data_6ILA # _entry.id 6ILA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ILA pdb_00006ila 10.2210/pdb6ila/pdb WWPDB D_1300009402 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ILA _pdbx_database_status.recvd_initial_deposition_date 2018-10-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Choi, M.Y.' 1 0000-0003-0803-2835 'Kang, L.W.' 2 0000-0002-1411-3132 'Ho, T.H.' 3 0000-0002-3706-7917 'Nguyen, D.Q.' 4 0000-0003-4864-0368 'Lee, I.H.' 5 0000-0003-3529-470X 'Lee, J.H.' 6 0000-0002-8275-197X 'Park, Y.S.' 7 0000-0001-7685-1117 'Park, H.J.' 8 0000-0002-1252-2389 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of fructuronate-tagaturonate epimerase UxaE from Cohnella laeviribosi' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Choi, M.Y.' 1 0000-0003-0803-2835 primary 'Kang, L.W.' 2 0000-0002-1411-3132 primary 'Ho, T.H.' 3 0000-0002-3706-7917 primary 'Nguyen, D.Q.' 4 0000-0003-4864-0368 primary 'Lee, I.H.' 5 0000-0003-3529-470X primary 'Lee, J.H.' 6 0000-0002-8275-197X primary 'Park, Y.S.' 7 0000-0001-7685-1117 primary 'Park, H.J.' 8 0000-0002-1252-2389 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 100.656 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6ILA _cell.details ? _cell.formula_units_Z ? _cell.length_a 135.269 _cell.length_a_esd ? _cell.length_b 51.998 _cell.length_b_esd ? _cell.length_c 73.974 _cell.length_c_esd ? _cell.volume 511339.477 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ILA _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fructuronate-tagaturonate epimerase UxaE' 55208.102 1 5.1.2.7 S345A ? ? 2 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 5 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKAQSIIERLAAGQVHVYPRSRHESEGTRVQMIKAEGRKYLVAEGSGKLYDELRGEEADGVKLCELSHENRLVLNRHFPF TVPQAFGKQSATIGLGDRLGIAGPGHVQTVRGRAIHPILAQQSIRELALTGRDYKQVIDAAAYAVFQEGYTEGYGADGDH LKKEEDIRMALDLGFTMLTLDCSEQIDNEAAQAGESEVKRKYEELPESVRSHYEAKYLDKTFQVGPHAIHFDAATLMRDV LVYREAIQFMIYIYEKYIQTAGRAVDFEISIDETLTPTAPGSHFLVASELIGKNVDIFSMAPRFIGEFQKGIDYIGDIAQ FERELAVHAAIADRFGYKLSIHSGADKFSVFALVGRYTNGRFHVKTAGTNWLEAVRIVAKTNPGLYRRMHQYALEHFEEA TAYYHVTTNLNNIRPLADVSDEELPSYMNENDARQLLHITYGLLLQAKKDDGSSLFRDEFFRTLSEREEDYEAALRSHIG KHLDLLGVK ; _entity_poly.pdbx_seq_one_letter_code_can ;MKAQSIIERLAAGQVHVYPRSRHESEGTRVQMIKAEGRKYLVAEGSGKLYDELRGEEADGVKLCELSHENRLVLNRHFPF TVPQAFGKQSATIGLGDRLGIAGPGHVQTVRGRAIHPILAQQSIRELALTGRDYKQVIDAAAYAVFQEGYTEGYGADGDH LKKEEDIRMALDLGFTMLTLDCSEQIDNEAAQAGESEVKRKYEELPESVRSHYEAKYLDKTFQVGPHAIHFDAATLMRDV LVYREAIQFMIYIYEKYIQTAGRAVDFEISIDETLTPTAPGSHFLVASELIGKNVDIFSMAPRFIGEFQKGIDYIGDIAQ FERELAVHAAIADRFGYKLSIHSGADKFSVFALVGRYTNGRFHVKTAGTNWLEAVRIVAKTNPGLYRRMHQYALEHFEEA TAYYHVTTNLNNIRPLADVSDEELPSYMNENDARQLLHITYGLLLQAKKDDGSSLFRDEFFRTLSEREEDYEAALRSHIG KHLDLLGVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ALA n 1 4 GLN n 1 5 SER n 1 6 ILE n 1 7 ILE n 1 8 GLU n 1 9 ARG n 1 10 LEU n 1 11 ALA n 1 12 ALA n 1 13 GLY n 1 14 GLN n 1 15 VAL n 1 16 HIS n 1 17 VAL n 1 18 TYR n 1 19 PRO n 1 20 ARG n 1 21 SER n 1 22 ARG n 1 23 HIS n 1 24 GLU n 1 25 SER n 1 26 GLU n 1 27 GLY n 1 28 THR n 1 29 ARG n 1 30 VAL n 1 31 GLN n 1 32 MET n 1 33 ILE n 1 34 LYS n 1 35 ALA n 1 36 GLU n 1 37 GLY n 1 38 ARG n 1 39 LYS n 1 40 TYR n 1 41 LEU n 1 42 VAL n 1 43 ALA n 1 44 GLU n 1 45 GLY n 1 46 SER n 1 47 GLY n 1 48 LYS n 1 49 LEU n 1 50 TYR n 1 51 ASP n 1 52 GLU n 1 53 LEU n 1 54 ARG n 1 55 GLY n 1 56 GLU n 1 57 GLU n 1 58 ALA n 1 59 ASP n 1 60 GLY n 1 61 VAL n 1 62 LYS n 1 63 LEU n 1 64 CYS n 1 65 GLU n 1 66 LEU n 1 67 SER n 1 68 HIS n 1 69 GLU n 1 70 ASN n 1 71 ARG n 1 72 LEU n 1 73 VAL n 1 74 LEU n 1 75 ASN n 1 76 ARG n 1 77 HIS n 1 78 PHE n 1 79 PRO n 1 80 PHE n 1 81 THR n 1 82 VAL n 1 83 PRO n 1 84 GLN n 1 85 ALA n 1 86 PHE n 1 87 GLY n 1 88 LYS n 1 89 GLN n 1 90 SER n 1 91 ALA n 1 92 THR n 1 93 ILE n 1 94 GLY n 1 95 LEU n 1 96 GLY n 1 97 ASP n 1 98 ARG n 1 99 LEU n 1 100 GLY n 1 101 ILE n 1 102 ALA n 1 103 GLY n 1 104 PRO n 1 105 GLY n 1 106 HIS n 1 107 VAL n 1 108 GLN n 1 109 THR n 1 110 VAL n 1 111 ARG n 1 112 GLY n 1 113 ARG n 1 114 ALA n 1 115 ILE n 1 116 HIS n 1 117 PRO n 1 118 ILE n 1 119 LEU n 1 120 ALA n 1 121 GLN n 1 122 GLN n 1 123 SER n 1 124 ILE n 1 125 ARG n 1 126 GLU n 1 127 LEU n 1 128 ALA n 1 129 LEU n 1 130 THR n 1 131 GLY n 1 132 ARG n 1 133 ASP n 1 134 TYR n 1 135 LYS n 1 136 GLN n 1 137 VAL n 1 138 ILE n 1 139 ASP n 1 140 ALA n 1 141 ALA n 1 142 ALA n 1 143 TYR n 1 144 ALA n 1 145 VAL n 1 146 PHE n 1 147 GLN n 1 148 GLU n 1 149 GLY n 1 150 TYR n 1 151 THR n 1 152 GLU n 1 153 GLY n 1 154 TYR n 1 155 GLY n 1 156 ALA n 1 157 ASP n 1 158 GLY n 1 159 ASP n 1 160 HIS n 1 161 LEU n 1 162 LYS n 1 163 LYS n 1 164 GLU n 1 165 GLU n 1 166 ASP n 1 167 ILE n 1 168 ARG n 1 169 MET n 1 170 ALA n 1 171 LEU n 1 172 ASP n 1 173 LEU n 1 174 GLY n 1 175 PHE n 1 176 THR n 1 177 MET n 1 178 LEU n 1 179 THR n 1 180 LEU n 1 181 ASP n 1 182 CYS n 1 183 SER n 1 184 GLU n 1 185 GLN n 1 186 ILE n 1 187 ASP n 1 188 ASN n 1 189 GLU n 1 190 ALA n 1 191 ALA n 1 192 GLN n 1 193 ALA n 1 194 GLY n 1 195 GLU n 1 196 SER n 1 197 GLU n 1 198 VAL n 1 199 LYS n 1 200 ARG n 1 201 LYS n 1 202 TYR n 1 203 GLU n 1 204 GLU n 1 205 LEU n 1 206 PRO n 1 207 GLU n 1 208 SER n 1 209 VAL n 1 210 ARG n 1 211 SER n 1 212 HIS n 1 213 TYR n 1 214 GLU n 1 215 ALA n 1 216 LYS n 1 217 TYR n 1 218 LEU n 1 219 ASP n 1 220 LYS n 1 221 THR n 1 222 PHE n 1 223 GLN n 1 224 VAL n 1 225 GLY n 1 226 PRO n 1 227 HIS n 1 228 ALA n 1 229 ILE n 1 230 HIS n 1 231 PHE n 1 232 ASP n 1 233 ALA n 1 234 ALA n 1 235 THR n 1 236 LEU n 1 237 MET n 1 238 ARG n 1 239 ASP n 1 240 VAL n 1 241 LEU n 1 242 VAL n 1 243 TYR n 1 244 ARG n 1 245 GLU n 1 246 ALA n 1 247 ILE n 1 248 GLN n 1 249 PHE n 1 250 MET n 1 251 ILE n 1 252 TYR n 1 253 ILE n 1 254 TYR n 1 255 GLU n 1 256 LYS n 1 257 TYR n 1 258 ILE n 1 259 GLN n 1 260 THR n 1 261 ALA n 1 262 GLY n 1 263 ARG n 1 264 ALA n 1 265 VAL n 1 266 ASP n 1 267 PHE n 1 268 GLU n 1 269 ILE n 1 270 SER n 1 271 ILE n 1 272 ASP n 1 273 GLU n 1 274 THR n 1 275 LEU n 1 276 THR n 1 277 PRO n 1 278 THR n 1 279 ALA n 1 280 PRO n 1 281 GLY n 1 282 SER n 1 283 HIS n 1 284 PHE n 1 285 LEU n 1 286 VAL n 1 287 ALA n 1 288 SER n 1 289 GLU n 1 290 LEU n 1 291 ILE n 1 292 GLY n 1 293 LYS n 1 294 ASN n 1 295 VAL n 1 296 ASP n 1 297 ILE n 1 298 PHE n 1 299 SER n 1 300 MET n 1 301 ALA n 1 302 PRO n 1 303 ARG n 1 304 PHE n 1 305 ILE n 1 306 GLY n 1 307 GLU n 1 308 PHE n 1 309 GLN n 1 310 LYS n 1 311 GLY n 1 312 ILE n 1 313 ASP n 1 314 TYR n 1 315 ILE n 1 316 GLY n 1 317 ASP n 1 318 ILE n 1 319 ALA n 1 320 GLN n 1 321 PHE n 1 322 GLU n 1 323 ARG n 1 324 GLU n 1 325 LEU n 1 326 ALA n 1 327 VAL n 1 328 HIS n 1 329 ALA n 1 330 ALA n 1 331 ILE n 1 332 ALA n 1 333 ASP n 1 334 ARG n 1 335 PHE n 1 336 GLY n 1 337 TYR n 1 338 LYS n 1 339 LEU n 1 340 SER n 1 341 ILE n 1 342 HIS n 1 343 SER n 1 344 GLY n 1 345 ALA n 1 346 ASP n 1 347 LYS n 1 348 PHE n 1 349 SER n 1 350 VAL n 1 351 PHE n 1 352 ALA n 1 353 LEU n 1 354 VAL n 1 355 GLY n 1 356 ARG n 1 357 TYR n 1 358 THR n 1 359 ASN n 1 360 GLY n 1 361 ARG n 1 362 PHE n 1 363 HIS n 1 364 VAL n 1 365 LYS n 1 366 THR n 1 367 ALA n 1 368 GLY n 1 369 THR n 1 370 ASN n 1 371 TRP n 1 372 LEU n 1 373 GLU n 1 374 ALA n 1 375 VAL n 1 376 ARG n 1 377 ILE n 1 378 VAL n 1 379 ALA n 1 380 LYS n 1 381 THR n 1 382 ASN n 1 383 PRO n 1 384 GLY n 1 385 LEU n 1 386 TYR n 1 387 ARG n 1 388 ARG n 1 389 MET n 1 390 HIS n 1 391 GLN n 1 392 TYR n 1 393 ALA n 1 394 LEU n 1 395 GLU n 1 396 HIS n 1 397 PHE n 1 398 GLU n 1 399 GLU n 1 400 ALA n 1 401 THR n 1 402 ALA n 1 403 TYR n 1 404 TYR n 1 405 HIS n 1 406 VAL n 1 407 THR n 1 408 THR n 1 409 ASN n 1 410 LEU n 1 411 ASN n 1 412 ASN n 1 413 ILE n 1 414 ARG n 1 415 PRO n 1 416 LEU n 1 417 ALA n 1 418 ASP n 1 419 VAL n 1 420 SER n 1 421 ASP n 1 422 GLU n 1 423 GLU n 1 424 LEU n 1 425 PRO n 1 426 SER n 1 427 TYR n 1 428 MET n 1 429 ASN n 1 430 GLU n 1 431 ASN n 1 432 ASP n 1 433 ALA n 1 434 ARG n 1 435 GLN n 1 436 LEU n 1 437 LEU n 1 438 HIS n 1 439 ILE n 1 440 THR n 1 441 TYR n 1 442 GLY n 1 443 LEU n 1 444 LEU n 1 445 LEU n 1 446 GLN n 1 447 ALA n 1 448 LYS n 1 449 LYS n 1 450 ASP n 1 451 ASP n 1 452 GLY n 1 453 SER n 1 454 SER n 1 455 LEU n 1 456 PHE n 1 457 ARG n 1 458 ASP n 1 459 GLU n 1 460 PHE n 1 461 PHE n 1 462 ARG n 1 463 THR n 1 464 LEU n 1 465 SER n 1 466 GLU n 1 467 ARG n 1 468 GLU n 1 469 GLU n 1 470 ASP n 1 471 TYR n 1 472 GLU n 1 473 ALA n 1 474 ALA n 1 475 LEU n 1 476 ARG n 1 477 SER n 1 478 HIS n 1 479 ILE n 1 480 GLY n 1 481 LYS n 1 482 HIS n 1 483 LEU n 1 484 ASP n 1 485 LEU n 1 486 LEU n 1 487 GLY n 1 488 VAL n 1 489 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 489 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cohnella laeviribosi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 380174 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6ILA _struct_ref.pdbx_db_accession 6ILA _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ILA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 489 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6ILA _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 489 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 489 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ILA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Potassium sodium tartrate, 20% (w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97940 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97940 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 49.3986650862 _reflns.entry_id 6ILA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.675 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14303 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.000 _reflns.pdbx_Rmerge_I_obs 0.177 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 4.214 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.192 _reflns.pdbx_Rpim_I_all 0.075 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.690 2.740 ? ? ? ? ? ? 691 96.800 ? ? ? ? 0.496 ? ? ? ? ? ? ? ? 4.500 ? 1.021 ? ? 0.557 0.248 ? 1 1 0.720 ? ? 2.740 2.790 ? ? ? ? ? ? 708 99.200 ? ? ? ? 0.473 ? ? ? ? ? ? ? ? 4.700 ? 1.021 ? ? 0.529 0.232 ? 2 1 0.772 ? ? 2.790 2.840 ? ? ? ? ? ? 705 98.900 ? ? ? ? 0.464 ? ? ? ? ? ? ? ? 5.000 ? 1.040 ? ? 0.516 0.223 ? 3 1 0.795 ? ? 2.840 2.900 ? ? ? ? ? ? 709 99.600 ? ? ? ? 0.435 ? ? ? ? ? ? ? ? 5.200 ? 1.058 ? ? 0.483 0.206 ? 4 1 0.832 ? ? 2.900 2.960 ? ? ? ? ? ? 699 99.300 ? ? ? ? 0.413 ? ? ? ? ? ? ? ? 5.300 ? 1.181 ? ? 0.457 0.192 ? 5 1 0.906 ? ? 2.960 3.030 ? ? ? ? ? ? 703 99.700 ? ? ? ? 0.367 ? ? ? ? ? ? ? ? 5.600 ? 1.407 ? ? 0.404 0.167 ? 6 1 0.918 ? ? 3.030 3.110 ? ? ? ? ? ? 703 99.700 ? ? ? ? 0.345 ? ? ? ? ? ? ? ? 5.700 ? 1.565 ? ? 0.379 0.155 ? 7 1 0.902 ? ? 3.110 3.190 ? ? ? ? ? ? 705 99.900 ? ? ? ? 0.326 ? ? ? ? ? ? ? ? 5.800 ? 1.613 ? ? 0.357 0.145 ? 8 1 0.929 ? ? 3.190 3.280 ? ? ? ? ? ? 736 100.000 ? ? ? ? 0.269 ? ? ? ? ? ? ? ? 5.900 ? 2.122 ? ? 0.294 0.117 ? 9 1 0.944 ? ? 3.280 3.390 ? ? ? ? ? ? 689 99.900 ? ? ? ? 0.246 ? ? ? ? ? ? ? ? 6.100 ? 2.555 ? ? 0.268 0.105 ? 10 1 0.959 ? ? 3.390 3.510 ? ? ? ? ? ? 731 99.900 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? 6.100 ? 3.072 ? ? 0.261 0.103 ? 11 1 0.952 ? ? 3.510 3.650 ? ? ? ? ? ? 706 99.700 ? ? ? ? 0.208 ? ? ? ? ? ? ? ? 6.300 ? 3.598 ? ? 0.227 0.088 ? 12 1 0.964 ? ? 3.650 3.820 ? ? ? ? ? ? 717 100.000 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? 6.400 ? 4.140 ? ? 0.208 0.081 ? 13 1 0.979 ? ? 3.820 4.020 ? ? ? ? ? ? 727 100.000 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 6.500 ? 4.766 ? ? 0.191 0.073 ? 14 1 0.976 ? ? 4.020 4.270 ? ? ? ? ? ? 714 100.000 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 6.700 ? 5.598 ? ? 0.181 0.068 ? 15 1 0.982 ? ? 4.270 4.600 ? ? ? ? ? ? 709 99.900 ? ? ? ? 0.154 ? ? ? ? ? ? ? ? 6.700 ? 6.473 ? ? 0.166 0.063 ? 16 1 0.982 ? ? 4.600 5.060 ? ? ? ? ? ? 721 100.000 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 6.700 ? 7.217 ? ? 0.165 0.062 ? 17 1 0.977 ? ? 5.060 5.790 ? ? ? ? ? ? 731 99.900 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 6.700 ? 6.117 ? ? 0.158 0.059 ? 18 1 0.983 ? ? 5.790 7.290 ? ? ? ? ? ? 741 100.000 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 6.600 ? 5.462 ? ? 0.142 0.053 ? 19 1 0.987 ? ? 7.290 50.000 ? ? ? ? ? ? 758 99.600 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 6.900 ? 14.858 ? ? 0.118 0.044 ? 20 1 0.982 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 46.1622809606 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ILA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.690 _refine.ls_d_res_low 36.3491624588 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14299 _refine.ls_number_reflns_R_free 676 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4034133921 _refine.ls_percent_reflns_R_free 4.7276033289 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20316698807 _refine.ls_R_factor_R_free 0.284320448633 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19913973908 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36875042987 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6ILB _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.9210339953 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.420136682428 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.690 _refine_hist.d_res_low 36.3491624588 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 3927 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3885 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00868641295374 ? 3979 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.995900626976 ? 5367 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0504375633963 ? 576 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00548051466974 ? 704 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 7.35630477692 ? 2373 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.690 2.8815 . . 129 2536 92.6634214186 . . . 0.375309358418 . 0.2544589044 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8815 3.1713 . . 117 2731 99.5804195804 . . . 0.305951481975 . 0.230372523043 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1713 3.6298 . . 136 2779 99.8971898561 . . . 0.318844371469 . 0.200841147416 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6298 4.5718 . . 141 2750 99.9654218534 . . . 0.259200715475 . 0.171891849045 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5718 36.349 . . 153 2827 99.8659517426 . . . 0.259964833481 . 0.194934296846 . . . . . . . . . . . # _struct.entry_id 6ILA _struct.title 'Two Glycerol complexed Crystal structure of fructuronate-tagaturonate epimerase UxaE from Cohnella laeviribosi' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ILA _struct_keywords.text 'UxaE, TIM-barrel, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? ALA A 12 ? SER A 5 ALA A 12 1 ? 8 HELX_P HELX_P2 AA2 PRO A 19 ? ARG A 22 ? PRO A 19 ARG A 22 5 ? 4 HELX_P HELX_P3 AA3 GLY A 47 ? LEU A 53 ? GLY A 47 LEU A 53 1 ? 7 HELX_P HELX_P4 AA4 SER A 67 ? PHE A 78 ? SER A 67 PHE A 78 1 ? 12 HELX_P HELX_P5 AA5 PRO A 79 ? VAL A 82 ? PRO A 79 VAL A 82 5 ? 4 HELX_P HELX_P6 AA6 ALA A 102 ? ARG A 111 ? ALA A 102 ARG A 111 1 ? 10 HELX_P HELX_P7 AA7 ILE A 124 ? GLY A 131 ? ILE A 124 GLY A 131 1 ? 8 HELX_P HELX_P8 AA8 ASP A 133 ? GLY A 149 ? ASP A 133 GLY A 149 1 ? 17 HELX_P HELX_P9 AA9 LYS A 163 ? LEU A 173 ? LYS A 163 LEU A 173 1 ? 11 HELX_P HELX_P10 AB1 ASP A 187 ? ALA A 193 ? ASP A 187 ALA A 193 1 ? 7 HELX_P HELX_P11 AB2 GLY A 194 ? GLU A 203 ? GLY A 194 GLU A 203 1 ? 10 HELX_P HELX_P12 AB3 PRO A 206 ? LEU A 218 ? PRO A 206 LEU A 218 1 ? 13 HELX_P HELX_P13 AB4 ASP A 232 ? TYR A 257 ? ASP A 232 TYR A 257 1 ? 26 HELX_P HELX_P14 AB5 ALA A 279 ? LYS A 293 ? ALA A 279 LYS A 293 1 ? 15 HELX_P HELX_P15 AB6 ASP A 317 ? GLY A 336 ? ASP A 317 GLY A 336 1 ? 20 HELX_P HELX_P16 AB7 VAL A 350 ? THR A 358 ? VAL A 350 THR A 358 1 ? 9 HELX_P HELX_P17 AB8 ALA A 367 ? ASN A 382 ? ALA A 367 ASN A 382 1 ? 16 HELX_P HELX_P18 AB9 ASN A 382 ? GLU A 395 ? ASN A 382 GLU A 395 1 ? 14 HELX_P HELX_P19 AC1 HIS A 396 ? THR A 401 ? HIS A 396 THR A 401 1 ? 6 HELX_P HELX_P20 AC2 ASN A 409 ? ILE A 413 ? ASN A 409 ILE A 413 5 ? 5 HELX_P HELX_P21 AC3 PRO A 415 ? VAL A 419 ? PRO A 415 VAL A 419 5 ? 5 HELX_P HELX_P22 AC4 LEU A 424 ? ASN A 429 ? LEU A 424 ASN A 429 5 ? 6 HELX_P HELX_P23 AC5 GLU A 430 ? THR A 440 ? GLU A 430 THR A 440 1 ? 11 HELX_P HELX_P24 AC6 THR A 440 ? ALA A 447 ? THR A 440 ALA A 447 1 ? 8 HELX_P HELX_P25 AC7 PHE A 456 ? ARG A 467 ? PHE A 456 ARG A 467 1 ? 12 HELX_P HELX_P26 AC8 ARG A 467 ? GLY A 487 ? ARG A 467 GLY A 487 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 160 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 160 A ZN 503 1_555 ? ? ? ? ? ? ? 2.498 ? ? metalc2 metalc ? ? A HIS 342 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 342 A ZN 503 1_555 ? ? ? ? ? ? ? 2.631 ? ? metalc3 metalc ? ? B GOL . O2 ? ? ? 1_555 D ZN . ZN ? ? A GOL 501 A ZN 503 1_555 ? ? ? ? ? ? ? 2.567 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 9 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA3 5 6 ? parallel AA3 6 7 ? parallel AA3 7 8 ? parallel AA3 8 9 ? parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 16 ? VAL A 17 ? HIS A 16 VAL A 17 AA1 2 THR A 28 ? ALA A 35 ? THR A 28 ALA A 35 AA1 3 HIS A 23 ? SER A 25 ? HIS A 23 SER A 25 AA2 1 HIS A 16 ? VAL A 17 ? HIS A 16 VAL A 17 AA2 2 THR A 28 ? ALA A 35 ? THR A 28 ALA A 35 AA2 3 ARG A 38 ? GLU A 44 ? ARG A 38 GLU A 44 AA2 4 VAL A 61 ? GLU A 65 ? VAL A 61 GLU A 65 AA2 5 GLU A 56 ? ALA A 58 ? GLU A 56 ALA A 58 AA3 1 HIS A 116 ? ILE A 118 ? HIS A 116 ILE A 118 AA3 2 THR A 92 ? LEU A 95 ? THR A 92 LEU A 95 AA3 3 HIS A 363 ? THR A 366 ? HIS A 363 THR A 366 AA3 4 LYS A 338 ? ILE A 341 ? LYS A 338 ILE A 341 AA3 5 SER A 299 ? ALA A 301 ? SER A 299 ALA A 301 AA3 6 ASP A 266 ? SER A 270 ? ASP A 266 SER A 270 AA3 7 MET A 177 ? ASP A 181 ? MET A 177 ASP A 181 AA3 8 ALA A 156 ? LEU A 161 ? ALA A 156 LEU A 161 AA3 9 ALA A 120 ? SER A 123 ? ALA A 120 SER A 123 AA4 1 THR A 221 ? GLN A 223 ? THR A 221 GLN A 223 AA4 2 ALA A 228 ? HIS A 230 ? ALA A 228 HIS A 230 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 16 ? N HIS A 16 O LYS A 34 ? O LYS A 34 AA1 2 3 O THR A 28 ? O THR A 28 N SER A 25 ? N SER A 25 AA2 1 2 N HIS A 16 ? N HIS A 16 O LYS A 34 ? O LYS A 34 AA2 2 3 N ILE A 33 ? N ILE A 33 O TYR A 40 ? O TYR A 40 AA2 3 4 N LEU A 41 ? N LEU A 41 O CYS A 64 ? O CYS A 64 AA2 4 5 O LEU A 63 ? O LEU A 63 N GLU A 56 ? N GLU A 56 AA3 1 2 O ILE A 118 ? O ILE A 118 N ILE A 93 ? N ILE A 93 AA3 2 3 N GLY A 94 ? N GLY A 94 O VAL A 364 ? O VAL A 364 AA3 3 4 O HIS A 363 ? O HIS A 363 N ILE A 341 ? N ILE A 341 AA3 4 5 O SER A 340 ? O SER A 340 N MET A 300 ? N MET A 300 AA3 5 6 O SER A 299 ? O SER A 299 N ILE A 269 ? N ILE A 269 AA3 6 7 O ASP A 266 ? O ASP A 266 N LEU A 178 ? N LEU A 178 AA3 7 8 O THR A 179 ? O THR A 179 N LEU A 161 ? N LEU A 161 AA3 8 9 O ASP A 159 ? O ASP A 159 N GLN A 122 ? N GLN A 122 AA4 1 2 N PHE A 222 ? N PHE A 222 O ILE A 229 ? O ILE A 229 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 501 ? 8 'binding site for residue GOL A 501' AC2 Software A GOL 502 ? 10 'binding site for residue GOL A 502' AC3 Software A ZN 503 ? 5 'binding site for residue ZN A 503' AC4 Software A PO4 504 ? 9 'binding site for residue PO4 A 504' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 LYS A 310 ? LYS A 310 . ? 1_555 ? 2 AC1 8 HIS A 342 ? HIS A 342 . ? 1_555 ? 3 AC1 8 SER A 343 ? SER A 343 . ? 1_555 ? 4 AC1 8 GLY A 344 ? GLY A 344 . ? 1_555 ? 5 AC1 8 LYS A 365 ? LYS A 365 . ? 1_555 ? 6 AC1 8 GOL C . ? GOL A 502 . ? 1_555 ? 7 AC1 8 ZN D . ? ZN A 503 . ? 1_555 ? 8 AC1 8 PO4 E . ? PO4 A 504 . ? 1_555 ? 9 AC2 10 ARG A 98 ? ARG A 98 . ? 1_555 ? 10 AC2 10 SER A 123 ? SER A 123 . ? 1_555 ? 11 AC2 10 ARG A 125 ? ARG A 125 . ? 1_555 ? 12 AC2 10 GLU A 126 ? GLU A 126 . ? 1_555 ? 13 AC2 10 LYS A 310 ? LYS A 310 . ? 1_555 ? 14 AC2 10 ALA A 367 ? ALA A 367 . ? 1_555 ? 15 AC2 10 TYR A 404 ? TYR A 404 . ? 1_555 ? 16 AC2 10 TYR A 441 ? TYR A 441 . ? 1_555 ? 17 AC2 10 GOL B . ? GOL A 501 . ? 1_555 ? 18 AC2 10 ZN D . ? ZN A 503 . ? 1_555 ? 19 AC3 5 ASP A 159 ? ASP A 159 . ? 1_555 ? 20 AC3 5 HIS A 160 ? HIS A 160 . ? 1_555 ? 21 AC3 5 HIS A 342 ? HIS A 342 . ? 1_555 ? 22 AC3 5 GOL B . ? GOL A 501 . ? 1_555 ? 23 AC3 5 GOL C . ? GOL A 502 . ? 1_555 ? 24 AC4 9 LYS A 310 ? LYS A 310 . ? 1_555 ? 25 AC4 9 SER A 343 ? SER A 343 . ? 1_555 ? 26 AC4 9 ALA A 345 ? ALA A 345 . ? 1_555 ? 27 AC4 9 THR A 366 ? THR A 366 . ? 1_555 ? 28 AC4 9 ALA A 367 ? ALA A 367 . ? 1_555 ? 29 AC4 9 GLY A 368 ? GLY A 368 . ? 1_555 ? 30 AC4 9 THR A 369 ? THR A 369 . ? 1_555 ? 31 AC4 9 HIS A 438 ? HIS A 438 . ? 1_555 ? 32 AC4 9 GOL B . ? GOL A 501 . ? 1_555 ? # _atom_sites.entry_id 6ILA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007393 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001391 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019232 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013755 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N NI O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLN 4 4 4 GLN ALA A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 MET 177 177 177 MET MET A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 CYS 182 182 182 CYS CYS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 GLN 185 185 185 GLN GLN A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 TYR 213 213 213 TYR TYR A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 HIS 227 227 227 HIS HIS A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 PHE 231 231 231 PHE PHE A . n A 1 232 ASP 232 232 232 ASP ASP A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 MET 237 237 237 MET MET A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 TYR 243 243 243 TYR TYR A . n A 1 244 ARG 244 244 244 ARG ARG A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 PHE 249 249 249 PHE PHE A . n A 1 250 MET 250 250 250 MET MET A . n A 1 251 ILE 251 251 251 ILE ILE A . n A 1 252 TYR 252 252 252 TYR TYR A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 TYR 254 254 254 TYR TYR A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 GLN 259 259 259 GLN GLN A . n A 1 260 THR 260 260 260 THR THR A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 ARG 263 263 263 ARG ARG A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 ASP 266 266 266 ASP ASP A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 GLU 268 268 268 GLU GLU A . n A 1 269 ILE 269 269 269 ILE ILE A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 GLU 273 273 273 GLU GLU A . n A 1 274 THR 274 274 274 THR THR A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 THR 276 276 276 THR ALA A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 HIS 283 283 283 HIS HIS A . n A 1 284 PHE 284 284 284 PHE PHE A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 VAL 286 286 286 VAL VAL A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 GLU 289 289 289 GLU GLU A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 ILE 291 291 291 ILE ILE A . n A 1 292 GLY 292 292 292 GLY GLY A . n A 1 293 LYS 293 293 293 LYS LYS A . n A 1 294 ASN 294 294 294 ASN ASN A . n A 1 295 VAL 295 295 295 VAL VAL A . n A 1 296 ASP 296 296 296 ASP ASP A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 PHE 298 298 298 PHE PHE A . n A 1 299 SER 299 299 299 SER SER A . n A 1 300 MET 300 300 300 MET MET A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 PRO 302 302 302 PRO PRO A . n A 1 303 ARG 303 303 303 ARG ARG A . n A 1 304 PHE 304 304 304 PHE PHE A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 GLY 306 306 306 GLY GLY A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 PHE 308 308 308 PHE PHE A . n A 1 309 GLN 309 309 309 GLN GLN A . n A 1 310 LYS 310 310 310 LYS LYS A . n A 1 311 GLY 311 311 311 GLY GLY A . n A 1 312 ILE 312 312 312 ILE ILE A . n A 1 313 ASP 313 313 313 ASP ASP A . n A 1 314 TYR 314 314 314 TYR TYR A . n A 1 315 ILE 315 315 315 ILE ILE A . n A 1 316 GLY 316 316 316 GLY GLY A . n A 1 317 ASP 317 317 317 ASP ASP A . n A 1 318 ILE 318 318 318 ILE ILE A . n A 1 319 ALA 319 319 319 ALA ALA A . n A 1 320 GLN 320 320 320 GLN GLN A . n A 1 321 PHE 321 321 321 PHE PHE A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 ARG 323 323 323 ARG ARG A . n A 1 324 GLU 324 324 324 GLU GLU A . n A 1 325 LEU 325 325 325 LEU LEU A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 VAL 327 327 327 VAL VAL A . n A 1 328 HIS 328 328 328 HIS HIS A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 ALA 330 330 330 ALA ALA A . n A 1 331 ILE 331 331 331 ILE ILE A . n A 1 332 ALA 332 332 332 ALA ALA A . n A 1 333 ASP 333 333 333 ASP ASP A . n A 1 334 ARG 334 334 334 ARG ARG A . n A 1 335 PHE 335 335 335 PHE PHE A . n A 1 336 GLY 336 336 336 GLY GLY A . n A 1 337 TYR 337 337 337 TYR TYR A . n A 1 338 LYS 338 338 338 LYS LYS A . n A 1 339 LEU 339 339 339 LEU LEU A . n A 1 340 SER 340 340 340 SER SER A . n A 1 341 ILE 341 341 341 ILE ILE A . n A 1 342 HIS 342 342 342 HIS HIS A . n A 1 343 SER 343 343 343 SER SER A . n A 1 344 GLY 344 344 344 GLY GLY A . n A 1 345 ALA 345 345 345 ALA ALA A . n A 1 346 ASP 346 346 346 ASP ASP A . n A 1 347 LYS 347 347 347 LYS LYS A . n A 1 348 PHE 348 348 348 PHE PHE A . n A 1 349 SER 349 349 349 SER SER A . n A 1 350 VAL 350 350 350 VAL VAL A . n A 1 351 PHE 351 351 351 PHE PHE A . n A 1 352 ALA 352 352 352 ALA ALA A . n A 1 353 LEU 353 353 353 LEU LEU A . n A 1 354 VAL 354 354 354 VAL VAL A . n A 1 355 GLY 355 355 355 GLY GLY A . n A 1 356 ARG 356 356 356 ARG ARG A . n A 1 357 TYR 357 357 357 TYR TYR A . n A 1 358 THR 358 358 358 THR THR A . n A 1 359 ASN 359 359 359 ASN ASN A . n A 1 360 GLY 360 360 360 GLY GLY A . n A 1 361 ARG 361 361 361 ARG ARG A . n A 1 362 PHE 362 362 362 PHE PHE A . n A 1 363 HIS 363 363 363 HIS HIS A . n A 1 364 VAL 364 364 364 VAL VAL A . n A 1 365 LYS 365 365 365 LYS LYS A . n A 1 366 THR 366 366 366 THR THR A . n A 1 367 ALA 367 367 367 ALA ALA A . n A 1 368 GLY 368 368 368 GLY GLY A . n A 1 369 THR 369 369 369 THR THR A . n A 1 370 ASN 370 370 370 ASN ASN A . n A 1 371 TRP 371 371 371 TRP TRP A . n A 1 372 LEU 372 372 372 LEU LEU A . n A 1 373 GLU 373 373 373 GLU GLU A . n A 1 374 ALA 374 374 374 ALA ALA A . n A 1 375 VAL 375 375 375 VAL VAL A . n A 1 376 ARG 376 376 376 ARG ARG A . n A 1 377 ILE 377 377 377 ILE ILE A . n A 1 378 VAL 378 378 378 VAL VAL A . n A 1 379 ALA 379 379 379 ALA ALA A . n A 1 380 LYS 380 380 380 LYS LYS A . n A 1 381 THR 381 381 381 THR THR A . n A 1 382 ASN 382 382 382 ASN ASN A . n A 1 383 PRO 383 383 383 PRO PRO A . n A 1 384 GLY 384 384 384 GLY GLY A . n A 1 385 LEU 385 385 385 LEU LEU A . n A 1 386 TYR 386 386 386 TYR TYR A . n A 1 387 ARG 387 387 387 ARG ARG A . n A 1 388 ARG 388 388 388 ARG ARG A . n A 1 389 MET 389 389 389 MET MET A . n A 1 390 HIS 390 390 390 HIS HIS A . n A 1 391 GLN 391 391 391 GLN GLN A . n A 1 392 TYR 392 392 392 TYR TYR A . n A 1 393 ALA 393 393 393 ALA ALA A . n A 1 394 LEU 394 394 394 LEU LEU A . n A 1 395 GLU 395 395 395 GLU GLU A . n A 1 396 HIS 396 396 396 HIS HIS A . n A 1 397 PHE 397 397 397 PHE PHE A . n A 1 398 GLU 398 398 398 GLU GLU A . n A 1 399 GLU 399 399 399 GLU GLU A . n A 1 400 ALA 400 400 400 ALA ALA A . n A 1 401 THR 401 401 401 THR THR A . n A 1 402 ALA 402 402 402 ALA ALA A . n A 1 403 TYR 403 403 403 TYR TYR A . n A 1 404 TYR 404 404 404 TYR TYR A . n A 1 405 HIS 405 405 405 HIS HIS A . n A 1 406 VAL 406 406 406 VAL VAL A . n A 1 407 THR 407 407 407 THR THR A . n A 1 408 THR 408 408 408 THR THR A . n A 1 409 ASN 409 409 409 ASN ASN A . n A 1 410 LEU 410 410 410 LEU LEU A . n A 1 411 ASN 411 411 411 ASN ASN A . n A 1 412 ASN 412 412 412 ASN ASN A . n A 1 413 ILE 413 413 413 ILE ILE A . n A 1 414 ARG 414 414 414 ARG ARG A . n A 1 415 PRO 415 415 415 PRO PRO A . n A 1 416 LEU 416 416 416 LEU LEU A . n A 1 417 ALA 417 417 417 ALA ALA A . n A 1 418 ASP 418 418 418 ASP ASP A . n A 1 419 VAL 419 419 419 VAL VAL A . n A 1 420 SER 420 420 420 SER SER A . n A 1 421 ASP 421 421 421 ASP ASP A . n A 1 422 GLU 422 422 422 GLU GLU A . n A 1 423 GLU 423 423 423 GLU GLU A . n A 1 424 LEU 424 424 424 LEU LEU A . n A 1 425 PRO 425 425 425 PRO PRO A . n A 1 426 SER 426 426 426 SER SER A . n A 1 427 TYR 427 427 427 TYR TYR A . n A 1 428 MET 428 428 428 MET MET A . n A 1 429 ASN 429 429 429 ASN ASN A . n A 1 430 GLU 430 430 430 GLU GLU A . n A 1 431 ASN 431 431 431 ASN ASN A . n A 1 432 ASP 432 432 432 ASP ASP A . n A 1 433 ALA 433 433 433 ALA ALA A . n A 1 434 ARG 434 434 434 ARG ARG A . n A 1 435 GLN 435 435 435 GLN GLN A . n A 1 436 LEU 436 436 436 LEU LEU A . n A 1 437 LEU 437 437 437 LEU LEU A . n A 1 438 HIS 438 438 438 HIS HIS A . n A 1 439 ILE 439 439 439 ILE ILE A . n A 1 440 THR 440 440 440 THR THR A . n A 1 441 TYR 441 441 441 TYR TYR A . n A 1 442 GLY 442 442 442 GLY GLY A . n A 1 443 LEU 443 443 443 LEU LEU A . n A 1 444 LEU 444 444 444 LEU LEU A . n A 1 445 LEU 445 445 445 LEU LEU A . n A 1 446 GLN 446 446 446 GLN GLN A . n A 1 447 ALA 447 447 447 ALA ALA A . n A 1 448 LYS 448 448 448 LYS LYS A . n A 1 449 LYS 449 449 449 LYS LYS A . n A 1 450 ASP 450 450 450 ASP ASP A . n A 1 451 ASP 451 451 451 ASP ASP A . n A 1 452 GLY 452 452 452 GLY GLY A . n A 1 453 SER 453 453 453 SER SER A . n A 1 454 SER 454 454 454 SER SER A . n A 1 455 LEU 455 455 455 LEU LEU A . n A 1 456 PHE 456 456 456 PHE PHE A . n A 1 457 ARG 457 457 457 ARG ARG A . n A 1 458 ASP 458 458 458 ASP ASP A . n A 1 459 GLU 459 459 459 GLU GLU A . n A 1 460 PHE 460 460 460 PHE PHE A . n A 1 461 PHE 461 461 461 PHE PHE A . n A 1 462 ARG 462 462 462 ARG ARG A . n A 1 463 THR 463 463 463 THR THR A . n A 1 464 LEU 464 464 464 LEU LEU A . n A 1 465 SER 465 465 465 SER SER A . n A 1 466 GLU 466 466 466 GLU GLU A . n A 1 467 ARG 467 467 467 ARG ARG A . n A 1 468 GLU 468 468 468 GLU GLU A . n A 1 469 GLU 469 469 469 GLU GLU A . n A 1 470 ASP 470 470 470 ASP ASP A . n A 1 471 TYR 471 471 471 TYR TYR A . n A 1 472 GLU 472 472 472 GLU GLU A . n A 1 473 ALA 473 473 473 ALA ALA A . n A 1 474 ALA 474 474 474 ALA ALA A . n A 1 475 LEU 475 475 475 LEU LEU A . n A 1 476 ARG 476 476 476 ARG ARG A . n A 1 477 SER 477 477 477 SER SER A . n A 1 478 HIS 478 478 478 HIS HIS A . n A 1 479 ILE 479 479 479 ILE ILE A . n A 1 480 GLY 480 480 480 GLY GLY A . n A 1 481 LYS 481 481 481 LYS LYS A . n A 1 482 HIS 482 482 482 HIS HIS A . n A 1 483 LEU 483 483 483 LEU LEU A . n A 1 484 ASP 484 484 484 ASP ASP A . n A 1 485 LEU 485 485 485 LEU LEU A . n A 1 486 LEU 486 486 486 LEU LEU A . n A 1 487 GLY 487 487 487 GLY GLY A . n A 1 488 VAL 488 488 488 VAL VAL A . n A 1 489 LYS 489 489 489 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 501 1 GOL GOL A . C 2 GOL 1 502 2 GOL GOL A . D 3 ZN 1 503 1 ZN ZN A . E 4 PO4 1 504 1 PO4 PO4 A . F 5 HOH 1 601 21 HOH HOH A . F 5 HOH 2 602 22 HOH HOH A . F 5 HOH 3 603 6 HOH HOH A . F 5 HOH 4 604 1 HOH HOH A . F 5 HOH 5 605 8 HOH HOH A . F 5 HOH 6 606 2 HOH HOH A . F 5 HOH 7 607 5 HOH HOH A . F 5 HOH 8 608 4 HOH HOH A . F 5 HOH 9 609 3 HOH HOH A . F 5 HOH 10 610 10 HOH HOH A . F 5 HOH 11 611 14 HOH HOH A . F 5 HOH 12 612 15 HOH HOH A . F 5 HOH 13 613 11 HOH HOH A . F 5 HOH 14 614 17 HOH HOH A . F 5 HOH 15 615 13 HOH HOH A . F 5 HOH 16 616 16 HOH HOH A . F 5 HOH 17 617 20 HOH HOH A . F 5 HOH 18 618 7 HOH HOH A . F 5 HOH 19 619 12 HOH HOH A . F 5 HOH 20 620 18 HOH HOH A . F 5 HOH 21 621 9 HOH HOH A . F 5 HOH 22 622 19 HOH HOH A . F 5 HOH 23 623 24 HOH HOH A . F 5 HOH 24 624 23 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -17 ? 1 'SSA (A^2)' 20690 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 160 ? A HIS 160 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 ND1 ? A HIS 342 ? A HIS 342 ? 1_555 84.9 ? 2 NE2 ? A HIS 160 ? A HIS 160 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 O2 ? B GOL . ? A GOL 501 ? 1_555 161.3 ? 3 ND1 ? A HIS 342 ? A HIS 342 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 O2 ? B GOL . ? A GOL 501 ? 1_555 82.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-10-23 2 'Structure model' 2 0 2020-03-25 3 'Structure model' 2 1 2023-11-22 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Ligand identity' 'The sulfate ion is changed to a phosphate ion.' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Author supporting evidence' 4 2 'Structure model' 'Data collection' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Non-polymer description' 7 2 'Structure model' Other 8 2 'Structure model' 'Refinement description' 9 2 'Structure model' 'Structure summary' 10 3 'Structure model' 'Data collection' 11 3 'Structure model' 'Database references' 12 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' atom_sites 3 2 'Structure model' atom_type 4 2 'Structure model' cell 5 2 'Structure model' chem_comp 6 2 'Structure model' entity 7 2 'Structure model' pdbx_distant_solvent_atoms 8 2 'Structure model' pdbx_entity_instance_feature 9 2 'Structure model' pdbx_entity_nonpoly 10 2 'Structure model' pdbx_entry_details 11 2 'Structure model' pdbx_nonpoly_scheme 12 2 'Structure model' pdbx_poly_seq_scheme 13 2 'Structure model' pdbx_struct_conn_angle 14 2 'Structure model' pdbx_struct_sheet_hbond 15 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 16 2 'Structure model' pdbx_validate_close_contact 17 2 'Structure model' pdbx_validate_torsion 18 2 'Structure model' refine 19 2 'Structure model' refine_hist 20 2 'Structure model' refine_ls_restr 21 2 'Structure model' refine_ls_shell 22 2 'Structure model' reflns 23 2 'Structure model' software 24 2 'Structure model' struct_asym 25 2 'Structure model' struct_conf 26 2 'Structure model' struct_conn 27 2 'Structure model' struct_sheet_range 28 2 'Structure model' struct_site 29 2 'Structure model' struct_site_gen 30 2 'Structure model' symmetry 31 3 'Structure model' chem_comp_atom 32 3 'Structure model' chem_comp_bond 33 3 'Structure model' database_2 34 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_sites.fract_transf_matrix[2][1]' 2 2 'Structure model' '_atom_sites.fract_transf_matrix[3][2]' 3 2 'Structure model' '_cell.angle_beta' 4 2 'Structure model' '_cell.volume' 5 2 'Structure model' '_chem_comp.formula' 6 2 'Structure model' '_chem_comp.formula_weight' 7 2 'Structure model' '_chem_comp.id' 8 2 'Structure model' '_chem_comp.mon_nstd_flag' 9 2 'Structure model' '_chem_comp.name' 10 2 'Structure model' '_chem_comp.type' 11 2 'Structure model' '_entity.formula_weight' 12 2 'Structure model' '_entity.pdbx_description' 13 2 'Structure model' '_entity.pdbx_number_of_molecules' 14 2 'Structure model' '_pdbx_entity_nonpoly.comp_id' 15 2 'Structure model' '_pdbx_entity_nonpoly.name' 16 2 'Structure model' '_pdbx_entry_details.has_ligand_of_interest' 17 2 'Structure model' '_pdbx_poly_seq_scheme.auth_mon_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 20 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 22 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 23 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 24 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 25 2 'Structure model' '_pdbx_struct_conn_angle.value' 26 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_comp_id' 27 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_seq_id' 28 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_comp_id' 29 2 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 30 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_comp_id' 31 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 32 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_comp_id' 33 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 34 2 'Structure model' '_refine.B_iso_max' 35 2 'Structure model' '_refine.B_iso_mean' 36 2 'Structure model' '_refine.B_iso_min' 37 2 'Structure model' '_refine.aniso_B[1][1]' 38 2 'Structure model' '_refine.aniso_B[1][2]' 39 2 'Structure model' '_refine.aniso_B[1][3]' 40 2 'Structure model' '_refine.aniso_B[2][2]' 41 2 'Structure model' '_refine.aniso_B[2][3]' 42 2 'Structure model' '_refine.aniso_B[3][3]' 43 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc' 44 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc_free' 45 2 'Structure model' '_refine.details' 46 2 'Structure model' '_refine.ls_R_factor_R_free' 47 2 'Structure model' '_refine.ls_R_factor_R_work' 48 2 'Structure model' '_refine.ls_R_factor_obs' 49 2 'Structure model' '_refine.ls_d_res_high' 50 2 'Structure model' '_refine.ls_d_res_low' 51 2 'Structure model' '_refine.ls_number_reflns_R_free' 52 2 'Structure model' '_refine.ls_number_reflns_obs' 53 2 'Structure model' '_refine.ls_percent_reflns_R_free' 54 2 'Structure model' '_refine.ls_percent_reflns_obs' 55 2 'Structure model' '_refine.overall_SU_B' 56 2 'Structure model' '_refine.overall_SU_ML' 57 2 'Structure model' '_refine.pdbx_ls_sigma_F' 58 2 'Structure model' '_refine.pdbx_overall_ESU_R_Free' 59 2 'Structure model' '_refine.pdbx_overall_phase_error' 60 2 'Structure model' '_refine.pdbx_solvent_ion_probe_radii' 61 2 'Structure model' '_refine.pdbx_solvent_shrinkage_radii' 62 2 'Structure model' '_refine.pdbx_solvent_vdw_probe_radii' 63 2 'Structure model' '_refine_hist.cycle_id' 64 2 'Structure model' '_refine_hist.d_res_high' 65 2 'Structure model' '_refine_hist.d_res_low' 66 2 'Structure model' '_refine_hist.number_atoms_solvent' 67 2 'Structure model' '_refine_hist.number_atoms_total' 68 2 'Structure model' '_refine_hist.pdbx_B_iso_mean_ligand' 69 2 'Structure model' '_refine_hist.pdbx_B_iso_mean_solvent' 70 2 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 71 2 'Structure model' '_refine_hist.pdbx_number_residues_total' 72 2 'Structure model' '_reflns.B_iso_Wilson_estimate' 73 2 'Structure model' '_reflns.d_resolution_high' 74 2 'Structure model' '_struct_asym.entity_id' 75 2 'Structure model' '_struct_conf.beg_auth_comp_id' 76 2 'Structure model' '_struct_conf.beg_auth_seq_id' 77 2 'Structure model' '_struct_conf.beg_label_comp_id' 78 2 'Structure model' '_struct_conf.beg_label_seq_id' 79 2 'Structure model' '_struct_conf.end_auth_comp_id' 80 2 'Structure model' '_struct_conf.end_auth_seq_id' 81 2 'Structure model' '_struct_conf.end_label_comp_id' 82 2 'Structure model' '_struct_conf.end_label_seq_id' 83 2 'Structure model' '_struct_conf.pdbx_PDB_helix_length' 84 2 'Structure model' '_struct_conn.pdbx_dist_value' 85 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 86 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 87 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 88 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 89 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 90 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 91 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 92 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 93 2 'Structure model' '_struct_sheet_range.beg_auth_comp_id' 94 2 'Structure model' '_struct_sheet_range.beg_auth_seq_id' 95 2 'Structure model' '_struct_sheet_range.beg_label_comp_id' 96 2 'Structure model' '_struct_sheet_range.beg_label_seq_id' 97 2 'Structure model' '_struct_sheet_range.end_auth_comp_id' 98 2 'Structure model' '_struct_sheet_range.end_auth_seq_id' 99 2 'Structure model' '_struct_sheet_range.end_label_comp_id' 100 2 'Structure model' '_struct_sheet_range.end_label_seq_id' 101 2 'Structure model' '_struct_site.details' 102 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 103 2 'Structure model' '_struct_site.pdbx_num_residues' 104 2 'Structure model' '_symmetry.space_group_name_Hall' 105 3 'Structure model' '_database_2.pdbx_DOI' 106 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 6 # _pdbx_entry_details.entry_id 6ILA _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'WP_019005805.1 for sequence reference' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH1 A ARG 71 ? ? OD1 A ASN 75 ? ? 2.08 2 1 O A HOH 601 ? ? O A HOH 615 ? ? 2.09 3 1 NZ A LYS 293 ? ? O A HOH 601 ? ? 2.09 4 1 OE1 A GLU 307 ? ? NE2 A HIS 405 ? ? 2.10 5 1 OD1 A ASP 266 ? ? O A HOH 602 ? ? 2.11 6 1 N A PHE 86 ? ? O A HOH 602 ? ? 2.12 7 1 N A GLY 87 ? ? O A HOH 602 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 4 ? ? -67.44 23.95 2 1 GLU A 26 ? ? 45.85 -110.24 3 1 ALA A 58 ? ? 162.68 117.08 4 1 ASP A 59 ? ? 66.96 -153.62 5 1 LEU A 66 ? ? -64.46 82.20 6 1 GLN A 89 ? ? -109.37 61.69 7 1 LYS A 162 ? ? -132.61 -45.00 8 1 GLU A 197 ? ? 159.49 -54.49 9 1 ASP A 219 ? ? 58.46 8.45 10 1 VAL A 224 ? ? -77.75 -110.83 11 1 ILE A 271 ? ? -141.29 18.58 12 1 ALA A 367 ? ? -161.71 -64.55 13 1 GLU A 399 ? ? -45.96 -72.22 14 1 ALA A 417 ? ? -59.59 -5.06 15 1 ARG A 467 ? ? -103.77 41.73 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 624 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.94 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 4 ? CG ? A GLN 4 CG 2 1 Y 1 A GLN 4 ? CD ? A GLN 4 CD 3 1 Y 1 A GLN 4 ? OE1 ? A GLN 4 OE1 4 1 Y 1 A GLN 4 ? NE2 ? A GLN 4 NE2 5 1 Y 1 A THR 276 ? OG1 ? A THR 276 OG1 6 1 Y 1 A THR 276 ? CG2 ? A THR 276 CG2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PO4 P P N N 287 PO4 O1 O N N 288 PO4 O2 O N N 289 PO4 O3 O N N 290 PO4 O4 O N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 ZN ZN ZN N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PO4 P O1 doub N N 273 PO4 P O2 sing N N 274 PO4 P O3 sing N N 275 PO4 P O4 sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 PO4 ? ? PO4 ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'ZINC ION' ZN 4 'PHOSPHATE ION' PO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6ILB _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #