data_6IE9 # _entry.id 6IE9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6IE9 pdb_00006ie9 10.2210/pdb6ie9/pdb WWPDB D_1300009060 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 6IE8 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6IE9 _pdbx_database_status.recvd_initial_deposition_date 2018-09-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nakashima, R.' 1 ? 'Sakurai, K.' 2 ? 'Yamasaki, S.' 3 ? 'Nishino, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 177 _citation.page_last 177 _citation.title 'Crystal structure of the multidrug resistance regulator RamR complexed with bile acids.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-018-36025-8 _citation.pdbx_database_id_PubMed 30655545 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yamasaki, S.' 1 0000-0003-3370-5851 primary 'Nakashima, R.' 2 ? primary 'Sakurai, K.' 3 0000-0002-6948-1899 primary 'Baucheron, S.' 4 ? primary 'Giraud, E.' 5 0000-0002-2534-4040 primary 'Doublet, B.' 6 0000-0003-0531-0967 primary 'Cloeckaert, A.' 7 ? primary 'Nishino, K.' 8 0000-0003-3349-1769 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 93.290 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6IE9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.436 _cell.length_a_esd ? _cell.length_b 53.576 _cell.length_b_esd ? _cell.length_c 43.837 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6IE9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Regulatory protein' 22044.262 1 ? ? ? ? 2 non-polymer syn 'CHENODEOXYCHOLIC ACID' 392.572 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 35 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVARPKSEDKKQALLEAATQAIAQSGIAASTAVIARNAGVAEGTLFRYFATKDELINTLYLHLKQDLCQSMIMELDRSIT DAKMMTRFIWNSYISWGLNHPARHRAIRQLAVSEKLTKETEQRADDMFPELRDLCHRSVLMVFMSDEYRAFGDGLFLALA ETTMDFAARDPARAGEYIALGFEAMWRALTREEQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MVARPKSEDKKQALLEAATQAIAQSGIAASTAVIARNAGVAEGTLFRYFATKDELINTLYLHLKQDLCQSMIMELDRSIT DAKMMTRFIWNSYISWGLNHPARHRAIRQLAVSEKLTKETEQRADDMFPELRDLCHRSVLMVFMSDEYRAFGDGLFLALA ETTMDFAARDPARAGEYIALGFEAMWRALTREEQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ALA n 1 4 ARG n 1 5 PRO n 1 6 LYS n 1 7 SER n 1 8 GLU n 1 9 ASP n 1 10 LYS n 1 11 LYS n 1 12 GLN n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 GLU n 1 17 ALA n 1 18 ALA n 1 19 THR n 1 20 GLN n 1 21 ALA n 1 22 ILE n 1 23 ALA n 1 24 GLN n 1 25 SER n 1 26 GLY n 1 27 ILE n 1 28 ALA n 1 29 ALA n 1 30 SER n 1 31 THR n 1 32 ALA n 1 33 VAL n 1 34 ILE n 1 35 ALA n 1 36 ARG n 1 37 ASN n 1 38 ALA n 1 39 GLY n 1 40 VAL n 1 41 ALA n 1 42 GLU n 1 43 GLY n 1 44 THR n 1 45 LEU n 1 46 PHE n 1 47 ARG n 1 48 TYR n 1 49 PHE n 1 50 ALA n 1 51 THR n 1 52 LYS n 1 53 ASP n 1 54 GLU n 1 55 LEU n 1 56 ILE n 1 57 ASN n 1 58 THR n 1 59 LEU n 1 60 TYR n 1 61 LEU n 1 62 HIS n 1 63 LEU n 1 64 LYS n 1 65 GLN n 1 66 ASP n 1 67 LEU n 1 68 CYS n 1 69 GLN n 1 70 SER n 1 71 MET n 1 72 ILE n 1 73 MET n 1 74 GLU n 1 75 LEU n 1 76 ASP n 1 77 ARG n 1 78 SER n 1 79 ILE n 1 80 THR n 1 81 ASP n 1 82 ALA n 1 83 LYS n 1 84 MET n 1 85 MET n 1 86 THR n 1 87 ARG n 1 88 PHE n 1 89 ILE n 1 90 TRP n 1 91 ASN n 1 92 SER n 1 93 TYR n 1 94 ILE n 1 95 SER n 1 96 TRP n 1 97 GLY n 1 98 LEU n 1 99 ASN n 1 100 HIS n 1 101 PRO n 1 102 ALA n 1 103 ARG n 1 104 HIS n 1 105 ARG n 1 106 ALA n 1 107 ILE n 1 108 ARG n 1 109 GLN n 1 110 LEU n 1 111 ALA n 1 112 VAL n 1 113 SER n 1 114 GLU n 1 115 LYS n 1 116 LEU n 1 117 THR n 1 118 LYS n 1 119 GLU n 1 120 THR n 1 121 GLU n 1 122 GLN n 1 123 ARG n 1 124 ALA n 1 125 ASP n 1 126 ASP n 1 127 MET n 1 128 PHE n 1 129 PRO n 1 130 GLU n 1 131 LEU n 1 132 ARG n 1 133 ASP n 1 134 LEU n 1 135 CYS n 1 136 HIS n 1 137 ARG n 1 138 SER n 1 139 VAL n 1 140 LEU n 1 141 MET n 1 142 VAL n 1 143 PHE n 1 144 MET n 1 145 SER n 1 146 ASP n 1 147 GLU n 1 148 TYR n 1 149 ARG n 1 150 ALA n 1 151 PHE n 1 152 GLY n 1 153 ASP n 1 154 GLY n 1 155 LEU n 1 156 PHE n 1 157 LEU n 1 158 ALA n 1 159 LEU n 1 160 ALA n 1 161 GLU n 1 162 THR n 1 163 THR n 1 164 MET n 1 165 ASP n 1 166 PHE n 1 167 ALA n 1 168 ALA n 1 169 ARG n 1 170 ASP n 1 171 PRO n 1 172 ALA n 1 173 ARG n 1 174 ALA n 1 175 GLY n 1 176 GLU n 1 177 TYR n 1 178 ILE n 1 179 ALA n 1 180 LEU n 1 181 GLY n 1 182 PHE n 1 183 GLU n 1 184 ALA n 1 185 MET n 1 186 TRP n 1 187 ARG n 1 188 ALA n 1 189 LEU n 1 190 THR n 1 191 ARG n 1 192 GLU n 1 193 GLU n 1 194 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 194 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene STM14_0676 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain '14028s / SGSC 2262' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella typhimurium (strain 14028s / SGSC 2262)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 588858 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0F6AY66_SALT1 _struct_ref.pdbx_db_accession A0A0F6AY66 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MARPKSEDKKQALLEAATQAIAQSGIAASTAVIARNAGVAEGTLFRYFATKDELINTLYLHLKQDLCQSMIMELDRSITD AKMMTRFIWNSYISWGLNHPARHRAIRQLAVSEKLTKETEQRADDMFPELRDLCHRSVLMVFMSDEYRAFGDGLFLALAE TTMDFAARDPARAGEYIALGFEAMWRALTREEQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6IE9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 194 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0F6AY66 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 193 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 193 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6IE9 _struct_ref_seq_dif.mon_id VAL _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 2 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A0F6AY66 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details insertion _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JN3 non-polymer . 'CHENODEOXYCHOLIC ACID' '(3ALPHA,5ALPHA,7BETA,8ALPHA,17ALPHA)-3,7-DIHYDROXYCHOLAN-24-OIC ACID' 'C24 H40 O4' 392.572 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IE9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M MES pH6.5, 0.2M Ammonium Sulfate, 20% PEG6000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-02-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.900 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.900 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6IE9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.780 _reflns.d_resolution_low 100.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18975 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.700 _reflns.pdbx_Rmerge_I_obs 0.040 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 51.869 _reflns.pdbx_netI_over_sigmaI 15.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.155 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 145509 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.780 1.810 ? ? ? ? ? ? 929 97.400 ? ? ? ? 0.392 ? ? ? ? ? ? ? ? 7.800 ? 0.983 ? ? ? ? ? 1 1 ? ? 1.810 1.840 ? ? ? ? ? ? ? 97.900 ? ? ? ? 0.341 ? ? ? ? ? ? ? ? 7.800 ? 0.968 ? ? ? ? ? 2 1 ? ? 1.840 1.880 ? ? ? ? ? ? ? 97.500 ? ? ? ? 0.279 ? ? ? ? ? ? ? ? 7.800 ? 0.972 ? ? ? ? ? 3 1 ? ? 1.880 1.920 ? ? ? ? ? ? ? 98.300 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 7.800 ? 0.998 ? ? ? ? ? 4 1 ? ? 1.920 1.960 ? ? ? ? ? ? ? 97.900 ? ? ? ? 0.199 ? ? ? ? ? ? ? ? 7.800 ? 0.988 ? ? ? ? ? 5 1 ? ? 1.960 2.000 ? ? ? ? ? ? ? 98.100 ? ? ? ? 0.161 ? ? ? ? ? ? ? ? 7.800 ? 0.983 ? ? ? ? ? 6 1 ? ? 2.000 2.050 ? ? ? ? ? ? ? 97.900 ? ? ? ? 0.123 ? ? ? ? ? ? ? ? 7.800 ? 0.964 ? ? ? ? ? 7 1 ? ? 2.050 2.110 ? ? ? ? ? ? ? 98.400 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 7.800 ? 0.974 ? ? ? ? ? 8 1 ? ? 2.110 2.170 ? ? ? ? ? ? ? 98.500 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 7.800 ? 0.963 ? ? ? ? ? 9 1 ? ? 2.170 2.240 ? ? ? ? ? ? ? 98.300 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 7.800 ? 0.991 ? ? ? ? ? 10 1 ? ? 2.240 2.320 ? ? ? ? ? ? ? 99.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 7.700 ? 0.999 ? ? ? ? ? 11 1 ? ? 2.320 2.420 ? ? ? ? ? ? ? 98.600 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 7.800 ? 1.011 ? ? ? ? ? 12 1 ? ? 2.420 2.530 ? ? ? ? ? ? ? 98.900 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 7.700 ? 1.161 ? ? ? ? ? 13 1 ? ? 2.530 2.660 ? ? ? ? ? ? ? 99.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 7.700 ? 1.418 ? ? ? ? ? 14 1 ? ? 2.660 2.830 ? ? ? ? ? ? ? 99.200 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 7.700 ? 1.655 ? ? ? ? ? 15 1 ? ? 2.830 3.040 ? ? ? ? ? ? ? 99.300 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 7.700 ? 1.778 ? ? ? ? ? 16 1 ? ? 3.040 3.350 ? ? ? ? ? ? ? 99.300 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 7.700 ? 1.527 ? ? ? ? ? 17 1 ? ? 3.350 3.830 ? ? ? ? ? ? ? 