data_6HJ4 # _entry.id 6HJ4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6HJ4 WWPDB D_1200011754 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HJ4 _pdbx_database_status.recvd_initial_deposition_date 2018-08-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pryce, R.' 1 ? 'Ng, W.M.' 2 ? 'Zeltina, A.' 3 ? 'Watanabe, Y.' 4 ? 'El Omari, K.' 5 ? 'Wagner, A.' 6 ? 'Bowden, T.A.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Virol.' _citation.journal_id_ASTM JOVIAM _citation.journal_id_CSD 0825 _citation.journal_id_ISSN 1098-5514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 93 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure-Based Classification Defines the Discrete Conformational Classes Adopted by the Arenaviral GP1.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/JVI.01048-18 _citation.pdbx_database_id_PubMed 30305351 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pryce, R.' 1 0000-0001-8824-9721 primary 'Ng, W.M.' 2 0000-0001-8218-5544 primary 'Zeltina, A.' 3 ? primary 'Watanabe, Y.' 4 ? primary 'El Omari, K.' 5 ? primary 'Wagner, A.' 6 ? primary 'Bowden, T.A.' 7 0000-0002-8066-8785 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6HJ4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.660 _cell.length_a_esd ? _cell.length_b 106.660 _cell.length_b_esd ? _cell.length_c 74.810 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HJ4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Pre-glycoprotein polyprotein GP complex' 18652.061 1 ? ? ? ? 2 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 3 ? ? ? ? 3 non-polymer syn 'CADMIUM ION' 112.411 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Pre-GP-C # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ETGASYITPYVPMPCMINDTHFLLRGPFEASWAIKLEITDVTTLVVDTDNVANPTNISKCFANNQDERLLGFTMEWFLSG LEHDHHFTPQIICGNVSKGEVNAQVNITMEDHCSQVFLKMRRIFGVFKNPCTSHGKQNVLISVSNWTNQCSGNHLSGTKH HHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;ETGASYITPYVPMPCMINDTHFLLRGPFEASWAIKLEITDVTTLVVDTDNVANPTNISKCFANNQDERLLGFTMEWFLSG LEHDHHFTPQIICGNVSKGEVNAQVNITMEDHCSQVFLKMRRIFGVFKNPCTSHGKQNVLISVSNWTNQCSGNHLSGTKH HHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 THR n 1 3 GLY n 1 4 ALA n 1 5 SER n 1 6 TYR n 1 7 ILE n 1 8 THR n 1 9 PRO n 1 10 TYR n 1 11 VAL n 1 12 PRO n 1 13 MET n 1 14 PRO n 1 15 CYS n 1 16 MET n 1 17 ILE n 1 18 ASN n 1 19 ASP n 1 20 THR n 1 21 HIS n 1 22 PHE n 1 23 LEU n 1 24 LEU n 1 25 ARG n 1 26 GLY n 1 27 PRO n 1 28 PHE n 1 29 GLU n 1 30 ALA n 1 31 SER n 1 32 TRP n 1 33 ALA n 1 34 ILE n 1 35 LYS n 1 36 LEU n 1 37 GLU n 1 38 ILE n 1 39 THR n 1 40 ASP n 1 41 VAL n 1 42 THR n 1 43 THR n 1 44 LEU n 1 45 VAL n 1 46 VAL n 1 47 ASP n 1 48 THR n 1 49 ASP n 1 50 ASN n 1 51 VAL n 1 52 ALA n 1 53 ASN n 1 54 PRO n 1 55 THR n 1 56 ASN n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 CYS n 1 61 PHE n 1 62 ALA n 1 63 ASN n 1 64 ASN n 1 65 GLN n 1 66 ASP n 1 67 GLU n 1 68 ARG n 1 69 LEU n 1 70 LEU n 1 71 GLY n 1 72 PHE n 1 73 THR n 1 74 MET n 1 75 GLU n 1 76 TRP n 1 77 PHE n 1 78 LEU n 1 79 SER n 1 80 GLY n 1 81 LEU n 1 82 GLU n 1 83 HIS n 1 84 ASP n 1 85 HIS n 1 86 HIS n 1 87 PHE n 1 88 THR n 1 89 PRO n 1 90 GLN n 1 91 ILE n 1 92 ILE n 1 93 CYS n 1 94 GLY n 1 95 ASN n 1 96 VAL n 1 97 SER n 1 98 LYS n 1 99 GLY n 1 100 GLU n 1 101 VAL n 1 102 ASN n 1 103 ALA n 1 104 GLN n 1 105 VAL n 1 106 ASN n 1 107 ILE n 1 108 THR n 1 109 MET n 1 110 GLU n 1 111 ASP n 1 112 HIS n 1 113 CYS n 1 114 SER n 1 115 GLN n 1 116 VAL n 1 117 PHE n 1 118 LEU n 1 119 LYS n 1 120 MET n 1 121 ARG n 1 122 ARG n 1 123 ILE n 1 124 PHE n 1 125 GLY n 1 126 VAL n 1 127 PHE n 1 128 LYS n 1 129 ASN n 1 130 PRO n 1 131 CYS n 1 132 THR n 1 133 SER n 1 134 HIS n 1 135 GLY n 1 136 LYS n 1 137 GLN n 1 138 ASN n 1 139 VAL n 1 140 LEU n 1 141 ILE n 1 142 SER n 1 143 VAL n 1 144 SER n 1 145 ASN n 1 146 TRP n 1 147 THR n 1 148 ASN n 1 149 GLN n 1 150 CYS n 1 151 SER n 1 152 GLY n 1 153 ASN n 1 154 HIS n 1 155 LEU n 1 156 SER n 1 157 GLY n 1 158 THR n 1 159 LYS n 1 160 HIS n 1 161 HIS n 1 162 HIS n 1 163 HIS n 1 164 HIS n 1 165 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 165 _entity_src_gen.gene_src_common_name 'isolate Rat/United States/AV 9310135/1995' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GPC, GP-C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Whitewater Arroyo mammarenavirus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 46919 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell HEK293T _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLYC_WWAVU _struct_ref.pdbx_db_accession Q911P0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASYITPYVPMPCMINDTHFLLRGPFEASWAIKLEITDVTTLVVDTDNVANPTNISKCFANNQDERLLGFTMEWFLSGLEH DHHFTPQIICGNVSKGEVNAQVNITMEDHCSQVFLKMRRIFGVFKNPCTSHGKQNVLISVSNWTNQCSGNHLS ; _struct_ref.pdbx_align_begin 74 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6HJ4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 156 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q911P0 _struct_ref_seq.db_align_beg 74 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 226 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 74 _struct_ref_seq.pdbx_auth_seq_align_end 226 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6HJ4 GLU A 1 ? UNP Q911P0 ? ? 'expression tag' 71 1 1 6HJ4 THR A 2 ? UNP Q911P0 ? ? 'expression tag' 72 2 1 6HJ4 GLY A 3 ? UNP Q911P0 ? ? 'expression tag' 73 3 1 6HJ4 GLY A 157 ? UNP Q911P0 ? ? 'expression tag' 227 4 1 6HJ4 THR A 158 ? UNP Q911P0 ? ? 'expression tag' 228 5 1 6HJ4 LYS A 159 ? UNP Q911P0 ? ? 'expression tag' 229 6 1 6HJ4 HIS A 160 ? UNP Q911P0 ? ? 'expression tag' 230 7 1 6HJ4 HIS A 161 ? UNP Q911P0 ? ? 'expression tag' 231 8 1 6HJ4 HIS A 162 ? UNP Q911P0 ? ? 'expression tag' 232 9 1 6HJ4 HIS A 163 ? UNP Q911P0 ? ? 'expression tag' 233 10 1 6HJ4 HIS A 164 ? UNP Q911P0 ? ? 'expression tag' 234 11 1 6HJ4 HIS A 165 ? UNP Q911P0 ? ? 'expression tag' 235 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HJ4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.29 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.0 mg/ml protein, 0.1 M HEPES-Na pH 7.5, and 0.05 M cadmium sulphate' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? ? 43 ? ? 1 ? ? ? 2 ? ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency ? PIXEL 1 'DECTRIS PILATUS 6M-F' ? ? ? ? 2016-07-06 ? ? PIXEL 2 'DECTRIS PILATUS 12M' ? ? ? ? 2016-07-20 ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97950 1.0 2 2.7552 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'DIAMOND BEAMLINE I04' ? ? 0.97950 ? I04 Diamond ? ? 2 ? ? SYNCHROTRON ? 'DIAMOND BEAMLINE I23' ? ? 2.7552 ? I23 Diamond # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_R_split ? 6HJ4 ? ? 2.43 29 ? ? ? ? ? ? ? ? 15417 ? ? ? ? ? ? ? 99.9 ? ? ? ? ? ? 18.8 0.068 ? ? ? 22.8 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? ? 6HJ4 ? ? 2.99 75 ? ? ? ? ? ? ? ? 5158 ? ? ? ? ? ? ? 94.3 ? ? ? ? ? ? 28.3 ? ? ? ? 25.2 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 ? ? # _reflns_shell.d_res_high 2.43 _reflns_shell.d_res_low 2.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 3.163 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HJ4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.430 _refine.ls_d_res_low 28.473 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15417 _refine.ls_number_reflns_R_free 868 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.70 _refine.ls_percent_reflns_R_free 4.85 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2217 _refine.ls_R_factor_R_free 0.2522 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2202 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.08 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.38 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1160 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 47 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1207 _refine_hist.d_res_high 2.430 _refine_hist.d_res_low 28.473 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1237 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.549 ? 1690 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.819 ? 730 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 198 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 215 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4304 2.5825 . . 157 2822 100.00 . . . 0.3449 . 0.3414 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5825 2.7818 . . 136 2834 99.00 . . . 0.3397 . 0.3010 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7818 3.0614 . . 161 2810 99.00 . . . 0.3694 . 0.2677 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0614 3.5037 . . 126 2852 100.00 . . . 0.3389 . 0.2655 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5037 4.4117 . . 147 2852 100.00 . . . 0.2336 . 0.2087 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4117 28.4747 . . 141 2857 100.00 . . . 0.2117 . 0.1936 . . . . . . . . . . # _struct.entry_id 6HJ4 _struct.title 'Crystal structure of Whitewater Arroyo virus GP1 glycoprotein at pH 7.5' _struct.pdbx_descriptor 'Pre-glycoprotein polyprotein GP complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HJ4 _struct_keywords.text 'Attachment, glycoprotein, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 56 ? ALA A 62 ? ASN A 126 ALA A 132 5 ? 7 HELX_P HELX_P2 AA2 ASP A 66 ? LEU A 78 ? ASP A 136 LEU A 148 1 ? 13 HELX_P HELX_P3 AA3 ASN A 95 ? GLY A 99 ? ASN A 165 GLY A 169 5 ? 5 HELX_P HELX_P4 AA4 MET A 109 ? GLY A 125 ? MET A 179 GLY A 195 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 150 SG ? ? A CYS 85 A CYS 220 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf2 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 93 SG ? ? A CYS 130 A CYS 163 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf3 disulf ? ? A CYS 113 SG ? ? ? 1_555 A CYS 131 SG ? ? A CYS 183 A CYS 201 1_555 ? ? ? ? ? ? ? 2.033 ? ? covale1 covale one ? A ASN 18 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 88 A NAG 301 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation covale2 covale one ? A ASN 56 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 126 A NAG 303 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation covale3 covale one ? A ASN 106 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 176 A NAG 302 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation metalc1 metalc ? ? A GLU 75 OE1 ? ? ? 1_555 F CD . CD ? ? A GLU 145 A CD 305 12_554 ? ? ? ? ? ? ? 2.700 ? ? metalc2 metalc ? ? A GLU 82 OE1 ? ? ? 1_555 F CD . CD ? ? A GLU 152 A CD 305 12_554 ? ? ? ? ? ? ? 2.692 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 13 ? ASN A 18 ? MET A 83 ASN A 88 AA1 2 HIS A 21 ? ARG A 25 ? HIS A 91 ARG A 95 AA1 3 TRP A 32 ? THR A 39 ? TRP A 102 THR A 109 AA1 4 ASN A 138 ? ASN A 145 ? ASN A 208 ASN A 215 AA1 5 ALA A 103 ? ASN A 106 ? ALA A 173 ASN A 176 AA1 6 ILE A 91 ? CYS A 93 ? ILE A 161 CYS A 163 AA1 7 VAL A 51 ? ALA A 52 ? VAL A 121 ALA A 122 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 13 ? N MET A 83 O ARG A 25 ? O ARG A 95 AA1 2 3 N PHE A 22 ? N PHE A 92 O LEU A 36 ? O LEU A 106 AA1 3 4 N GLU A 37 ? N GLU A 107 O LEU A 140 ? O LEU A 210 AA1 4 5 O ILE A 141 ? O ILE A 211 N ALA A 103 ? N ALA A 173 AA1 5 6 O GLN A 104 ? O GLN A 174 N ILE A 92 ? N ILE A 162 AA1 6 7 O ILE A 91 ? O ILE A 161 N ALA A 52 ? N ALA A 122 # _atom_sites.entry_id 6HJ4 _atom_sites.fract_transf_matrix[1][1] 0.009376 _atom_sites.fract_transf_matrix[1][2] 0.005413 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010826 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013367 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CD N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 71 ? ? ? A . n A 1 2 THR 2 72 ? ? ? A . n A 1 3 GLY 3 73 ? ? ? A . n A 1 4 ALA 4 74 ? ? ? A . n A 1 5 SER 5 75 75 SER SER A . n A 1 6 TYR 6 76 76 TYR TYR A . n A 1 7 ILE 7 77 77 ILE ILE A . n A 1 8 THR 8 78 78 THR THR A . n A 1 9 PRO 9 79 79 PRO PRO A . n A 1 10 TYR 10 80 80 TYR TYR A . n A 1 11 VAL 11 81 81 VAL VAL A . n A 1 12 PRO 12 82 82 PRO PRO A . n A 1 13 MET 13 83 83 MET MET A . n A 1 14 PRO 14 84 84 PRO PRO A . n A 1 15 CYS 15 85 85 CYS CYS A . n A 1 16 MET 16 86 86 MET MET A . n A 1 17 ILE 17 87 87 ILE ILE A . n A 1 18 ASN 18 88 88 ASN ASN A . n A 1 19 ASP 19 89 89 ASP ASP A . n A 1 20 THR 20 90 90 THR THR A . n A 1 21 HIS 21 91 91 HIS HIS A . n A 1 22 PHE 22 92 92 PHE PHE A . n A 1 23 LEU 23 93 93 LEU LEU A . n A 1 24 LEU 24 94 94 LEU LEU A . n A 1 25 ARG 25 95 95 ARG ARG A . n A 1 26 GLY 26 96 96 GLY GLY A . n A 1 27 PRO 27 97 97 PRO PRO A . n A 1 28 PHE 28 98 98 PHE PHE A . n A 1 29 GLU 29 99 99 GLU GLU A . n A 1 30 ALA 30 100 100 ALA ALA A . n A 1 31 SER 31 101 101 SER SER A . n A 1 32 TRP 32 102 102 TRP TRP A . n A 1 33 ALA 33 103 103 ALA ALA A . n A 1 34 ILE 34 104 104 ILE ILE A . n A 1 35 LYS 35 105 105 LYS LYS A . n A 1 36 LEU 36 106 106 LEU LEU A . n A 1 37 GLU 37 107 107 GLU GLU A . n A 1 38 ILE 38 108 108 ILE ILE A . n A 1 39 THR 39 109 109 THR THR A . n A 1 40 ASP 40 110 110 ASP ASP A . n A 1 41 VAL 41 111 111 VAL VAL A . n A 1 42 THR 42 112 112 THR THR A . n A 1 43 THR 43 113 113 THR THR A . n A 1 44 LEU 44 114 114 LEU LEU A . n A 1 45 VAL 45 115 115 VAL VAL A . n A 1 46 VAL 46 116 116 VAL VAL A . n A 1 47 ASP 47 117 117 ASP ASP A . n A 1 48 THR 48 118 118 THR THR A . n A 1 49 ASP 49 119 119 ASP ASP A . n A 1 50 ASN 50 120 120 ASN ASN A . n A 1 51 VAL 51 121 121 VAL VAL A . n A 1 52 ALA 52 122 122 ALA ALA A . n A 1 53 ASN 53 123 123 ASN ASN A . n A 1 54 PRO 54 124 124 PRO PRO A . n A 1 55 THR 55 125 125 THR THR A . n A 1 56 ASN 56 126 126 ASN ASN A . n A 1 57 ILE 57 127 127 ILE ILE A . n A 1 58 SER 58 128 128 SER SER A . n A 1 59 LYS 59 129 129 LYS LYS A . n A 1 60 CYS 60 130 130 CYS CYS A . n A 1 61 PHE 61 131 131 PHE PHE A . n A 1 62 ALA 62 132 132 ALA ALA A . n A 1 63 ASN 63 133 133 ASN ASN A . n A 1 64 ASN 64 134 134 ASN ASN A . n A 1 65 GLN 65 135 135 GLN GLN A . n A 1 66 ASP 66 136 136 ASP ASP A . n A 1 67 GLU 67 137 137 GLU GLU A . n A 1 68 ARG 68 138 138 ARG ARG A . n A 1 69 LEU 69 139 139 LEU LEU A . n A 1 70 LEU 70 140 140 LEU LEU A . n A 1 71 GLY 71 141 141 GLY GLY A . n A 1 72 PHE 72 142 142 PHE PHE A . n A 1 73 THR 73 143 143 THR THR A . n A 1 74 MET 74 144 144 MET MET A . n A 1 75 GLU 75 145 145 GLU GLU A . n A 1 76 TRP 76 146 146 TRP TRP A . n A 1 77 PHE 77 147 147 PHE PHE A . n A 1 78 LEU 78 148 148 LEU LEU A . n A 1 79 SER 79 149 149 SER SER A . n A 1 80 GLY 80 150 150 GLY GLY A . n A 1 81 LEU 81 151 151 LEU LEU A . n A 1 82 GLU 82 152 152 GLU GLU A . n A 1 83 HIS 83 153 153 HIS HIS A . n A 1 84 ASP 84 154 154 ASP ASP A . n A 1 85 HIS 85 155 155 HIS HIS A . n A 1 86 HIS 86 156 156 HIS HIS A . n A 1 87 PHE 87 157 157 PHE PHE A . n A 1 88 THR 88 158 158 THR THR A . n A 1 89 PRO 89 159 159 PRO PRO A . n A 1 90 GLN 90 160 160 GLN GLN A . n A 1 91 ILE 91 161 161 ILE ILE A . n A 1 92 ILE 92 162 162 ILE ILE A . n A 1 93 CYS 93 163 163 CYS CYS A . n A 1 94 GLY 94 164 164 GLY GLY A . n A 1 95 ASN 95 165 165 ASN ASN A . n A 1 96 VAL 96 166 166 VAL VAL A . n A 1 97 SER 97 167 167 SER SER A . n A 1 98 LYS 98 168 168 LYS LYS A . n A 1 99 GLY 99 169 169 GLY GLY A . n A 1 100 GLU 100 170 170 GLU GLU A . n A 1 101 VAL 101 171 171 VAL VAL A . n A 1 102 ASN 102 172 172 ASN ASN A . n A 1 103 ALA 103 173 173 ALA ALA A . n A 1 104 GLN 104 174 174 GLN GLN A . n A 1 105 VAL 105 175 175 VAL VAL A . n A 1 106 ASN 106 176 176 ASN ASN A . n A 1 107 ILE 107 177 177 ILE ILE A . n A 1 108 THR 108 178 178 THR THR A . n A 1 109 MET 109 179 179 MET MET A . n A 1 110 GLU 110 180 180 GLU GLU A . n A 1 111 ASP 111 181 181 ASP ASP A . n A 1 112 HIS 112 182 182 HIS HIS A . n A 1 113 CYS 113 183 183 CYS CYS A . n A 1 114 SER 114 184 184 SER SER A . n A 1 115 GLN 115 185 185 GLN GLN A . n A 1 116 VAL 116 186 186 VAL VAL A . n A 1 117 PHE 117 187 187 PHE PHE A . n A 1 118 LEU 118 188 188 LEU LEU A . n A 1 119 LYS 119 189 189 LYS LYS A . n A 1 120 MET 120 190 190 MET MET A . n A 1 121 ARG 121 191 191 ARG ARG A . n A 1 122 ARG 122 192 192 ARG ARG A . n A 1 123 ILE 123 193 193 ILE ILE A . n A 1 124 PHE 124 194 194 PHE PHE A . n A 1 125 GLY 125 195 195 GLY GLY A . n A 1 126 VAL 126 196 196 VAL VAL A . n A 1 127 PHE 127 197 197 PHE PHE A . n A 1 128 LYS 128 198 198 LYS LYS A . n A 1 129 ASN 129 199 199 ASN ASN A . n A 1 130 PRO 130 200 200 PRO PRO A . n A 1 131 CYS 131 201 201 CYS CYS A . n A 1 132 THR 132 202 202 THR THR A . n A 1 133 SER 133 203 203 SER SER A . n A 1 134 HIS 134 204 204 HIS HIS A . n A 1 135 GLY 135 205 205 GLY GLY A . n A 1 136 LYS 136 206 206 LYS LYS A . n A 1 137 GLN 137 207 207 GLN GLN A . n A 1 138 ASN 138 208 208 ASN ASN A . n A 1 139 VAL 139 209 209 VAL VAL A . n A 1 140 LEU 140 210 210 LEU LEU A . n A 1 141 ILE 141 211 211 ILE ILE A . n A 1 142 SER 142 212 212 SER SER A . n A 1 143 VAL 143 213 213 VAL VAL A . n A 1 144 SER 144 214 214 SER SER A . n A 1 145 ASN 145 215 215 ASN ASN A . n A 1 146 TRP 146 216 216 TRP TRP A . n A 1 147 THR 147 217 217 THR THR A . n A 1 148 ASN 148 218 218 ASN ASN A . n A 1 149 GLN 149 219 219 GLN GLN A . n A 1 150 CYS 150 220 220 CYS CYS A . n A 1 151 SER 151 221 ? ? ? A . n A 1 152 GLY 152 222 ? ? ? A . n A 1 153 ASN 153 223 ? ? ? A . n A 1 154 HIS 154 224 ? ? ? A . n A 1 155 LEU 155 225 ? ? ? A . n A 1 156 SER 156 226 ? ? ? A . n A 1 157 GLY 157 227 ? ? ? A . n A 1 158 THR 158 228 ? ? ? A . n A 1 159 LYS 159 229 ? ? ? A . n A 1 160 HIS 160 230 ? ? ? A . n A 1 161 HIS 161 231 ? ? ? A . n A 1 162 HIS 162 232 ? ? ? A . n A 1 163 HIS 163 233 ? ? ? A . n A 1 164 HIS 164 234 ? ? ? A . n A 1 165 HIS 165 235 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 301 228 NAG NAG A . C 2 NAG 1 302 229 NAG NAG A . D 2 NAG 1 303 230 NAG NAG A . E 3 CD 1 304 1 CD CD A . F 3 CD 1 305 2 CD CD A . G 3 CD 1 306 3 CD CD A . H 3 CD 1 307 4 CD CD A . I 3 CD 1 308 5 CD CD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1340 ? 1 MORE -11 ? 1 'SSA (A^2)' 8610 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CD _pdbx_struct_special_symmetry.auth_seq_id 308 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id I _pdbx_struct_special_symmetry.label_comp_id CD _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OE1 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id GLU _pdbx_struct_conn_angle.ptnr1_label_seq_id 75 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr1_auth_seq_id 145 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id CD _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id F _pdbx_struct_conn_angle.ptnr2_label_comp_id CD _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id CD _pdbx_struct_conn_angle.ptnr2_auth_seq_id 305 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 12_554 _pdbx_struct_conn_angle.ptnr3_label_atom_id OE1 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id GLU _pdbx_struct_conn_angle.ptnr3_label_seq_id 82 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr3_auth_seq_id 152 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 119.4 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-10-10 2 'Structure model' 1 1 2018-10-24 3 'Structure model' 1 2 2018-12-19 4 'Structure model' 1 3 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp 6 4 'Structure model' entity 7 4 'Structure model' pdbx_chem_comp_identifier 8 4 'Structure model' pdbx_entity_nonpoly 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_site 11 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation.year' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 4 'Structure model' '_chem_comp.name' 16 4 'Structure model' '_chem_comp.type' 17 4 'Structure model' '_entity.pdbx_description' 18 4 'Structure model' '_pdbx_entity_nonpoly.name' 19 4 'Structure model' '_struct_conn.pdbx_role' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 43.7590 _pdbx_refine_tls.origin_y 13.5737 _pdbx_refine_tls.origin_z -5.9118 _pdbx_refine_tls.T[1][1] 0.9622 _pdbx_refine_tls.T[2][2] 0.6879 _pdbx_refine_tls.T[3][3] 0.6242 _pdbx_refine_tls.T[1][2] -0.0970 _pdbx_refine_tls.T[1][3] 0.0068 _pdbx_refine_tls.T[2][3] 0.1820 _pdbx_refine_tls.L[1][1] 3.9321 _pdbx_refine_tls.L[2][2] 6.0651 _pdbx_refine_tls.L[3][3] 4.3646 _pdbx_refine_tls.L[1][2] 0.6607 _pdbx_refine_tls.L[1][3] 0.9488 _pdbx_refine_tls.L[2][3] 0.4033 _pdbx_refine_tls.S[1][1] 0.0860 _pdbx_refine_tls.S[1][2] -0.5296 _pdbx_refine_tls.S[1][3] -0.5508 _pdbx_refine_tls.S[2][1] 0.9015 _pdbx_refine_tls.S[2][2] 0.1788 _pdbx_refine_tls.S[2][3] 0.5511 _pdbx_refine_tls.S[3][1] 1.2506 _pdbx_refine_tls.S[3][2] -0.5157 _pdbx_refine_tls.S[3][3] -0.2097 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13_2998: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 80 ? ? -101.27 57.66 2 1 HIS A 204 ? ? -80.15 -156.27 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 71 ? A GLU 1 2 1 Y 1 A THR 72 ? A THR 2 3 1 Y 1 A GLY 73 ? A GLY 3 4 1 Y 1 A ALA 74 ? A ALA 4 5 1 Y 1 A SER 221 ? A SER 151 6 1 Y 1 A GLY 222 ? A GLY 152 7 1 Y 1 A ASN 223 ? A ASN 153 8 1 Y 1 A HIS 224 ? A HIS 154 9 1 Y 1 A LEU 225 ? A LEU 155 10 1 Y 1 A SER 226 ? A SER 156 11 1 Y 1 A GLY 227 ? A GLY 157 12 1 Y 1 A THR 228 ? A THR 158 13 1 Y 1 A LYS 229 ? A LYS 159 14 1 Y 1 A HIS 230 ? A HIS 160 15 1 Y 1 A HIS 231 ? A HIS 161 16 1 Y 1 A HIS 232 ? A HIS 162 17 1 Y 1 A HIS 233 ? A HIS 163 18 1 Y 1 A HIS 234 ? A HIS 164 19 1 Y 1 A HIS 235 ? A HIS 165 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Medical Research Council (United Kingdom)' 'United Kingdom' MR/L009528/1 1 'Medical Research Council (United Kingdom)' 'United Kingdom' MR/N002091/1 2 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 'CADMIUM ION' CD # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #