P.J.' 1 primary 'Clore, G.M.' 2 primary 'Driscoll, P.C.' 3 primary 'Dodt, J.' 4 primary 'Kohler, S.' 5 primary 'Gronenborn, A.M.' 6 # _cell.entry_id 6HIR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HIR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HIRUDIN VARIANT-1' _entity.formula_weight 6973.439 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPEPQSHNDGDFEEIPEEYLQ _entity_poly.pdbx_seq_one_letter_code_can VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPEPQSHNDGDFEEIPEEYLQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 TYR n 1 4 THR n 1 5 ASP n 1 6 CYS n 1 7 THR n 1 8 GLU n 1 9 SER n 1 10 GLY n 1 11 GLN n 1 12 ASN n 1 13 LEU n 1 14 CYS n 1 15 LEU n 1 16 CYS n 1 17 GLU n 1 18 GLY n 1 19 SER n 1 20 ASN n 1 21 VAL n 1 22 CYS n 1 23 GLY n 1 24 GLN n 1 25 GLY n 1 26 ASN n 1 27 LYS n 1 28 CYS n 1 29 ILE n 1 30 LEU n 1 31 GLY n 1 32 SER n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 LYS n 1 37 ASN n 1 38 GLN n 1 39 CYS n 1 40 VAL n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 THR n 1 46 PRO n 1 47 GLU n 1 48 PRO n 1 49 GLN n 1 50 SER n 1 51 HIS n 1 52 ASN n 1 53 ASP n 1 54 GLY n 1 55 ASP n 1 56 PHE n 1 57 GLU n 1 58 GLU n 1 59 ILE n 1 60 PRO n 1 61 GLU n 1 62 GLU n 1 63 TYR n 1 64 LEU n 1 65 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'medicinal leech' _entity_src_gen.gene_src_genus Hirudo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hirudo medicinalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITH1_HIRME _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01050 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6HIR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01050 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 65 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6HIR _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 47 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01050 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 47 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 47 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_refine.entry_id 6HIR _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;THE METHOD USED TO DETERMINE AND REFINE THE STRUCTURE IS THE HYBRID METRIC MATRIX DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD (M.NILGES, G.M.CLORE, A.M. GRONENBORN, FEBS LETT. 229, 317-324 (1988)) USING THE PROGRAM XPLOR (A.T. BRUENGER, YALE UNIVERSITY, CT 06511). STRUCTURAL STATISTICS RMS DEVIATION FROM EXPERIMENTAL RESTRAINTS *(1)* RESTRAINT TYPE NUMBER OF RESTRAINTS RMS (ANGSTROMS) ALL 677 0.071 INTERRESIDUE SHORT RANGE 234 0.083 INTERRESIDUE LONG RANGE 199 0.068 INTRARESIDUE 228 0.062 HBOND *(2)* 16 0.039 POTENTIAL ENERGY TERMS TYPE ENERGY (KCAL/MOL) F(NOE) *(3)* 170 F(TOR) *(4)* 16 F(REPEL) *(5)* 49 LENNARD-JONES VAN DER WAALS ENERGY (E(L-J)) CALCULATED USING THE *CHARMM* EMPIRICAL ENERGY FUNCTION IS -73 KCAL/MOL. DEVIATIONS FROM IDEALIZED GEOMETRY *(6)* TYPE TOTAL NUMBER RMS DEVIATION BONDS 669 0.011 (ANGSTROMS) ANGLES 1208 3.177 (DEGREES) IMPROPERS 132 0.419 (DEGREES) NOTES. *(1)* THE RMS DEVIATION FROM THE EXPERIMENTAL RESTRAINTS ARE CALCULATED WITH RESPECT TO THE UPPER AND LOWER LIMITS OF THE DISTANCE RESTRAINTS. NONE OF THE STRUCTURES EXHIBITED VIOLATIONS GREATER THAN 0.5 ANGSTROMS. *(2)* FOR EACH BACKBONE HYDROGEN BOND THERE ARE TWO RESTRAINTS - R(NH-O) .LT. 2.3 ANGSTROMS AND R(N-O) .LT. 3.3 ANGSTROMS. THE LOWER LIMITS ARE GIVEN BY THE SUM OF THE VAN DER WAALS RADII OF THE RELEVANT ATOMS. *(3)* THE VALUES OF THE SQUARE-WELL NOE POTENTIAL F(NOE) ARE CALCULATED WITH A FORCE CONSTANT OF 50 KCAL/MOL/ANGSTROM**2. *(4)* THE VALUES OF F(PHI) ARE CALCULATED WITH A FORCE CONSTANT OF 200 KCAL/MOL/RAD**2. F(PHI) IS A SQUARE-WELL DIHEDRAL POTENTIAL WHICH IS USED TO RESTRICT THE RANGES OF 26 PHI AND 18 CHI1 TORSION ANGLES. *(5)* THE VALUE OF THE VAN DER WAALS REPULSION TERM F(REPEL) IS CALCULATED WITH A FORCE CONSTANT OF 4 KCAL/MOL/ANGSTROM**4 WITH THE HARD SPHERE VAN DER WAALS RADII SET TO 0.8 TIMES THE STANDARD VALUES USED IN THE *CHARMM* EMPIRICAL ENERGY FUNCTION. *(6)* THE IMPROPER TERMS SERVE TO MAINTAIN PLANARITY AND APPROPRIATE CHIRALITY. THEY ALSO MAINTAIN THE PEPTIDE BONDS OF ALL RESIDUES (WITH THE EXCEPTION OF PROLINES) IN THE TRANS CONFORMATION. IN THE DYNAMICAL SIMULATED ANNEALING CALCULATIONS, THE RESTRAINTS FOR THE DISULFIDE BRIDGES ARE INCLUDED IN THE BOND AND ANGLE TERMS. A TOTAL OF 32 STRUCTURES CONSISTENT WITH THE NMR DATA WERE CALCULATED. THIS ENTRY REPRESENTS THE COORDINATES OBTAINED BY AVERAGING THE COORDINATES OF THE INDIVIDUAL STRUCTURES AND SUBJECTING THE RESULTING COORDINATES TO FURTHER RESTRAINED MINIMIZATION. THE COORDINATES OF THESE 32 STRUCTURES ARE GIVEN IN PROTEIN DATA BANK ENTRY *4HIR*. THE THERMAL PARAMETERS GIVEN IN THIS ENTRY REPRESENT THE ATOMIC RMS DEVIATION OF THE INDIVIDUAL STRUCTURES ABOUT THE MEAN COORDINATE POSITIONS. ONLY RESIDUES 1-49 ARE WELL DEFINED. RESIDUES 50-65 FORM A DISORDERED C-TERMINAL TAIL. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 6HIR _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 6HIR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 6HIR _struct.title ;SOLUTION STRUCTURE OF RECOMBINANT HIRUDIN AND THE LYS-47 (RIGHT ARROW) GLU MUTANT. A NUCLEAR MAGNETIC RESONANCE AND HYBRID DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING STUDY ; _struct.pdbx_descriptor 'HIRUDIN (MUTANT WITH LYS 47 REPLACED BY GLU) (K47E) (NMR, MINIMIZED MEAN STRUCTURE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 6HIR _struct_keywords.pdbx_keywords 'COAGULATION INHIBITOR' _struct_keywords.text 'COAGULATION INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 6 A CYS 14 1_555 ? ? ? ? ? ? ? 2.018 ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 16 A CYS 28 1_555 ? ? ? ? ? ? ? 2.017 ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 22 A CYS 39 1_555 ? ? ? ? ? ? ? 2.022 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 9 ? GLN A 11 ? SER A 9 GLN A 11 A 2 LYS A 27 ? GLY A 31 ? LYS A 27 GLY A 31 A 3 LYS A 36 ? VAL A 40 ? LYS A 36 VAL A 40 B 1 CYS A 14 ? CYS A 16 ? CYS A 14 CYS A 16 B 2 VAL A 21 ? CYS A 22 ? VAL A 21 CYS A 22 # _database_PDB_matrix.entry_id 6HIR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6HIR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 SER 50 50 ? ? ? A . n A 1 51 HIS 51 51 ? ? ? A . n A 1 52 ASN 52 52 ? ? ? A . n A 1 53 ASP 53 53 ? ? ? A . n A 1 54 GLY 54 54 ? ? ? A . n A 1 55 ASP 55 55 ? ? ? A . n A 1 56 PHE 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 GLU 58 58 ? ? ? A . n A 1 59 ILE 59 59 ? ? ? A . n A 1 60 PRO 60 60 ? ? ? A . n A 1 61 GLU 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n A 1 63 TYR 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 GLN 65 65 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1990-01-15 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 7 ? ? -141.00 -11.45 2 1 GLN A 11 ? ? -54.21 -171.30 3 1 ASN A 12 ? ? -149.07 -69.72 4 1 CYS A 14 ? ? -160.35 -150.93 5 1 GLN A 24 ? ? -37.63 132.43 6 1 LEU A 30 ? ? -79.01 -168.89 7 1 SER A 32 ? ? -67.77 -91.06 8 1 PRO A 46 ? ? -54.95 -174.15 9 1 PRO A 48 ? ? -60.38 -168.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 50 ? A SER 50 2 1 Y 1 A HIS 51 ? A HIS 51 3 1 Y 1 A ASN 52 ? A ASN 52 4 1 Y 1 A ASP 53 ? A ASP 53 5 1 Y 1 A GLY 54 ? A GLY 54 6 1 Y 1 A ASP 55 ? A ASP 55 7 1 Y 1 A PHE 56 ? A PHE 56 8 1 Y 1 A GLU 57 ? A GLU 57 9 1 Y 1 A GLU 58 ? A GLU 58 10 1 Y 1 A ILE 59 ? A ILE 59 11 1 Y 1 A PRO 60 ? A PRO 60 12 1 Y 1 A GLU 61 ? A GLU 61 13 1 Y 1 A GLU 62 ? A GLU 62 14 1 Y 1 A TYR 63 ? A TYR 63 15 1 Y 1 A LEU 64 ? A LEU 64 16 1 Y 1 A GLN 65 ? A GLN 65 #