99.400 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 7.600 ? 1.317 ? ? ? ? ? 18 1 ? ? 3.830 4.830 ? ? ? ? ? ? ? 97.600 ? ? ? ? 0.024 ? ? ? ? ? ? ? ? 7.300 ? 1.158 ? ? ? ? ? 19 1 ? ? 4.830 100.000 ? ? ? ? ? ? ? 88.500 ? ? ? ? 0.024 ? ? ? ? ? ? ? ? 6.700 ? 1.312 ? ? ? ? ? 20 1 ? ? # _refine.aniso_B[1][1] -0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.0000 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 152.360 _refine.B_iso_mean 41.7400 _refine.B_iso_min 13.890 _refine.correlation_coeff_Fo_to_Fc 0.9540 _refine.correlation_coeff_Fo_to_Fc_free 0.9260 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6IE9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7800 _refine.ls_d_res_low 32.0800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18006 _refine.ls_number_reflns_R_free 969 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.7900 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1990 _refine.ls_R_factor_R_free 0.2526 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1962 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3VVX _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1300 _refine.pdbx_overall_ESU_R_Free 0.1360 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.4680 _refine.overall_SU_ML 0.0810 _refine.overall_SU_R_Cruickshank_DPI 0.1304 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7800 _refine_hist.d_res_low 32.0800 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 1531 _refine_hist.pdbx_number_residues_total 184 _refine_hist.pdbx_B_iso_mean_ligand 33.98 _refine_hist.pdbx_B_iso_mean_solvent 41.76 _refine_hist.pdbx_number_atoms_protein 1462 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 0.019 1551 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1487 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.009 1.975 2103 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.982 3.000 3409 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.846 5.000 189 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.015 22.838 74 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.353 15.000 270 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.128 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.121 0.200 237 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1737 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 371 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.7830 _refine_ls_shell.d_res_low 1.8300 _refine_ls_shell.number_reflns_all 1387 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 73 _refine_ls_shell.number_reflns_R_work 1314 _refine_ls_shell.percent_reflns_obs 95.9200 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2780 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2120 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6IE9 _struct.title 'RamR in complex with chenodeoxycholic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IE9 _struct_keywords.text 'transcriptional regulator, TetR Family, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 9 ? GLY A 26 ? ASP A 8 GLY A 25 1 ? 18 HELX_P HELX_P2 AA2 SER A 30 ? ALA A 38 ? SER A 29 ALA A 37 1 ? 9 HELX_P HELX_P3 AA3 ALA A 41 ? PHE A 49 ? ALA A 40 PHE A 48 1 ? 9 HELX_P HELX_P4 AA4 THR A 51 ? LEU A 75 ? THR A 50 LEU A 74 1 ? 25 HELX_P HELX_P5 AA5 ASP A 81 ? HIS A 100 ? ASP A 80 HIS A 99 1 ? 20 HELX_P HELX_P6 AA6 HIS A 100 ? VAL A 112 ? HIS A 99 VAL A 111 1 ? 13 HELX_P HELX_P7 AA7 THR A 117 ? PHE A 128 ? THR A 116 PHE A 127 1 ? 12 HELX_P HELX_P8 AA8 PHE A 128 ? ASP A 133 ? PHE A 127 ASP A 132 1 ? 6 HELX_P HELX_P9 AA9 SER A 145 ? GLU A 147 ? SER A 144 GLU A 146 5 ? 3 HELX_P HELX_P10 AB1 TYR A 148 ? ASP A 170 ? TYR A 147 ASP A 169 1 ? 23 HELX_P HELX_P11 AB2 ARG A 173 ? THR A 190 ? ARG A 172 THR A 189 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A JN3 200 ? 8 'binding site for residue JN3 A 200' AC2 Software A SO4 201 ? 6 'binding site for residue SO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 60 ? TYR A 59 . ? 1_555 ? 2 AC1 8 THR A 86 ? THR A 85 . ? 1_555 ? 3 AC1 8 ILE A 89 ? ILE A 88 . ? 1_555 ? 4 AC1 8 TYR A 93 ? TYR A 92 . ? 1_555 ? 5 AC1 8 SER A 138 ? SER A 137 . ? 1_555 ? 6 AC1 8 LEU A 140 ? LEU A 139 . ? 1_555 ? 7 AC1 8 ARG A 149 ? ARG A 148 . ? 1_555 ? 8 AC1 8 ASP A 153 ? ASP A 152 . ? 1_555 ? 9 AC2 6 GLN A 20 ? GLN A 19 . ? 1_555 ? 10 AC2 6 ASN A 99 ? ASN A 98 . ? 1_555 ? 11 AC2 6 HIS A 100 ? HIS A 99 . ? 1_555 ? 12 AC2 6 PRO A 101 ? PRO A 100 . ? 1_555 ? 13 AC2 6 ALA A 102 ? ALA A 101 . ? 1_555 ? 14 AC2 6 ARG A 103 ? ARG A 102 . ? 1_555 ? # _atom_sites.entry_id 6IE9 _atom_sites.fract_transf_matrix[1][1] 0.011437 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000658 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018665 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022849 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 VAL 2 1 ? ? ? A . n A 1 3 ALA 3 2 ? ? ? A . n A 1 4 ARG 4 3 ? ? ? A . n A 1 5 PRO 5 4 ? ? ? A . n A 1 6 LYS 6 5 ? ? ? A . n A 1 7 SER 7 6 ? ? ? A . n A 1 8 GLU 8 7 ? ? ? A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 GLN 12 11 11 GLN GLN A . n A 1 13 ALA 13 12 12 ALA ALA A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 ALA 18 17 17 ALA ALA A . n A 1 19 THR 19 18 18 THR THR A . n A 1 20 GLN 20 19 19 GLN GLN A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 GLN 24 23 23 GLN GLN A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 ILE 27 26 26 ILE ILE A . n A 1 28 ALA 28 27 27 ALA ALA A . n A 1 29 ALA 29 28 28 ALA ALA A . n A 1 30 SER 30 29 29 SER SER A . n A 1 31 THR 31 30 30 THR THR A . n A 1 32 ALA 32 31 31 ALA ALA A . n A 1 33 VAL 33 32 32 VAL VAL A . n A 1 34 ILE 34 33 33 ILE ILE A . n A 1 35 ALA 35 34 34 ALA ALA A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 ASN 37 36 36 ASN ASN A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 GLY 39 38 38 GLY GLY A . n A 1 40 VAL 40 39 39 VAL VAL A . n A 1 41 ALA 41 40 40 ALA ALA A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 THR 44 43 43 THR THR A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 PHE 46 45 45 PHE PHE A . n A 1 47 ARG 47 46 46 ARG ARG A . n A 1 48 TYR 48 47 47 TYR TYR A . n A 1 49 PHE 49 48 48 PHE PHE A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 THR 51 50 50 THR THR A . n A 1 52 LYS 52 51 51 LYS LYS A . n A 1 53 ASP 53 52 52 ASP ASP A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 LEU 55 54 54 LEU LEU A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 ASN 57 56 56 ASN ASN A . n A 1 58 THR 58 57 57 THR THR A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 TYR 60 59 59 TYR TYR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 HIS 62 61 61 HIS HIS A . n A 1 63 LEU 63 62 62 LEU LEU A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 GLN 65 64 64 GLN GLN A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 LEU 67 66 66 LEU LEU A . n A 1 68 CYS 68 67 67 CYS CYS A . n A 1 69 GLN 69 68 68 GLN GLN A . n A 1 70 SER 70 69 69 SER SER A . n A 1 71 MET 71 70 70 MET MET A . n A 1 72 ILE 72 71 71 ILE ILE A . n A 1 73 MET 73 72 72 MET MET A . n A 1 74 GLU 74 73 73 GLU GLU A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 ASP 76 75 75 ASP ASP A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 SER 78 77 77 SER SER A . n A 1 79 ILE 79 78 78 ILE ILE A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 ASP 81 80 80 ASP ASP A . n A 1 82 ALA 82 81 81 ALA ALA A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 MET 84 83 83 MET MET A . n A 1 85 MET 85 84 84 MET MET A . n A 1 86 THR 86 85 85 THR THR A . n A 1 87 ARG 87 86 86 ARG ARG A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 ILE 89 88 88 ILE ILE A . n A 1 90 TRP 90 89 89 TRP TRP A . n A 1 91 ASN 91 90 90 ASN ASN A . n A 1 92 SER 92 91 91 SER SER A . n A 1 93 TYR 93 92 92 TYR TYR A . n A 1 94 ILE 94 93 93 ILE ILE A . n A 1 95 SER 95 94 94 SER SER A . n A 1 96 TRP 96 95 95 TRP TRP A . n A 1 97 GLY 97 96 96 GLY GLY A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 ASN 99 98 98 ASN ASN A . n A 1 100 HIS 100 99 99 HIS HIS A . n A 1 101 PRO 101 100 100 PRO PRO A . n A 1 102 ALA 102 101 101 ALA ALA A . n A 1 103 ARG 103 102 102 ARG ARG A . n A 1 104 HIS 104 103 103 HIS HIS A . n A 1 105 ARG 105 104 104 ARG ARG A . n A 1 106 ALA 106 105 105 ALA ALA A . n A 1 107 ILE 107 106 106 ILE ILE A . n A 1 108 ARG 108 107 107 ARG ARG A . n A 1 109 GLN 109 108 108 GLN GLN A . n A 1 110 LEU 110 109 109 LEU LEU A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 VAL 112 111 111 VAL VAL A . n A 1 113 SER 113 112 112 SER SER A . n A 1 114 GLU 114 113 113 GLU GLU A . n A 1 115 LYS 115 114 114 LYS LYS A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 THR 117 116 116 THR THR A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 GLU 119 118 118 GLU GLU A . n A 1 120 THR 120 119 119 THR THR A . n A 1 121 GLU 121 120 120 GLU GLU A . n A 1 122 GLN 122 121 121 GLN GLN A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 ASP 126 125 125 ASP ASP A . n A 1 127 MET 127 126 126 MET MET A . n A 1 128 PHE 128 127 127 PHE PHE A . n A 1 129 PRO 129 128 128 PRO PRO A . n A 1 130 GLU 130 129 129 GLU GLU A . n A 1 131 LEU 131 130 130 LEU LEU A . n A 1 132 ARG 132 131 131 ARG ARG A . n A 1 133 ASP 133 132 132 ASP ASP A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 CYS 135 134 134 CYS CYS A . n A 1 136 HIS 136 135 135 HIS HIS A . n A 1 137 ARG 137 136 136 ARG ARG A . n A 1 138 SER 138 137 137 SER SER A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 MET 141 140 140 MET MET A . n A 1 142 VAL 142 141 141 VAL VAL A . n A 1 143 PHE 143 142 142 PHE PHE A . n A 1 144 MET 144 143 143 MET MET A . n A 1 145 SER 145 144 144 SER SER A . n A 1 146 ASP 146 145 145 ASP ASP A . n A 1 147 GLU 147 146 146 GLU GLU A . n A 1 148 TYR 148 147 147 TYR TYR A . n A 1 149 ARG 149 148 148 ARG ARG A . n A 1 150 ALA 150 149 149 ALA ALA A . n A 1 151 PHE 151 150 150 PHE PHE A . n A 1 152 GLY 152 151 151 GLY GLY A . n A 1 153 ASP 153 152 152 ASP ASP A . n A 1 154 GLY 154 153 153 GLY GLY A . n A 1 155 LEU 155 154 154 LEU LEU A . n A 1 156 PHE 156 155 155 PHE PHE A . n A 1 157 LEU 157 156 156 LEU LEU A . n A 1 158 ALA 158 157 157 ALA ALA A . n A 1 159 LEU 159 158 158 LEU LEU A . n A 1 160 ALA 160 159 159 ALA ALA A . n A 1 161 GLU 161 160 160 GLU GLU A . n A 1 162 THR 162 161 161 THR THR A . n A 1 163 THR 163 162 162 THR THR A . n A 1 164 MET 164 163 163 MET MET A . n A 1 165 ASP 165 164 164 ASP ASP A . n A 1 166 PHE 166 165 165 PHE PHE A . n A 1 167 ALA 167 166 166 ALA ALA A . n A 1 168 ALA 168 167 167 ALA ALA A . n A 1 169 ARG 169 168 168 ARG ARG A . n A 1 170 ASP 170 169 169 ASP ASP A . n A 1 171 PRO 171 170 170 PRO PRO A . n A 1 172 ALA 172 171 171 ALA ALA A . n A 1 173 ARG 173 172 172 ARG ARG A . n A 1 174 ALA 174 173 173 ALA ALA A . n A 1 175 GLY 175 174 174 GLY GLY A . n A 1 176 GLU 176 175 175 GLU GLU A . n A 1 177 TYR 177 176 176 TYR TYR A . n A 1 178 ILE 178 177 177 ILE ILE A . n A 1 179 ALA 179 178 178 ALA ALA A . n A 1 180 LEU 180 179 179 LEU LEU A . n A 1 181 GLY 181 180 180 GLY GLY A . n A 1 182 PHE 182 181 181 PHE PHE A . n A 1 183 GLU 183 182 182 GLU GLU A . n A 1 184 ALA 184 183 183 ALA ALA A . n A 1 185 MET 185 184 184 MET MET A . n A 1 186 TRP 186 185 185 TRP TRP A . n A 1 187 ARG 187 186 186 ARG ARG A . n A 1 188 ALA 188 187 187 ALA ALA A . n A 1 189 LEU 189 188 188 LEU LEU A . n A 1 190 THR 190 189 189 THR THR A . n A 1 191 ARG 191 190 190 ARG ARG A . n A 1 192 GLU 192 191 191 GLU GLU A . n A 1 193 GLU 193 192 ? ? ? A . n A 1 194 GLN 194 193 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 JN3 1 200 200 JN3 JN3 A . C 3 SO4 1 201 201 SO4 SO4 A . D 4 HOH 1 301 219 HOH HOH A . D 4 HOH 2 302 211 HOH HOH A . D 4 HOH 3 303 205 HOH HOH A . D 4 HOH 4 304 230 HOH HOH A . D 4 HOH 5 305 217 HOH HOH A . D 4 HOH 6 306 210 HOH HOH A . D 4 HOH 7 307 222 HOH HOH A . D 4 HOH 8 308 221 HOH HOH A . D 4 HOH 9 309 223 HOH HOH A . D 4 HOH 10 310 233 HOH HOH A . D 4 HOH 11 311 203 HOH HOH A . D 4 HOH 12 312 209 HOH HOH A . D 4 HOH 13 313 229 HOH HOH A . D 4 HOH 14 314 228 HOH HOH A . D 4 HOH 15 315 232 HOH HOH A . D 4 HOH 16 316 215 HOH HOH A . D 4 HOH 17 317 208 HOH HOH A . D 4 HOH 18 318 237 HOH HOH A . D 4 HOH 19 319 214 HOH HOH A . D 4 HOH 20 320 220 HOH HOH A . D 4 HOH 21 321 225 HOH HOH A . D 4 HOH 22 322 231 HOH HOH A . D 4 HOH 23 323 218 HOH HOH A . D 4 HOH 24 324 234 HOH HOH A . D 4 HOH 25 325 227 HOH HOH A . D 4 HOH 26 326 216 HOH HOH A . D 4 HOH 27 327 207 HOH HOH A . D 4 HOH 28 328 213 HOH HOH A . D 4 HOH 29 329 235 HOH HOH A . D 4 HOH 30 330 226 HOH HOH A . D 4 HOH 31 331 212 HOH HOH A . D 4 HOH 32 332 204 HOH HOH A . D 4 HOH 33 333 236 HOH HOH A . D 4 HOH 34 334 206 HOH HOH A . D 4 HOH 35 335 224 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2470 ? 1 MORE -17 ? 1 'SSA (A^2)' 18430 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -2.5157958984 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 43.7647499707 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-13 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 6IE9 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.030 _pdbx_phasing_MR.d_res_low_rotation 32.080 _pdbx_phasing_MR.d_res_high_translation 2.030 _pdbx_phasing_MR.d_res_low_translation 32.080 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 10.2.35 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0029 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 132 ? ? -140.55 58.93 2 1 ARG A 136 ? ? 25.39 163.71 3 1 SER A 137 ? ? 66.59 -134.25 4 1 VAL A 138 ? ? 57.48 -30.29 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASP A 132 ? ? LEU A 133 ? ? 147.90 2 1 SER A 137 ? ? VAL A 138 ? ? -133.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A VAL 1 ? A VAL 2 3 1 Y 1 A ALA 2 ? A ALA 3 4 1 Y 1 A ARG 3 ? A ARG 4 5 1 Y 1 A PRO 4 ? A PRO 5 6 1 Y 1 A LYS 5 ? A LYS 6 7 1 Y 1 A SER 6 ? A SER 7 8 1 Y 1 A GLU 7 ? A GLU 8 9 1 Y 1 A GLU 192 ? A GLU 193 10 1 Y 1 A GLN 193 ? A GLN 194 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 JN3 C1 C N N 183 JN3 C2 C N N 184 JN3 C3 C N R 185 JN3 O3 O N N 186 JN3 C4 C N N 187 JN3 C5 C N S 188 JN3 C6 C N N 189 JN3 C7 C N R 190 JN3 O7 O N N 191 JN3 C8 C N S 192 JN3 C9 C N S 193 JN3 C10 C N S 194 JN3 C11 C N N 195 JN3 C12 C N N 196 JN3 C13 C N R 197 JN3 C14 C N S 198 JN3 C15 C N N 199 JN3 C16 C N N 200 JN3 C17 C N R 201 JN3 C18 C N N 202 JN3 C19 C N N 203 JN3 C20 C N R 204 JN3 C21 C N N 205 JN3 C22 C N N 206 JN3 C23 C N N 207 JN3 O25 O N N 208 JN3 C24 C N N 209 JN3 O26 O N N 210 JN3 H11 H N N 211 JN3 H12 H N N 212 JN3 H21 H N N 213 JN3 H22 H N N 214 JN3 H3 H N N 215 JN3 HO3 H N N 216 JN3 H41 H N N 217 JN3 H42 H N N 218 JN3 H5 H N N 219 JN3 H61 H N N 220 JN3 H62 H N N 221 JN3 H7 H N N 222 JN3 HO7 H N N 223 JN3 H8 H N N 224 JN3 H9 H N N 225 JN3 H111 H N N 226 JN3 H112 H N N 227 JN3 H121 H N N 228 JN3 H122 H N N 229 JN3 H14 H N N 230 JN3 H151 H N N 231 JN3 H152 H N N 232 JN3 H161 H N N 233 JN3 H162 H N N 234 JN3 H17 H N N 235 JN3 H181 H N N 236 JN3 H182 H N N 237 JN3 H183 H N N 238 JN3 H191 H N N 239 JN3 H192 H N N 240 JN3 H193 H N N 241 JN3 H20 H N N 242 JN3 H211 H N N 243 JN3 H212 H N N 244 JN3 H213 H N N 245 JN3 H221 H N N 246 JN3 H222 H N N 247 JN3 H231 H N N 248 JN3 H232 H N N 249 JN3 HO26 H N N 250 LEU N N N N 251 LEU CA C N S 252 LEU C C N N 253 LEU O O N N 254 LEU CB C N N 255 LEU CG C N N 256 LEU CD1 C N N 257 LEU CD2 C N N 258 LEU OXT O N N 259 LEU H H N N 260 LEU H2 H N N 261 LEU HA H N N 262 LEU HB2 H N N 263 LEU HB3 H N N 264 LEU HG H N N 265 LEU HD11 H N N 266 LEU HD12 H N N 267 LEU HD13 H N N 268 LEU HD21 H N N 269 LEU HD22 H N N 270 LEU HD23 H N N 271 LEU HXT H N N 272 LYS N N N N 273 LYS CA C N S 274 LYS C C N N 275 LYS O O N N 276 LYS CB C N N 277 LYS CG C N N 278 LYS CD C N N 279 LYS CE C N N 280 LYS NZ N N N 281 LYS OXT O N N 282 LYS H H N N 283 LYS H2 H N N 284 LYS HA H N N 285 LYS HB2 H N N 286 LYS HB3 H N N 287 LYS HG2 H N N 288 LYS HG3 H N N 289 LYS HD2 H N N 290 LYS HD3 H N N 291 LYS HE2 H N N 292 LYS HE3 H N N 293 LYS HZ1 H N N 294 LYS HZ2 H N N 295 LYS HZ3 H N N 296 LYS HXT H N N 297 MET N N N N 298 MET CA C N S 299 MET C C N N 300 MET O O N N 301 MET CB C N N 302 MET CG C N N 303 MET SD S N N 304 MET CE C N N 305 MET OXT O N N 306 MET H H N N 307 MET H2 H N N 308 MET HA H N N 309 MET HB2 H N N 310 MET HB3 H N N 311 MET HG2 H N N 312 MET HG3 H N N 313 MET HE1 H N N 314 MET HE2 H N N 315 MET HE3 H N N 316 MET HXT H N N 317 PHE N N N N 318 PHE CA C N S 319 PHE C C N N 320 PHE O O N N 321 PHE CB C N N 322 PHE CG C Y N 323 PHE CD1 C Y N 324 PHE CD2 C Y N 325 PHE CE1 C Y N 326 PHE CE2 C Y N 327 PHE CZ C Y N 328 PHE OXT O N N 329 PHE H H N N 330 PHE H2 H N N 331 PHE HA H N N 332 PHE HB2 H N N 333 PHE HB3 H N N 334 PHE HD1 H N N 335 PHE HD2 H N N 336 PHE HE1 H N N 337 PHE HE2 H N N 338 PHE HZ H N N 339 PHE HXT H N N 340 PRO N N N N 341 PRO CA C N S 342 PRO C C N N 343 PRO O O N N 344 PRO CB C N N 345 PRO CG C N N 346 PRO CD C N N 347 PRO OXT O N N 348 PRO H H N N 349 PRO HA H N N 350 PRO HB2 H N N 351 PRO HB3 H N N 352 PRO HG2 H N N 353 PRO HG3 H N N 354 PRO HD2 H N N 355 PRO HD3 H N N 356 PRO HXT H N N 357 SER N N N N 358 SER CA C N S 359 SER C C N N 360 SER O O N N 361 SER CB C N N 362 SER OG O N N 363 SER OXT O N N 364 SER H H N N 365 SER H2 H N N 366 SER HA H N N 367 SER HB2 H N N 368 SER HB3 H N N 369 SER HG H N N 370 SER HXT H N N 371 SO4 S S N N 372 SO4 O1 O N N 373 SO4 O2 O N N 374 SO4 O3 O N N 375 SO4 O4 O N N 376 THR N N N N 377 THR CA C N S 378 THR C C N N 379 THR O O N N 380 THR CB C N R 381 THR OG1 O N N 382 THR CG2 C N N 383 THR OXT O N N 384 THR H H N N 385 THR H2 H N N 386 THR HA H N N 387 THR HB H N N 388 THR HG1 H N N 389 THR HG21 H N N 390 THR HG22 H N N 391 THR HG23 H N N 392 THR HXT H N N 393 TRP N N N N 394 TRP CA C N S 395 TRP C C N N 396 TRP O O N N 397 TRP CB C N N 398 TRP CG C Y N 399 TRP CD1 C Y N 400 TRP CD2 C Y N 401 TRP NE1 N Y N 402 TRP CE2 C Y N 403 TRP CE3 C Y N 404 TRP CZ2 C Y N 405 TRP CZ3 C Y N 406 TRP CH2 C Y N 407 TRP OXT O N N 408 TRP H H N N 409 TRP H2 H N N 410 TRP HA H N N 411 TRP HB2 H N N 412 TRP HB3 H N N 413 TRP HD1 H N N 414 TRP HE1 H N N 415 TRP HE3 H N N 416 TRP HZ2 H N N 417 TRP HZ3 H N N 418 TRP HH2 H N N 419 TRP HXT H N N 420 TYR N N N N 421 TYR CA C N S 422 TYR C C N N 423 TYR O O N N 424 TYR CB C N N 425 TYR CG C Y N 426 TYR CD1 C Y N 427 TYR CD2 C Y N 428 TYR CE1 C Y N 429 TYR CE2 C Y N 430 TYR CZ C Y N 431 TYR OH O N N 432 TYR OXT O N N 433 TYR H H N N 434 TYR H2 H N N 435 TYR HA H N N 436 TYR HB2 H N N 437 TYR HB3 H N N 438 TYR HD1 H N N 439 TYR HD2 H N N 440 TYR HE1 H N N 441 TYR HE2 H N N 442 TYR HH H N N 443 TYR HXT H N N 444 VAL N N N N 445 VAL CA C N S 446 VAL C C N N 447 VAL O O N N 448 VAL CB C N N 449 VAL CG1 C N N 450 VAL CG2 C N N 451 VAL OXT O N N 452 VAL H H N N 453 VAL H2 H N N 454 VAL HA H N N 455 VAL HB H N N 456 VAL HG11 H N N 457 VAL HG12 H N N 458 VAL HG13 H N N 459 VAL HG21 H N N 460 VAL HG22 H N N 461 VAL HG23 H N N 462 VAL HXT H N N 463 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 JN3 C1 C2 sing N N 173 JN3 C1 C10 sing N N 174 JN3 C1 H11 sing N N 175 JN3 C1 H12 sing N N 176 JN3 C2 C3 sing N N 177 JN3 C2 H21 sing N N 178 JN3 C2 H22 sing N N 179 JN3 C3 O3 sing N N 180 JN3 C3 C4 sing N N 181 JN3 C3 H3 sing N N 182 JN3 O3 HO3 sing N N 183 JN3 C4 C5 sing N N 184 JN3 C4 H41 sing N N 185 JN3 C4 H42 sing N N 186 JN3 C5 C10 sing N N 187 JN3 C5 C6 sing N N 188 JN3 C5 H5 sing N N 189 JN3 C6 C7 sing N N 190 JN3 C6 H61 sing N N 191 JN3 C6 H62 sing N N 192 JN3 C7 C8 sing N N 193 JN3 C7 O7 sing N N 194 JN3 C7 H7 sing N N 195 JN3 O7 HO7 sing N N 196 JN3 C8 C9 sing N N 197 JN3 C8 C14 sing N N 198 JN3 C8 H8 sing N N 199 JN3 C9 C11 sing N N 200 JN3 C9 C10 sing N N 201 JN3 C9 H9 sing N N 202 JN3 C10 C19 sing N N 203 JN3 C11 C12 sing N N 204 JN3 C11 H111 sing N N 205 JN3 C11 H112 sing N N 206 JN3 C12 C13 sing N N 207 JN3 C12 H121 sing N N 208 JN3 C12 H122 sing N N 209 JN3 C13 C18 sing N N 210 JN3 C13 C17 sing N N 211 JN3 C13 C14 sing N N 212 JN3 C14 C15 sing N N 213 JN3 C14 H14 sing N N 214 JN3 C15 C16 sing N N 215 JN3 C15 H151 sing N N 216 JN3 C15 H152 sing N N 217 JN3 C16 C17 sing N N 218 JN3 C16 H161 sing N N 219 JN3 C16 H162 sing N N 220 JN3 C17 C20 sing N N 221 JN3 C17 H17 sing N N 222 JN3 C18 H181 sing N N 223 JN3 C18 H182 sing N N 224 JN3 C18 H183 sing N N 225 JN3 C19 H191 sing N N 226 JN3 C19 H192 sing N N 227 JN3 C19 H193 sing N N 228 JN3 C20 C21 sing N N 229 JN3 C20 C22 sing N N 230 JN3 C20 H20 sing N N 231 JN3 C21 H211 sing N N 232 JN3 C21 H212 sing N N 233 JN3 C21 H213 sing N N 234 JN3 C22 C23 sing N N 235 JN3 C22 H221 sing N N 236 JN3 C22 H222 sing N N 237 JN3 C23 C24 sing N N 238 JN3 C23 H231 sing N N 239 JN3 C23 H232 sing N N 240 JN3 O25 C24 doub N N 241 JN3 C24 O26 sing N N 242 JN3 O26 HO26 sing N N 243 LEU N CA sing N N 244 LEU N H sing N N 245 LEU N H2 sing N N 246 LEU CA C sing N N 247 LEU CA CB sing N N 248 LEU CA HA sing N N 249 LEU C O doub N N 250 LEU C OXT sing N N 251 LEU CB CG sing N N 252 LEU CB HB2 sing N N 253 LEU CB HB3 sing N N 254 LEU CG CD1 sing N N 255 LEU CG CD2 sing N N 256 LEU CG HG sing N N 257 LEU CD1 HD11 sing N N 258 LEU CD1 HD12 sing N N 259 LEU CD1 HD13 sing N N 260 LEU CD2 HD21 sing N N 261 LEU CD2 HD22 sing N N 262 LEU CD2 HD23 sing N N 263 LEU OXT HXT sing N N 264 LYS N CA sing N N 265 LYS N H sing N N 266 LYS N H2 sing N N 267 LYS CA C sing N N 268 LYS CA CB sing N N 269 LYS CA HA sing N N 270 LYS C O doub N N 271 LYS C OXT sing N N 272 LYS CB CG sing N N 273 LYS CB HB2 sing N N 274 LYS CB HB3 sing N N 275 LYS CG CD sing N N 276 LYS CG HG2 sing N N 277 LYS CG HG3 sing N N 278 LYS CD CE sing N N 279 LYS CD HD2 sing N N 280 LYS CD HD3 sing N N 281 LYS CE NZ sing N N 282 LYS CE HE2 sing N N 283 LYS CE HE3 sing N N 284 LYS NZ HZ1 sing N N 285 LYS NZ HZ2 sing N N 286 LYS NZ HZ3 sing N N 287 LYS OXT HXT sing N N 288 MET N CA sing N N 289 MET N H sing N N 290 MET N H2 sing N N 291 MET CA C sing N N 292 MET CA CB sing N N 293 MET CA HA sing N N 294 MET C O doub N N 295 MET C OXT sing N N 296 MET CB CG sing N N 297 MET CB HB2 sing N N 298 MET CB HB3 sing N N 299 MET CG SD sing N N 300 MET CG HG2 sing N N 301 MET CG HG3 sing N N 302 MET SD CE sing N N 303 MET CE HE1 sing N N 304 MET CE HE2 sing N N 305 MET CE HE3 sing N N 306 MET OXT HXT sing N N 307 PHE N CA sing N N 308 PHE N H sing N N 309 PHE N H2 sing N N 310 PHE CA C sing N N 311 PHE CA CB sing N N 312 PHE CA HA sing N N 313 PHE C O doub N N 314 PHE C OXT sing N N 315 PHE CB CG sing N N 316 PHE CB HB2 sing N N 317 PHE CB HB3 sing N N 318 PHE CG CD1 doub Y N 319 PHE CG CD2 sing Y N 320 PHE CD1 CE1 sing Y N 321 PHE CD1 HD1 sing N N 322 PHE CD2 CE2 doub Y N 323 PHE CD2 HD2 sing N N 324 PHE CE1 CZ doub Y N 325 PHE CE1 HE1 sing N N 326 PHE CE2 CZ sing Y N 327 PHE CE2 HE2 sing N N 328 PHE CZ HZ sing N N 329 PHE OXT HXT sing N N 330 PRO N CA sing N N 331 PRO N CD sing N N 332 PRO N H sing N N 333 PRO CA C sing N N 334 PRO CA CB sing N N 335 PRO CA HA sing N N 336 PRO C O doub N N 337 PRO C OXT sing N N 338 PRO CB CG sing N N 339 PRO CB HB2 sing N N 340 PRO CB HB3 sing N N 341 PRO CG CD sing N N 342 PRO CG HG2 sing N N 343 PRO CG HG3 sing N N 344 PRO CD HD2 sing N N 345 PRO CD HD3 sing N N 346 PRO OXT HXT sing N N 347 SER N CA sing N N 348 SER N H sing N N 349 SER N H2 sing N N 350 SER CA C sing N N 351 SER CA CB sing N N 352 SER CA HA sing N N 353 SER C O doub N N 354 SER C OXT sing N N 355 SER CB OG sing N N 356 SER CB HB2 sing N N 357 SER CB HB3 sing N N 358 SER OG HG sing N N 359 SER OXT HXT sing N N 360 SO4 S O1 doub N N 361 SO4 S O2 doub N N 362 SO4 S O3 sing N N 363 SO4 S O4 sing N N 364 THR N CA sing N N 365 THR N H sing N N 366 THR N H2 sing N N 367 THR CA C sing N N 368 THR CA CB sing N N 369 THR CA HA sing N N 370 THR C O doub N N 371 THR C OXT sing N N 372 THR CB OG1 sing N N 373 THR CB CG2 sing N N 374 THR CB HB sing N N 375 THR OG1 HG1 sing N N 376 THR CG2 HG21 sing N N 377 THR CG2 HG22 sing N N 378 THR CG2 HG23 sing N N 379 THR OXT HXT sing N N 380 TRP N CA sing N N 381 TRP N H sing N N 382 TRP N H2 sing N N 383 TRP CA C sing N N 384 TRP CA CB sing N N 385 TRP CA HA sing N N 386 TRP C O doub N N 387 TRP C OXT sing N N 388 TRP CB CG sing N N 389 TRP CB HB2 sing N N 390 TRP CB HB3 sing N N 391 TRP CG CD1 doub Y N 392 TRP CG CD2 sing Y N 393 TRP CD1 NE1 sing Y N 394 TRP CD1 HD1 sing N N 395 TRP CD2 CE2 doub Y N 396 TRP CD2 CE3 sing Y N 397 TRP NE1 CE2 sing Y N 398 TRP NE1 HE1 sing N N 399 TRP CE2 CZ2 sing Y N 400 TRP CE3 CZ3 doub Y N 401 TRP CE3 HE3 sing N N 402 TRP CZ2 CH2 doub Y N 403 TRP CZ2 HZ2 sing N N 404 TRP CZ3 CH2 sing Y N 405 TRP CZ3 HZ3 sing N N 406 TRP CH2 HH2 sing N N 407 TRP OXT HXT sing N N 408 TYR N CA sing N N 409 TYR N H sing N N 410 TYR N H2 sing N N 411 TYR CA C sing N N 412 TYR CA CB sing N N 413 TYR CA HA sing N N 414 TYR C O doub N N 415 TYR C OXT sing N N 416 TYR CB CG sing N N 417 TYR CB HB2 sing N N 418 TYR CB HB3 sing N N 419 TYR CG CD1 doub Y N 420 TYR CG CD2 sing Y N 421 TYR CD1 CE1 sing Y N 422 TYR CD1 HD1 sing N N 423 TYR CD2 CE2 doub Y N 424 TYR CD2 HD2 sing N N 425 TYR CE1 CZ doub Y N 426 TYR CE1 HE1 sing N N 427 TYR CE2 CZ sing Y N 428 TYR CE2 HE2 sing N N 429 TYR CZ OH sing N N 430 TYR OH HH sing N N 431 TYR OXT HXT sing N N 432 VAL N CA sing N N 433 VAL N H sing N N 434 VAL N H2 sing N N 435 VAL CA C sing N N 436 VAL CA CB sing N N 437 VAL CA HA sing N N 438 VAL C O doub N N 439 VAL C OXT sing N N 440 VAL CB CG1 sing N N 441 VAL CB CG2 sing N N 442 VAL CB HB sing N N 443 VAL CG1 HG11 sing N N 444 VAL CG1 HG12 sing N N 445 VAL CG1 HG13 sing N N 446 VAL CG2 HG21 sing N N 447 VAL CG2 HG22 sing N N 448 VAL CG2 HG23 sing N N 449 VAL OXT HXT sing N N 450 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id JN3 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id JN3 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHENODEOXYCHOLIC ACID' JN3 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3VVX _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #