data_6HLN # _entry.id 6HLN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6HLN pdb_00006hln 10.2210/pdb6hln/pdb WWPDB D_1200011879 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-24 2 'Structure model' 1 1 2019-08-14 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' 6 3 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' entity_src_gen 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_entity_src_gen.gene_src_common_name' 15 3 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6HLN _pdbx_database_status.recvd_initial_deposition_date 2018-09-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Klima, M.' 1 ? 'Boura, E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first e1007962 _citation.page_last e1007962 _citation.title 'Convergent evolution in the mechanisms of ACBD3 recruitment to picornavirus replication sites.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1007962 _citation.pdbx_database_id_PubMed 31381608 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Horova, V.' 1 ? primary 'Lyoo, H.' 2 0000-0001-5806-9463 primary 'Rozycki, B.' 3 0000-0001-5938-7308 primary 'Chalupska, D.' 4 ? primary 'Smola, M.' 5 ? primary 'Humpolickova, J.' 6 ? primary 'Strating, J.R.P.M.' 7 0000-0003-2509-5213 primary 'van Kuppeveld, F.J.M.' 8 ? primary 'Boura, E.' 9 ? primary 'Klima, M.' 10 0000-0002-9083-509X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Golgi resident protein GCP60' 19261.217 1 ? ? ? ? 2 polymer man 'Genome polyprotein' 7035.023 1 3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48 ? ? ? 3 water nat water 18.015 33 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Acyl-CoA-binding domain-containing protein 3,Golgi complex-associated protein 1,GOCAP1,Golgi phosphoprotein 1,GOLPH1,PBR- and PKA-associated protein 7,Peripheral benzodiazepine receptor-associated protein PAP7 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTA VSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYY RVYYTR ; ;MESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTA VSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYY RVYYTR ; A ? 2 'polypeptide(L)' no no GAMGPPQFKEIKISVAPDTPAPDAINDLLRSVDSQEVRDYCQKKGWIVIHPSNELVVEKHISR GAMGPPQFKEIKISVAPDTPAPDAINDLLRSVDSQEVRDYCQKKGWIVIHPSNELVVEKHISR B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 SER n 1 4 LEU n 1 5 PRO n 1 6 VAL n 1 7 ILE n 1 8 ALA n 1 9 ALA n 1 10 PRO n 1 11 SER n 1 12 MET n 1 13 TRP n 1 14 THR n 1 15 ARG n 1 16 PRO n 1 17 GLN n 1 18 ILE n 1 19 LYS n 1 20 ASP n 1 21 PHE n 1 22 LYS n 1 23 GLU n 1 24 LYS n 1 25 ILE n 1 26 GLN n 1 27 GLN n 1 28 ASP n 1 29 ALA n 1 30 ASP n 1 31 SER n 1 32 VAL n 1 33 ILE n 1 34 THR n 1 35 VAL n 1 36 GLY n 1 37 ARG n 1 38 GLY n 1 39 GLU n 1 40 VAL n 1 41 VAL n 1 42 THR n 1 43 VAL n 1 44 ARG n 1 45 VAL n 1 46 PRO n 1 47 THR n 1 48 HIS n 1 49 GLU n 1 50 GLU n 1 51 GLY n 1 52 SER n 1 53 TYR n 1 54 LEU n 1 55 PHE n 1 56 TRP n 1 57 GLU n 1 58 PHE n 1 59 ALA n 1 60 THR n 1 61 ASP n 1 62 ASN n 1 63 TYR n 1 64 ASP n 1 65 ILE n 1 66 GLY n 1 67 PHE n 1 68 GLY n 1 69 VAL n 1 70 TYR n 1 71 PHE n 1 72 GLU n 1 73 TRP n 1 74 THR n 1 75 ASP n 1 76 SER n 1 77 PRO n 1 78 ASN n 1 79 THR n 1 80 ALA n 1 81 VAL n 1 82 SER n 1 83 VAL n 1 84 HIS n 1 85 VAL n 1 86 SER n 1 87 GLU n 1 88 SER n 1 89 SER n 1 90 ASP n 1 91 ASP n 1 92 ASP n 1 93 GLU n 1 94 GLU n 1 95 GLU n 1 96 GLU n 1 97 GLU n 1 98 ASN n 1 99 ILE n 1 100 GLY n 1 101 CYS n 1 102 GLU n 1 103 GLU n 1 104 LYS n 1 105 ALA n 1 106 LYS n 1 107 LYS n 1 108 ASN n 1 109 ALA n 1 110 ASN n 1 111 LYS n 1 112 PRO n 1 113 LEU n 1 114 LEU n 1 115 ASP n 1 116 GLU n 1 117 ILE n 1 118 VAL n 1 119 PRO n 1 120 VAL n 1 121 TYR n 1 122 ARG n 1 123 ARG n 1 124 ASP n 1 125 CYS n 1 126 HIS n 1 127 GLU n 1 128 GLU n 1 129 VAL n 1 130 TYR n 1 131 ALA n 1 132 GLY n 1 133 SER n 1 134 HIS n 1 135 GLN n 1 136 TYR n 1 137 PRO n 1 138 GLY n 1 139 ARG n 1 140 GLY n 1 141 VAL n 1 142 TYR n 1 143 LEU n 1 144 LEU n 1 145 LYS n 1 146 PHE n 1 147 ASP n 1 148 ASN n 1 149 SER n 1 150 TYR n 1 151 SER n 1 152 LEU n 1 153 TRP n 1 154 ARG n 1 155 SER n 1 156 LYS n 1 157 SER n 1 158 VAL n 1 159 TYR n 1 160 TYR n 1 161 ARG n 1 162 VAL n 1 163 TYR n 1 164 TYR n 1 165 THR n 1 166 ARG n 2 1 GLY n 2 2 ALA n 2 3 MET n 2 4 GLY n 2 5 PRO n 2 6 PRO n 2 7 GLN n 2 8 PHE n 2 9 LYS n 2 10 GLU n 2 11 ILE n 2 12 LYS n 2 13 ILE n 2 14 SER n 2 15 VAL n 2 16 ALA n 2 17 PRO n 2 18 ASP n 2 19 THR n 2 20 PRO n 2 21 ALA n 2 22 PRO n 2 23 ASP n 2 24 ALA n 2 25 ILE n 2 26 ASN n 2 27 ASP n 2 28 LEU n 2 29 LEU n 2 30 ARG n 2 31 SER n 2 32 VAL n 2 33 ASP n 2 34 SER n 2 35 GLN n 2 36 GLU n 2 37 VAL n 2 38 ARG n 2 39 ASP n 2 40 TYR n 2 41 CYS n 2 42 GLN n 2 43 LYS n 2 44 LYS n 2 45 GLY n 2 46 TRP n 2 47 ILE n 2 48 VAL n 2 49 ILE n 2 50 HIS n 2 51 PRO n 2 52 SER n 2 53 ASN n 2 54 GLU n 2 55 LEU n 2 56 VAL n 2 57 VAL n 2 58 GLU n 2 59 LYS n 2 60 HIS n 2 61 ILE n 2 62 SER n 2 63 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 166 human ? 'ACBD3, GCP60, GOCAP1, GOLPH1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 63 ? ? ? ? ? ? ? ? ? 'enterovirus D68' 42789 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 363 363 MET MET A . n A 1 2 GLU 2 364 364 GLU GLU A . n A 1 3 SER 3 365 365 SER SER A . n A 1 4 LEU 4 366 366 LEU LEU A . n A 1 5 PRO 5 367 367 PRO PRO A . n A 1 6 VAL 6 368 368 VAL VAL A . n A 1 7 ILE 7 369 369 ILE ILE A . n A 1 8 ALA 8 370 370 ALA ALA A . n A 1 9 ALA 9 371 371 ALA ALA A . n A 1 10 PRO 10 372 372 PRO PRO A . n A 1 11 SER 11 373 373 SER SER A . n A 1 12 MET 12 374 374 MET MET A . n A 1 13 TRP 13 375 375 TRP TRP A . n A 1 14 THR 14 376 376 THR THR A . n A 1 15 ARG 15 377 377 ARG ARG A . n A 1 16 PRO 16 378 378 PRO PRO A . n A 1 17 GLN 17 379 379 GLN GLN A . n A 1 18 ILE 18 380 380 ILE ILE A . n A 1 19 LYS 19 381 381 LYS LYS A . n A 1 20 ASP 20 382 382 ASP ASP A . n A 1 21 PHE 21 383 383 PHE PHE A . n A 1 22 LYS 22 384 384 LYS LYS A . n A 1 23 GLU 23 385 385 GLU GLU A . n A 1 24 LYS 24 386 386 LYS LYS A . n A 1 25 ILE 25 387 387 ILE ILE A . n A 1 26 GLN 26 388 388 GLN GLN A . n A 1 27 GLN 27 389 389 GLN GLN A . n A 1 28 ASP 28 390 390 ASP ASP A . n A 1 29 ALA 29 391 391 ALA ALA A . n A 1 30 ASP 30 392 392 ASP ASP A . n A 1 31 SER 31 393 393 SER SER A . n A 1 32 VAL 32 394 394 VAL VAL A . n A 1 33 ILE 33 395 395 ILE ILE A . n A 1 34 THR 34 396 396 THR THR A . n A 1 35 VAL 35 397 397 VAL VAL A . n A 1 36 GLY 36 398 398 GLY GLY A . n A 1 37 ARG 37 399 399 ARG ARG A . n A 1 38 GLY 38 400 400 GLY GLY A . n A 1 39 GLU 39 401 401 GLU GLU A . n A 1 40 VAL 40 402 402 VAL VAL A . n A 1 41 VAL 41 403 403 VAL VAL A . n A 1 42 THR 42 404 404 THR THR A . n A 1 43 VAL 43 405 405 VAL VAL A . n A 1 44 ARG 44 406 406 ARG ARG A . n A 1 45 VAL 45 407 407 VAL VAL A . n A 1 46 PRO 46 408 408 PRO PRO A . n A 1 47 THR 47 409 409 THR THR A . n A 1 48 HIS 48 410 410 HIS HIS A . n A 1 49 GLU 49 411 411 GLU GLU A . n A 1 50 GLU 50 412 412 GLU GLU A . n A 1 51 GLY 51 413 413 GLY GLY A . n A 1 52 SER 52 414 414 SER SER A . n A 1 53 TYR 53 415 415 TYR TYR A . n A 1 54 LEU 54 416 416 LEU LEU A . n A 1 55 PHE 55 417 417 PHE PHE A . n A 1 56 TRP 56 418 418 TRP TRP A . n A 1 57 GLU 57 419 419 GLU GLU A . n A 1 58 PHE 58 420 420 PHE PHE A . n A 1 59 ALA 59 421 421 ALA ALA A . n A 1 60 THR 60 422 422 THR THR A . n A 1 61 ASP 61 423 423 ASP ASP A . n A 1 62 ASN 62 424 424 ASN ASN A . n A 1 63 TYR 63 425 425 TYR TYR A . n A 1 64 ASP 64 426 426 ASP ASP A . n A 1 65 ILE 65 427 427 ILE ILE A . n A 1 66 GLY 66 428 428 GLY GLY A . n A 1 67 PHE 67 429 429 PHE PHE A . n A 1 68 GLY 68 430 430 GLY GLY A . n A 1 69 VAL 69 431 431 VAL VAL A . n A 1 70 TYR 70 432 432 TYR TYR A . n A 1 71 PHE 71 433 433 PHE PHE A . n A 1 72 GLU 72 434 434 GLU GLU A . n A 1 73 TRP 73 435 435 TRP TRP A . n A 1 74 THR 74 436 436 THR THR A . n A 1 75 ASP 75 437 ? ? ? A . n A 1 76 SER 76 438 ? ? ? A . n A 1 77 PRO 77 439 ? ? ? A . n A 1 78 ASN 78 440 ? ? ? A . n A 1 79 THR 79 441 ? ? ? A . n A 1 80 ALA 80 442 ? ? ? A . n A 1 81 VAL 81 443 ? ? ? A . n A 1 82 SER 82 444 ? ? ? A . n A 1 83 VAL 83 445 ? ? ? A . n A 1 84 HIS 84 446 ? ? ? A . n A 1 85 VAL 85 447 ? ? ? A . n A 1 86 SER 86 448 ? ? ? A . n A 1 87 GLU 87 449 ? ? ? A . n A 1 88 SER 88 450 ? ? ? A . n A 1 89 SER 89 451 ? ? ? A . n A 1 90 ASP 90 452 ? ? ? A . n A 1 91 ASP 91 453 ? ? ? A . n A 1 92 ASP 92 454 ? ? ? A . n A 1 93 GLU 93 455 ? ? ? A . n A 1 94 GLU 94 456 ? ? ? A . n A 1 95 GLU 95 457 ? ? ? A . n A 1 96 GLU 96 458 ? ? ? A . n A 1 97 GLU 97 459 ? ? ? A . n A 1 98 ASN 98 460 ? ? ? A . n A 1 99 ILE 99 461 ? ? ? A . n A 1 100 GLY 100 462 ? ? ? A . n A 1 101 CYS 101 463 ? ? ? A . n A 1 102 GLU 102 464 ? ? ? A . n A 1 103 GLU 103 465 ? ? ? A . n A 1 104 LYS 104 466 ? ? ? A . n A 1 105 ALA 105 467 ? ? ? A . n A 1 106 LYS 106 468 ? ? ? A . n A 1 107 LYS 107 469 ? ? ? A . n A 1 108 ASN 108 470 ? ? ? A . n A 1 109 ALA 109 471 ? ? ? A . n A 1 110 ASN 110 472 ? ? ? A . n A 1 111 LYS 111 473 473 LYS LYS A . n A 1 112 PRO 112 474 474 PRO PRO A . n A 1 113 LEU 113 475 475 LEU LEU A . n A 1 114 LEU 114 476 476 LEU LEU A . n A 1 115 ASP 115 477 477 ASP ASP A . n A 1 116 GLU 116 478 478 GLU GLU A . n A 1 117 ILE 117 479 479 ILE ILE A . n A 1 118 VAL 118 480 480 VAL VAL A . n A 1 119 PRO 119 481 481 PRO PRO A . n A 1 120 VAL 120 482 482 VAL VAL A . n A 1 121 TYR 121 483 483 TYR TYR A . n A 1 122 ARG 122 484 484 ARG ARG A . n A 1 123 ARG 123 485 485 ARG ARG A . n A 1 124 ASP 124 486 486 ASP ASP A . n A 1 125 CYS 125 487 487 CYS CYS A . n A 1 126 HIS 126 488 488 HIS HIS A . n A 1 127 GLU 127 489 489 GLU GLU A . n A 1 128 GLU 128 490 490 GLU GLU A . n A 1 129 VAL 129 491 491 VAL VAL A . n A 1 130 TYR 130 492 492 TYR TYR A . n A 1 131 ALA 131 493 493 ALA ALA A . n A 1 132 GLY 132 494 494 GLY GLY A . n A 1 133 SER 133 495 495 SER SER A . n A 1 134 HIS 134 496 496 HIS HIS A . n A 1 135 GLN 135 497 497 GLN GLN A . n A 1 136 TYR 136 498 498 TYR TYR A . n A 1 137 PRO 137 499 499 PRO PRO A . n A 1 138 GLY 138 500 500 GLY GLY A . n A 1 139 ARG 139 501 501 ARG ARG A . n A 1 140 GLY 140 502 502 GLY GLY A . n A 1 141 VAL 141 503 503 VAL VAL A . n A 1 142 TYR 142 504 504 TYR TYR A . n A 1 143 LEU 143 505 505 LEU LEU A . n A 1 144 LEU 144 506 506 LEU LEU A . n A 1 145 LYS 145 507 507 LYS LYS A . n A 1 146 PHE 146 508 508 PHE PHE A . n A 1 147 ASP 147 509 509 ASP ASP A . n A 1 148 ASN 148 510 510 ASN ASN A . n A 1 149 SER 149 511 511 SER SER A . n A 1 150 TYR 150 512 512 TYR TYR A . n A 1 151 SER 151 513 513 SER SER A . n A 1 152 LEU 152 514 514 LEU LEU A . n A 1 153 TRP 153 515 515 TRP TRP A . n A 1 154 ARG 154 516 516 ARG ARG A . n A 1 155 SER 155 517 517 SER SER A . n A 1 156 LYS 156 518 518 LYS LYS A . n A 1 157 SER 157 519 519 SER SER A . n A 1 158 VAL 158 520 520 VAL VAL A . n A 1 159 TYR 159 521 521 TYR TYR A . n A 1 160 TYR 160 522 522 TYR TYR A . n A 1 161 ARG 161 523 523 ARG ARG A . n A 1 162 VAL 162 524 524 VAL VAL A . n A 1 163 TYR 163 525 525 TYR TYR A . n A 1 164 TYR 164 526 526 TYR TYR A . n A 1 165 THR 165 527 527 THR THR A . n A 1 166 ARG 166 528 528 ARG ARG A . n B 2 1 GLY 1 -2 ? ? ? B . n B 2 2 ALA 2 -1 ? ? ? B . n B 2 3 MET 3 0 ? ? ? B . n B 2 4 GLY 4 1 ? ? ? B . n B 2 5 PRO 5 2 ? ? ? B . n B 2 6 PRO 6 3 ? ? ? B . n B 2 7 GLN 7 4 ? ? ? B . n B 2 8 PHE 8 5 ? ? ? B . n B 2 9 LYS 9 6 ? ? ? B . n B 2 10 GLU 10 7 ? ? ? B . n B 2 11 ILE 11 8 ? ? ? B . n B 2 12 LYS 12 9 ? ? ? B . n B 2 13 ILE 13 10 ? ? ? B . n B 2 14 SER 14 11 ? ? ? B . n B 2 15 VAL 15 12 ? ? ? B . n B 2 16 ALA 16 13 ? ? ? B . n B 2 17 PRO 17 14 ? ? ? B . n B 2 18 ASP 18 15 ? ? ? B . n B 2 19 THR 19 16 16 THR THR B . n B 2 20 PRO 20 17 17 PRO PRO B . n B 2 21 ALA 21 18 18 ALA ALA B . n B 2 22 PRO 22 19 19 PRO PRO B . n B 2 23 ASP 23 20 20 ASP ASP B . n B 2 24 ALA 24 21 21 ALA ALA B . n B 2 25 ILE 25 22 22 ILE ILE B . n B 2 26 ASN 26 23 23 ASN ASN B . n B 2 27 ASP 27 24 24 ASP ASP B . n B 2 28 LEU 28 25 25 LEU LEU B . n B 2 29 LEU 29 26 26 LEU LEU B . n B 2 30 ARG 30 27 27 ARG ARG B . n B 2 31 SER 31 28 28 SER SER B . n B 2 32 VAL 32 29 29 VAL VAL B . n B 2 33 ASP 33 30 30 ASP ASP B . n B 2 34 SER 34 31 31 SER SER B . n B 2 35 GLN 35 32 32 GLN GLN B . n B 2 36 GLU 36 33 33 GLU GLU B . n B 2 37 VAL 37 34 34 VAL VAL B . n B 2 38 ARG 38 35 35 ARG ARG B . n B 2 39 ASP 39 36 36 ASP ASP B . n B 2 40 TYR 40 37 37 TYR TYR B . n B 2 41 CYS 41 38 38 CYS CYS B . n B 2 42 GLN 42 39 39 GLN GLN B . n B 2 43 LYS 43 40 40 LYS LYS B . n B 2 44 LYS 44 41 41 LYS LYS B . n B 2 45 GLY 45 42 42 GLY GLY B . n B 2 46 TRP 46 43 43 TRP TRP B . n B 2 47 ILE 47 44 44 ILE ILE B . n B 2 48 VAL 48 45 45 VAL VAL B . n B 2 49 ILE 49 46 46 ILE ILE B . n B 2 50 HIS 50 47 47 HIS HIS B . n B 2 51 PRO 51 48 48 PRO PRO B . n B 2 52 SER 52 49 49 SER SER B . n B 2 53 ASN 53 50 50 ASN ASN B . n B 2 54 GLU 54 51 51 GLU GLU B . n B 2 55 LEU 55 52 52 LEU LEU B . n B 2 56 VAL 56 53 53 VAL VAL B . n B 2 57 VAL 57 54 54 VAL VAL B . n B 2 58 GLU 58 55 55 GLU GLU B . n B 2 59 LYS 59 56 56 LYS LYS B . n B 2 60 HIS 60 57 57 HIS HIS B . n B 2 61 ILE 61 58 58 ILE ILE B . n B 2 62 SER 62 59 ? ? ? B . n B 2 63 ARG 63 60 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 601 6 HOH HOH A . C 3 HOH 2 602 3 HOH HOH A . C 3 HOH 3 603 1 HOH HOH A . C 3 HOH 4 604 28 HOH HOH A . C 3 HOH 5 605 15 HOH HOH A . C 3 HOH 6 606 10 HOH HOH A . C 3 HOH 7 607 11 HOH HOH A . C 3 HOH 8 608 9 HOH HOH A . C 3 HOH 9 609 14 HOH HOH A . C 3 HOH 10 610 25 HOH HOH A . C 3 HOH 11 611 18 HOH HOH A . C 3 HOH 12 612 33 HOH HOH A . C 3 HOH 13 613 5 HOH HOH A . C 3 HOH 14 614 27 HOH HOH A . C 3 HOH 15 615 29 HOH HOH A . C 3 HOH 16 616 16 HOH HOH A . C 3 HOH 17 617 17 HOH HOH A . C 3 HOH 18 618 22 HOH HOH A . C 3 HOH 19 619 23 HOH HOH A . C 3 HOH 20 620 20 HOH HOH A . C 3 HOH 21 621 26 HOH HOH A . C 3 HOH 22 622 24 HOH HOH A . C 3 HOH 23 623 19 HOH HOH A . C 3 HOH 24 624 30 HOH HOH A . C 3 HOH 25 625 4 HOH HOH A . C 3 HOH 26 626 31 HOH HOH A . D 3 HOH 1 101 32 HOH HOH B . D 3 HOH 2 102 13 HOH HOH B . D 3 HOH 3 103 21 HOH HOH B . D 3 HOH 4 104 12 HOH HOH B . D 3 HOH 5 105 8 HOH HOH B . D 3 HOH 6 106 7 HOH HOH B . D 3 HOH 7 107 2 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 381 ? CG ? A LYS 19 CG 2 1 Y 1 A LYS 381 ? CD ? A LYS 19 CD 3 1 Y 1 A LYS 381 ? CE ? A LYS 19 CE 4 1 Y 1 A LYS 381 ? NZ ? A LYS 19 NZ 5 1 Y 1 A LYS 473 ? CG ? A LYS 111 CG 6 1 Y 1 A LYS 473 ? CD ? A LYS 111 CD 7 1 Y 1 A LYS 473 ? CE ? A LYS 111 CE 8 1 Y 1 A LYS 473 ? NZ ? A LYS 111 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 11-Sep-2018 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 11-Sep-2018 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 112.05 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6HLN _cell.details ? _cell.formula_units_Z ? _cell.length_a 96.879 _cell.length_a_esd ? _cell.length_b 55.889 _cell.length_b_esd ? _cell.length_c 64.493 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6HLN _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6HLN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;10% w/v PEG 8000, 6% v/v 1,5-pentanediol, 14% v/v PEG 200, 10 mM spermine, 10 mM spermidine, 10 mM DL-ornithine, 10 mM 1,4-diaminobutane, 300 mM NaCl, 100 mM GlyGly/AMPD pH 8.5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 47.36 _reflns.entry_id 6HLN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 47.45 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18521 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.34 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.78 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.175 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.21 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1848 _reflns_shell.percent_possible_all 99.09 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.556 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 47.70 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6HLN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.100 _refine.ls_d_res_low 47.45 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18496 _refine.ls_number_reflns_R_free 926 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.21 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2222 _refine.ls_R_factor_R_free 0.2508 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2206 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5LZ1 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.66 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.34 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1425 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 1458 _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 47.45 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1466 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.065 ? 1996 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.159 ? 530 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 211 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 255 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1000 2.2107 . . 132 2518 99.00 . . . 0.3682 . 0.3533 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2107 2.3492 . . 132 2487 98.00 . . . 0.3251 . 0.3207 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3492 2.5306 . . 130 2478 98.00 . . . 0.3183 . 0.2967 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5306 2.7852 . . 132 2497 98.00 . . . 0.3329 . 0.2718 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7852 3.1882 . . 132 2515 99.00 . . . 0.2834 . 0.2584 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1882 4.0165 . . 133 2519 98.00 . . . 0.2397 . 0.2034 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0165 47.4607 . . 135 2556 98.00 . . . 0.1964 . 0.1688 . . . . . . . . . . # _struct.entry_id 6HLN _struct.title 'Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of enterovirus-D68' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6HLN _struct_keywords.text 'complex, Golgi, enterovirus, picornavirus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GCP60_HUMAN Q9H3P7 ? 1 ;ESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAV SVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYR VYYTR ; 364 2 UNP Q68T42_9ENTO Q68T42 ? 2 GPPQFKEIKISVAPDTPAPDAINDLLRSVDSQEVRDYCQKKGWIVIHPSNELVVEKHISR 1438 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6HLN A 2 ? 166 ? Q9H3P7 364 ? 528 ? 364 528 2 2 6HLN B 4 ? 63 ? Q68T42 1438 ? 1497 ? 1 60 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6HLN MET A 1 ? UNP Q9H3P7 ? ? 'initiating methionine' 363 1 2 6HLN GLY B 1 ? UNP Q68T42 ? ? 'expression tag' -2 2 2 6HLN ALA B 2 ? UNP Q68T42 ? ? 'expression tag' -1 3 2 6HLN MET B 3 ? UNP Q68T42 ? ? 'expression tag' 0 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2750 ? 1 MORE -12 ? 1 'SSA (A^2)' 9250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 17 ? GLN A 27 ? GLN A 379 GLN A 389 1 ? 11 HELX_P HELX_P2 AA2 ASP A 28 ? ASP A 30 ? ASP A 390 ASP A 392 5 ? 3 HELX_P HELX_P3 AA3 ALA B 21 ? ASP B 33 ? ALA B 18 ASP B 30 1 ? 13 HELX_P HELX_P4 AA4 SER B 34 ? LYS B 44 ? SER B 31 LYS B 41 1 ? 11 HELX_P HELX_P5 AA5 PRO B 51 ? LEU B 55 ? PRO B 48 LEU B 52 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 11 ? ARG A 15 ? SER A 373 ARG A 377 AA1 2 VAL A 129 ? GLN A 135 ? VAL A 491 GLN A 497 AA1 3 TYR A 53 ? THR A 60 ? TYR A 415 THR A 422 AA1 4 LYS A 156 ? TYR A 164 ? LYS A 518 TYR A 526 AA1 5 VAL A 32 ? VAL A 35 ? VAL A 394 VAL A 397 AA2 1 SER A 11 ? ARG A 15 ? SER A 373 ARG A 377 AA2 2 VAL A 129 ? GLN A 135 ? VAL A 491 GLN A 497 AA2 3 TYR A 53 ? THR A 60 ? TYR A 415 THR A 422 AA2 4 LYS A 156 ? TYR A 164 ? LYS A 518 TYR A 526 AA2 5 VAL B 48 ? ILE B 49 ? VAL B 45 ILE B 46 AA3 1 LEU A 114 ? ARG A 123 ? LEU A 476 ARG A 485 AA3 2 ILE A 65 ? TRP A 73 ? ILE A 427 TRP A 435 AA3 3 GLY A 140 ? ASP A 147 ? GLY A 502 ASP A 509 AA3 4 VAL A 40 ? PRO A 46 ? VAL A 402 PRO A 408 AA3 5 VAL B 56 ? HIS B 60 ? VAL B 53 HIS B 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 13 ? N TRP A 375 O ALA A 131 ? O ALA A 493 AA1 2 3 O TYR A 130 ? O TYR A 492 N PHE A 58 ? N PHE A 420 AA1 3 4 N ALA A 59 ? N ALA A 421 O TYR A 159 ? O TYR A 521 AA1 4 5 O VAL A 158 ? O VAL A 520 N ILE A 33 ? N ILE A 395 AA2 1 2 N TRP A 13 ? N TRP A 375 O ALA A 131 ? O ALA A 493 AA2 2 3 O TYR A 130 ? O TYR A 492 N PHE A 58 ? N PHE A 420 AA2 3 4 N ALA A 59 ? N ALA A 421 O TYR A 159 ? O TYR A 521 AA2 4 5 N TYR A 164 ? N TYR A 526 O VAL B 48 ? O VAL B 45 AA3 1 2 O VAL A 118 ? O VAL A 480 N VAL A 69 ? N VAL A 431 AA3 2 3 N GLU A 72 ? N GLU A 434 O VAL A 141 ? O VAL A 503 AA3 3 4 O PHE A 146 ? O PHE A 508 N VAL A 41 ? N VAL A 403 AA3 4 5 N THR A 42 ? N THR A 404 O GLU B 58 ? O GLU B 55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 437 ? A ASP 75 2 1 Y 1 A SER 438 ? A SER 76 3 1 Y 1 A PRO 439 ? A PRO 77 4 1 Y 1 A ASN 440 ? A ASN 78 5 1 Y 1 A THR 441 ? A THR 79 6 1 Y 1 A ALA 442 ? A ALA 80 7 1 Y 1 A VAL 443 ? A VAL 81 8 1 Y 1 A SER 444 ? A SER 82 9 1 Y 1 A VAL 445 ? A VAL 83 10 1 Y 1 A HIS 446 ? A HIS 84 11 1 Y 1 A VAL 447 ? A VAL 85 12 1 Y 1 A SER 448 ? A SER 86 13 1 Y 1 A GLU 449 ? A GLU 87 14 1 Y 1 A SER 450 ? A SER 88 15 1 Y 1 A SER 451 ? A SER 89 16 1 Y 1 A ASP 452 ? A ASP 90 17 1 Y 1 A ASP 453 ? A ASP 91 18 1 Y 1 A ASP 454 ? A ASP 92 19 1 Y 1 A GLU 455 ? A GLU 93 20 1 Y 1 A GLU 456 ? A GLU 94 21 1 Y 1 A GLU 457 ? A GLU 95 22 1 Y 1 A GLU 458 ? A GLU 96 23 1 Y 1 A GLU 459 ? A GLU 97 24 1 Y 1 A ASN 460 ? A ASN 98 25 1 Y 1 A ILE 461 ? A ILE 99 26 1 Y 1 A GLY 462 ? A GLY 100 27 1 Y 1 A CYS 463 ? A CYS 101 28 1 Y 1 A GLU 464 ? A GLU 102 29 1 Y 1 A GLU 465 ? A GLU 103 30 1 Y 1 A LYS 466 ? A LYS 104 31 1 Y 1 A ALA 467 ? A ALA 105 32 1 Y 1 A LYS 468 ? A LYS 106 33 1 Y 1 A LYS 469 ? A LYS 107 34 1 Y 1 A ASN 470 ? A ASN 108 35 1 Y 1 A ALA 471 ? A ALA 109 36 1 Y 1 A ASN 472 ? A ASN 110 37 1 Y 1 B GLY -2 ? B GLY 1 38 1 Y 1 B ALA -1 ? B ALA 2 39 1 Y 1 B MET 0 ? B MET 3 40 1 Y 1 B GLY 1 ? B GLY 4 41 1 Y 1 B PRO 2 ? B PRO 5 42 1 Y 1 B PRO 3 ? B PRO 6 43 1 Y 1 B GLN 4 ? B GLN 7 44 1 Y 1 B PHE 5 ? B PHE 8 45 1 Y 1 B LYS 6 ? B LYS 9 46 1 Y 1 B GLU 7 ? B GLU 10 47 1 Y 1 B ILE 8 ? B ILE 11 48 1 Y 1 B LYS 9 ? B LYS 12 49 1 Y 1 B ILE 10 ? B ILE 13 50 1 Y 1 B SER 11 ? B SER 14 51 1 Y 1 B VAL 12 ? B VAL 15 52 1 Y 1 B ALA 13 ? B ALA 16 53 1 Y 1 B PRO 14 ? B PRO 17 54 1 Y 1 B ASP 15 ? B ASP 18 55 1 Y 1 B SER 59 ? B SER 62 56 1 Y 1 B ARG 60 ? B ARG 63 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Czech Science Foundation' _pdbx_audit_support.country 'Czech Republic' _pdbx_audit_support.grant_number 17-07058Y _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5LZ1 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6HLN _atom_sites.fract_transf_matrix[1][1] 0.010322 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004181 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017893 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016729 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_