data_6IR0 # _entry.id 6IR0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6IR0 pdb_00006ir0 10.2210/pdb6ir0/pdb WWPDB D_1300009755 ? ? BMRB 36217 ? 10.13018/BMR36217 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-13 2 'Structure model' 1 1 2020-01-29 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' struct_conn 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 16 3 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6IR0 _pdbx_database_status.recvd_initial_deposition_date 2018-11-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Zinc finger domain of the human DTX protein' _pdbx_database_related.db_id 36217 _pdbx_database_related.content_type unspecified # _audit_author.name 'Miyamoto, K.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-7792-0900 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 28 _citation.language ? _citation.page_first 1151 _citation.page_last 1156 _citation.title 'Zinc finger domain of the human DTX protein adopts a unique RING fold.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3610 _citation.pdbx_database_id_PubMed 30927328 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Fujiwara, Y.' 2 ? primary 'Saito, K.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Probable E3 ubiquitin-protein ligase DTX2' 8180.370 1 2.3.2.27 I36L 'Zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein deltex-2,hDTX2,RING finger protein 58,RING-type E3 ubiquitin transferase DTX2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NYTEELKVPPDEDCIICMEKLSTASGYSDVTDSKALGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKT _entity_poly.pdbx_seq_one_letter_code_can NYTEELKVPPDEDCIICMEKLSTASGYSDVTDSKALGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 TYR n 1 3 THR n 1 4 GLU n 1 5 GLU n 1 6 LEU n 1 7 LYS n 1 8 VAL n 1 9 PRO n 1 10 PRO n 1 11 ASP n 1 12 GLU n 1 13 ASP n 1 14 CYS n 1 15 ILE n 1 16 ILE n 1 17 CYS n 1 18 MET n 1 19 GLU n 1 20 LYS n 1 21 LEU n 1 22 SER n 1 23 THR n 1 24 ALA n 1 25 SER n 1 26 GLY n 1 27 TYR n 1 28 SER n 1 29 ASP n 1 30 VAL n 1 31 THR n 1 32 ASP n 1 33 SER n 1 34 LYS n 1 35 ALA n 1 36 LEU n 1 37 GLY n 1 38 SER n 1 39 LEU n 1 40 ALA n 1 41 VAL n 1 42 GLY n 1 43 HIS n 1 44 LEU n 1 45 THR n 1 46 LYS n 1 47 CYS n 1 48 SER n 1 49 HIS n 1 50 ALA n 1 51 PHE n 1 52 HIS n 1 53 LEU n 1 54 LEU n 1 55 CYS n 1 56 LEU n 1 57 LEU n 1 58 ALA n 1 59 MET n 1 60 TYR n 1 61 CYS n 1 62 ASN n 1 63 GLY n 1 64 ASN n 1 65 LYS n 1 66 ASP n 1 67 GLY n 1 68 SER n 1 69 LEU n 1 70 GLN n 1 71 CYS n 1 72 PRO n 1 73 SER n 1 74 CYS n 1 75 LYS n 1 76 THR n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 76 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 202 401 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6IR0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6IR0 _struct.title 'Zinc finger domain of the human DTX protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6IR0 _struct_keywords.text 'RING finger, DTX, zinc finger, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DTX2_HUMAN _struct_ref.pdbx_db_accession Q86UW9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NYTEELKVPPDEDCIICMEKLSTASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKT _struct_ref.pdbx_align_begin 399 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6IR0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q86UW9 _struct_ref_seq.db_align_beg 399 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 474 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6IR0 _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 36 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q86UW9 _struct_ref_seq_dif.db_mon_id ILE _struct_ref_seq_dif.pdbx_seq_db_seq_num 434 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 36 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4800 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'Cysteine modification' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 25 ? VAL A 30 ? SER A 25 VAL A 30 5 ? 6 HELX_P HELX_P2 AA2 LEU A 53 ? TYR A 60 ? LEU A 53 TYR A 60 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc3 metalc ? ? A CYS 47 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 47 A ZN 202 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc4 metalc ? ? A HIS 49 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 49 A ZN 202 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc5 metalc ? ? A HIS 52 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 52 A ZN 201 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc6 metalc ? ? A CYS 55 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 55 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc7 metalc ? ? A CYS 71 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 71 A ZN 202 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc8 metalc ? ? A CYS 74 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 74 A ZN 202 1_555 ? ? ? ? ? ? ? 2.327 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 117.1 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 52 ? A HIS 52 ? 1_555 85.8 ? 3 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 52 ? A HIS 52 ? 1_555 97.9 ? 4 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 118.3 ? 5 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 118.3 ? 6 ND1 ? A HIS 52 ? A HIS 52 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 110.9 ? 7 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 110.7 ? 8 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 71 ? A CYS 71 ? 1_555 93.7 ? 9 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 71 ? A CYS 71 ? 1_555 100.9 ? 10 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 74 ? A CYS 74 ? 1_555 115.4 ? 11 ND1 ? A HIS 49 ? A HIS 49 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 74 ? A CYS 74 ? 1_555 118.2 ? 12 SG ? A CYS 71 ? A CYS 71 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 SG ? A CYS 74 ? A CYS 74 ? 1_555 114.3 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 41 ? LEU A 44 ? VAL A 41 LEU A 44 AA1 2 HIS A 49 ? HIS A 52 ? HIS A 49 HIS A 52 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 44 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 44 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id HIS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 49 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id HIS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 49 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 5 'binding site for residue ZN A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 14 ? CYS A 14 . ? 1_555 ? 2 AC1 5 CYS A 17 ? CYS A 17 . ? 1_555 ? 3 AC1 5 GLY A 26 ? GLY A 26 . ? 1_555 ? 4 AC1 5 HIS A 52 ? HIS A 52 . ? 1_555 ? 5 AC1 5 CYS A 55 ? CYS A 55 . ? 1_555 ? 6 AC2 5 CYS A 47 ? CYS A 47 . ? 1_555 ? 7 AC2 5 HIS A 49 ? HIS A 49 . ? 1_555 ? 8 AC2 5 CYS A 71 ? CYS A 71 . ? 1_555 ? 9 AC2 5 SER A 73 ? SER A 73 . ? 1_555 ? 10 AC2 5 CYS A 74 ? CYS A 74 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 4 ? ? -38.21 92.79 2 1 LYS A 7 ? ? -37.33 -28.26 3 1 PRO A 10 ? ? -69.75 -163.84 4 1 ASP A 13 ? ? 64.29 136.27 5 1 CYS A 14 ? ? -49.88 166.59 6 1 THR A 23 ? ? -55.11 -93.53 7 1 ALA A 24 ? ? 178.91 -176.78 8 1 SER A 38 ? ? 177.31 48.18 9 1 LEU A 39 ? ? -177.69 49.49 10 1 LEU A 44 ? ? -37.95 125.57 11 1 SER A 48 ? ? 82.75 71.52 12 1 HIS A 49 ? ? -117.86 -99.98 13 1 ALA A 50 ? ? 158.99 133.00 14 1 PHE A 51 ? ? -176.58 148.62 15 1 HIS A 52 ? ? -48.55 99.51 16 1 ASN A 64 ? ? 35.81 53.95 17 1 ASP A 66 ? ? -157.01 -47.65 18 1 SER A 68 ? ? -152.50 -95.55 19 1 LEU A 69 ? ? 177.32 174.83 20 1 SER A 73 ? ? -57.95 -71.79 21 2 GLU A 5 ? ? -35.06 133.47 22 2 LYS A 7 ? ? -37.31 -28.34 23 2 ASP A 11 ? ? 83.00 10.62 24 2 GLU A 12 ? ? -67.89 -93.24 25 2 ASP A 13 ? ? 161.21 115.89 26 2 CYS A 14 ? ? -39.44 144.30 27 2 ILE A 16 ? ? -84.71 -71.89 28 2 THR A 23 ? ? -58.32 -90.43 29 2 SER A 28 ? ? -38.31 -28.20 30 2 THR A 31 ? ? -115.99 64.81 31 2 ALA A 35 ? ? -134.47 -41.64 32 2 LEU A 36 ? ? -90.95 -78.40 33 2 SER A 38 ? ? -40.11 94.28 34 2 LEU A 39 ? ? 161.31 -21.72 35 2 SER A 48 ? ? 83.42 39.12 36 2 PHE A 51 ? ? 169.88 173.84 37 2 ASN A 64 ? ? 34.43 45.87 38 2 SER A 68 ? ? -164.26 -73.14 39 2 LEU A 69 ? ? -179.89 -178.30 40 2 PRO A 72 ? ? -69.75 0.37 41 3 GLU A 5 ? ? -39.26 145.39 42 3 PRO A 10 ? ? -69.84 -163.83 43 3 ASP A 13 ? ? 65.39 128.69 44 3 CYS A 14 ? ? -40.60 157.47 45 3 ALA A 24 ? ? 75.27 170.78 46 3 SER A 33 ? ? 42.01 -92.37 47 3 LYS A 34 ? ? -176.70 -56.54 48 3 SER A 38 ? ? 49.61 26.36 49 3 SER A 48 ? ? 83.13 31.28 50 3 PHE A 51 ? ? 171.11 -179.18 51 3 LEU A 54 ? ? -56.11 -70.00 52 3 ASN A 64 ? ? 34.43 51.25 53 3 LYS A 65 ? ? -102.20 70.26 54 3 SER A 68 ? ? -176.12 -91.71 55 4 GLU A 5 ? ? -35.35 144.61 56 4 ASP A 11 ? ? 82.94 18.19 57 4 ASP A 13 ? ? 82.95 120.34 58 4 CYS A 14 ? ? -45.66 162.23 59 4 ILE A 16 ? ? -80.70 -70.70 60 4 THR A 23 ? ? -65.37 -90.93 61 4 ALA A 24 ? ? 175.32 155.61 62 4 VAL A 30 ? ? -108.62 -61.94 63 4 THR A 31 ? ? -46.81 -82.21 64 4 ASP A 32 ? ? 80.35 -12.45 65 4 SER A 33 ? ? 56.14 168.01 66 4 LYS A 34 ? ? -147.28 50.80 67 4 ALA A 35 ? ? 168.46 -29.06 68 4 LEU A 36 ? ? -91.99 -60.52 69 4 SER A 38 ? ? -76.02 49.12 70 4 LEU A 39 ? ? -179.56 40.74 71 4 SER A 48 ? ? 83.26 42.98 72 4 PHE A 51 ? ? 170.49 169.60 73 4 ASN A 64 ? ? 34.27 45.88 74 4 SER A 68 ? ? -155.62 -94.55 75 5 PRO A 10 ? ? -69.70 -165.39 76 5 ASP A 11 ? ? -101.87 40.82 77 5 ASP A 13 ? ? 61.58 132.76 78 5 CYS A 14 ? ? -39.01 159.12 79 5 MET A 18 ? ? 35.10 69.06 80 5 THR A 23 ? ? -96.24 34.33 81 5 ALA A 24 ? ? 49.92 178.58 82 5 THR A 31 ? ? -34.78 -78.67 83 5 ASP A 32 ? ? 75.38 -5.40 84 5 SER A 33 ? ? 45.31 -171.31 85 5 LYS A 34 ? ? -148.27 40.62 86 5 ALA A 35 ? ? -176.35 -43.02 87 5 LEU A 36 ? ? -74.21 -164.38 88 5 CYS A 47 ? ? -143.42 -44.34 89 5 SER A 48 ? ? 83.02 74.66 90 5 ALA A 50 ? ? 73.98 137.92 91 5 HIS A 52 ? ? -60.07 98.79 92 5 LEU A 57 ? ? -37.89 -28.36 93 5 CYS A 61 ? ? -35.16 -31.77 94 5 ASN A 62 ? ? -97.53 -71.74 95 5 ASN A 64 ? ? 57.18 -80.12 96 5 LYS A 65 ? ? 67.56 122.18 97 5 ASP A 66 ? ? -178.93 -47.96 98 5 SER A 68 ? ? -158.62 -73.17 99 5 LEU A 69 ? ? 178.60 -172.91 100 5 SER A 73 ? ? -98.61 -87.37 101 5 CYS A 74 ? ? -88.18 32.89 102 5 LYS A 75 ? ? 34.27 33.54 103 6 PRO A 10 ? ? -69.75 -90.84 104 6 ASP A 11 ? ? 168.70 33.96 105 6 ASP A 13 ? ? 78.51 127.54 106 6 ILE A 16 ? ? -64.87 -70.01 107 6 MET A 18 ? ? 34.58 70.85 108 6 THR A 23 ? ? -61.26 -92.81 109 6 SER A 38 ? ? 162.59 -34.23 110 6 SER A 48 ? ? 84.01 33.46 111 6 PHE A 51 ? ? 172.64 -171.14 112 6 LEU A 53 ? ? -40.99 -70.12 113 6 ASN A 64 ? ? 40.66 -92.06 114 6 SER A 68 ? ? -175.52 -63.39 115 6 LEU A 69 ? ? -175.66 -173.69 116 7 PRO A 10 ? ? -69.79 -163.81 117 7 ASP A 13 ? ? 65.00 129.09 118 7 CYS A 14 ? ? -42.79 160.08 119 7 ILE A 16 ? ? -82.14 -70.66 120 7 THR A 23 ? ? -83.31 35.18 121 7 ALA A 24 ? ? 51.48 178.99 122 7 SER A 33 ? ? -48.55 174.98 123 7 SER A 48 ? ? 83.37 38.86 124 7 PHE A 51 ? ? 171.22 -170.39 125 7 ASN A 62 ? ? -97.45 -63.61 126 7 ASN A 64 ? ? 40.18 -92.11 127 7 SER A 68 ? ? -171.33 -71.05 128 7 LEU A 69 ? ? -177.71 -174.69 129 8 GLU A 5 ? ? -35.08 109.41 130 8 PRO A 10 ? ? -69.78 -90.88 131 8 ASP A 11 ? ? 174.77 52.28 132 8 GLU A 12 ? ? -144.05 -97.48 133 8 ASP A 13 ? ? 159.68 144.40 134 8 ILE A 16 ? ? -83.52 -70.75 135 8 THR A 23 ? ? -51.60 -89.01 136 8 ALA A 24 ? ? 174.22 171.01 137 8 VAL A 30 ? ? -163.95 84.79 138 8 SER A 33 ? ? -101.46 -65.60 139 8 LYS A 34 ? ? 39.89 39.85 140 8 ALA A 35 ? ? -136.88 -48.39 141 8 LEU A 39 ? ? 174.31 -27.50 142 8 LEU A 44 ? ? -53.34 89.62 143 8 SER A 48 ? ? 84.53 34.34 144 8 PHE A 51 ? ? 174.63 -169.83 145 8 ASN A 62 ? ? -97.46 -61.73 146 8 ASN A 64 ? ? -52.97 84.83 147 8 SER A 68 ? ? -165.83 -95.22 148 8 LEU A 69 ? ? -171.97 -173.70 149 8 LYS A 75 ? ? 63.03 80.82 150 9 VAL A 8 ? ? 172.35 162.34 151 9 PRO A 10 ? ? -69.71 -90.94 152 9 ASP A 11 ? ? 175.57 41.84 153 9 GLU A 12 ? ? -112.97 -96.96 154 9 ASP A 13 ? ? 159.81 145.99 155 9 ILE A 16 ? ? -79.64 -70.56 156 9 MET A 18 ? ? 37.72 38.37 157 9 ALA A 24 ? ? 56.80 -178.54 158 9 ASP A 32 ? ? -107.42 52.80 159 9 LEU A 36 ? ? -74.19 -70.52 160 9 LEU A 39 ? ? -155.15 38.28 161 9 THR A 45 ? ? -38.54 -35.39 162 9 SER A 48 ? ? 79.62 73.82 163 9 ALA A 50 ? ? 83.74 133.06 164 9 LEU A 54 ? ? -57.90 -70.20 165 9 ASN A 62 ? ? -97.51 -67.54 166 9 ASN A 64 ? ? 38.94 -92.54 167 9 LYS A 65 ? ? 70.22 119.13 168 9 ASP A 66 ? ? 177.73 -32.23 169 9 SER A 68 ? ? -157.30 -94.89 170 9 SER A 73 ? ? -86.31 -87.79 171 10 PRO A 10 ? ? -69.71 -163.80 172 10 GLU A 12 ? ? -170.82 -33.20 173 10 ASP A 13 ? ? 65.97 142.59 174 10 CYS A 14 ? ? -40.40 161.79 175 10 MET A 18 ? ? 38.67 73.85 176 10 THR A 23 ? ? -54.87 -89.86 177 10 ALA A 24 ? ? 172.70 158.43 178 10 SER A 28 ? ? -39.74 -29.35 179 10 VAL A 30 ? ? -176.80 90.28 180 10 THR A 31 ? ? -100.61 -74.92 181 10 ASP A 32 ? ? 162.69 35.51 182 10 SER A 38 ? ? 61.08 174.91 183 10 LEU A 39 ? ? 82.85 29.97 184 10 THR A 45 ? ? -35.48 -31.10 185 10 SER A 48 ? ? 72.07 79.16 186 10 ALA A 50 ? ? 84.31 138.58 187 10 PHE A 51 ? ? -169.98 -159.88 188 10 ASN A 64 ? ? 34.39 56.66 189 10 LYS A 65 ? ? -86.05 31.50 190 10 SER A 68 ? ? -145.77 -71.95 191 10 LEU A 69 ? ? 178.44 -172.58 192 10 SER A 73 ? ? -82.62 -71.77 193 10 LYS A 75 ? ? 34.64 32.74 194 11 GLU A 5 ? ? -35.04 141.18 195 11 VAL A 8 ? ? -170.40 138.80 196 11 PRO A 10 ? ? -69.68 -165.52 197 11 ASP A 11 ? ? -114.87 54.01 198 11 ASP A 13 ? ? 76.55 127.84 199 11 THR A 23 ? ? -51.17 -89.46 200 11 ALA A 24 ? ? 175.40 179.34 201 11 THR A 31 ? ? -50.14 -71.37 202 11 ASP A 32 ? ? 82.91 -50.88 203 11 SER A 33 ? ? 34.40 86.33 204 11 LEU A 39 ? ? -145.93 28.31 205 11 SER A 48 ? ? 82.96 67.12 206 11 HIS A 49 ? ? -114.36 -101.14 207 11 ALA A 50 ? ? 159.18 131.87 208 11 PHE A 51 ? ? -170.29 -172.29 209 11 LEU A 53 ? ? -35.99 -32.89 210 11 ASP A 66 ? ? -159.81 -46.45 211 11 SER A 68 ? ? 160.87 -94.99 212 11 LEU A 69 ? ? -174.21 -173.40 213 11 SER A 73 ? ? -78.00 -71.76 214 11 LYS A 75 ? ? 41.05 24.46 215 12 GLU A 5 ? ? -36.31 145.37 216 12 PRO A 10 ? ? -69.72 -163.90 217 12 ASP A 13 ? ? 75.13 127.37 218 12 ILE A 16 ? ? -77.89 -70.49 219 12 ALA A 24 ? ? 53.51 -179.73 220 12 SER A 28 ? ? -36.85 -39.82 221 12 VAL A 30 ? ? -83.06 -71.91 222 12 THR A 31 ? ? -46.31 -74.87 223 12 ASP A 32 ? ? 82.28 -40.29 224 12 SER A 33 ? ? 32.72 -148.83 225 12 LYS A 34 ? ? -154.29 -44.69 226 12 ALA A 35 ? ? -59.35 -72.91 227 12 LEU A 39 ? ? -165.95 48.51 228 12 THR A 45 ? ? -34.53 -32.51 229 12 SER A 48 ? ? 82.70 64.62 230 12 HIS A 49 ? ? -109.10 -100.35 231 12 ALA A 50 ? ? 159.59 135.61 232 12 LEU A 53 ? ? -36.23 -30.20 233 12 ASN A 64 ? ? 38.04 50.82 234 12 SER A 68 ? ? -165.59 -86.19 235 12 LEU A 69 ? ? -177.73 -173.37 236 12 PRO A 72 ? ? -69.79 3.09 237 12 SER A 73 ? ? -97.94 -84.08 238 12 LYS A 75 ? ? 33.98 42.38 239 13 GLU A 5 ? ? -35.05 133.00 240 13 LYS A 7 ? ? -34.21 -34.57 241 13 ASP A 11 ? ? 82.84 38.11 242 13 GLU A 12 ? ? -103.67 -94.65 243 13 ASP A 13 ? ? 163.50 116.73 244 13 CYS A 14 ? ? -37.77 156.54 245 13 ILE A 16 ? ? -80.29 -70.12 246 13 MET A 18 ? ? 35.32 71.17 247 13 THR A 23 ? ? -83.07 -91.03 248 13 SER A 28 ? ? -39.23 -25.96 249 13 VAL A 30 ? ? -167.92 90.32 250 13 ASP A 32 ? ? 82.44 34.41 251 13 ALA A 35 ? ? 160.95 95.67 252 13 SER A 48 ? ? 83.29 42.24 253 13 PHE A 51 ? ? 173.04 175.54 254 13 LEU A 53 ? ? -36.28 -70.14 255 13 ASN A 64 ? ? 44.35 -90.59 256 13 SER A 68 ? ? -166.53 -67.39 257 13 LEU A 69 ? ? -171.63 -173.71 258 14 GLU A 5 ? ? -35.05 143.52 259 14 LYS A 7 ? ? -38.31 -26.76 260 14 PRO A 10 ? ? -69.79 -163.76 261 14 ASP A 11 ? ? -143.39 49.22 262 14 GLU A 12 ? ? -115.61 -96.25 263 14 ASP A 13 ? ? 160.23 136.14 264 14 CYS A 14 ? ? -47.79 162.79 265 14 ALA A 24 ? ? 51.15 176.17 266 14 THR A 31 ? ? -58.88 -152.84 267 14 ASP A 32 ? ? -153.31 -37.02 268 14 SER A 33 ? ? -37.37 94.85 269 14 SER A 38 ? ? 37.45 78.60 270 14 LEU A 39 ? ? 177.22 -28.76 271 14 LEU A 44 ? ? -63.01 95.06 272 14 THR A 45 ? ? -38.70 -25.94 273 14 SER A 48 ? ? 74.41 74.55 274 14 ALA A 50 ? ? 71.20 143.07 275 14 PHE A 51 ? ? -178.99 -169.08 276 14 LEU A 53 ? ? -35.30 -30.89 277 14 ASP A 66 ? ? -164.07 -37.57 278 14 SER A 68 ? ? 168.65 -92.81 279 14 LEU A 69 ? ? 178.11 -173.34 280 14 SER A 73 ? ? -82.13 -82.56 281 14 CYS A 74 ? ? -99.85 34.14 282 14 LYS A 75 ? ? 37.00 43.56 283 15 GLU A 5 ? ? -34.97 133.57 284 15 LYS A 7 ? ? 83.43 -34.11 285 15 PRO A 10 ? ? -69.70 -164.72 286 15 ASP A 13 ? ? 61.55 130.93 287 15 CYS A 14 ? ? -44.15 160.62 288 15 THR A 23 ? ? -51.30 -89.58 289 15 ALA A 24 ? ? 170.21 164.91 290 15 THR A 31 ? ? -110.35 -93.43 291 15 ASP A 32 ? ? 80.86 -5.75 292 15 SER A 33 ? ? 42.96 -91.44 293 15 LYS A 34 ? ? 164.07 -23.12 294 15 LEU A 39 ? ? -177.65 57.23 295 15 LEU A 44 ? ? -33.59 120.38 296 15 SER A 48 ? ? 60.39 70.66 297 15 HIS A 49 ? ? -115.79 -101.46 298 15 ALA A 50 ? ? 158.32 133.18 299 15 LEU A 53 ? ? -36.30 -29.86 300 15 CYS A 55 ? ? -35.61 -38.31 301 15 LEU A 57 ? ? -39.59 -25.56 302 15 ASN A 64 ? ? 38.77 36.19 303 15 SER A 68 ? ? -155.06 -87.30 304 15 SER A 73 ? ? -82.13 -77.87 305 15 LYS A 75 ? ? 37.74 31.14 306 16 GLU A 4 ? ? -34.37 93.39 307 16 LYS A 7 ? ? -34.29 -35.36 308 16 PRO A 10 ? ? -69.72 -163.87 309 16 ASP A 13 ? ? 65.40 128.83 310 16 CYS A 14 ? ? -41.58 163.92 311 16 ILE A 16 ? ? -76.13 -70.10 312 16 MET A 18 ? ? 35.58 51.69 313 16 ALA A 24 ? ? 60.07 170.75 314 16 VAL A 30 ? ? -129.35 -53.47 315 16 SER A 33 ? ? -40.60 102.27 316 16 LYS A 34 ? ? -88.39 30.43 317 16 LEU A 39 ? ? -153.25 23.13 318 16 LEU A 44 ? ? -36.49 139.35 319 16 THR A 45 ? ? -82.58 37.49 320 16 LYS A 46 ? ? -125.46 -57.22 321 16 SER A 48 ? ? 83.04 26.43 322 16 PHE A 51 ? ? 170.38 -170.61 323 16 LEU A 53 ? ? -35.93 -30.51 324 16 ASN A 64 ? ? 63.28 -74.33 325 16 LYS A 65 ? ? 41.79 82.39 326 16 ASP A 66 ? ? -151.09 59.13 327 16 SER A 68 ? ? -168.71 -96.48 328 16 LEU A 69 ? ? -172.55 -174.05 329 16 SER A 73 ? ? -68.73 -81.09 330 17 GLU A 5 ? ? -35.15 137.01 331 17 LYS A 7 ? ? 81.38 -14.61 332 17 PRO A 10 ? ? -69.77 -163.83 333 17 ASP A 11 ? ? -119.81 63.66 334 17 ASP A 13 ? ? 65.38 123.19 335 17 CYS A 14 ? ? -46.02 153.03 336 17 THR A 23 ? ? -55.64 -89.64 337 17 ALA A 24 ? ? 171.78 177.56 338 17 VAL A 30 ? ? -165.69 86.69 339 17 ASP A 32 ? ? 82.29 16.41 340 17 ALA A 35 ? ? -121.68 -50.50 341 17 LEU A 39 ? ? -164.15 49.97 342 17 LEU A 44 ? ? -34.27 118.62 343 17 SER A 48 ? ? 81.89 68.16 344 17 HIS A 49 ? ? -115.59 -103.33 345 17 ALA A 50 ? ? 158.98 134.75 346 17 LEU A 53 ? ? -36.14 -30.39 347 17 LEU A 54 ? ? -73.48 -70.16 348 17 ASN A 62 ? ? -97.64 -70.38 349 17 ASN A 64 ? ? 34.23 -92.51 350 17 LYS A 65 ? ? 52.32 71.89 351 17 SER A 68 ? ? 165.66 -83.63 352 17 LEU A 69 ? ? 177.46 -172.40 353 17 SER A 73 ? ? -81.28 -81.84 354 17 LYS A 75 ? ? 37.19 31.95 355 18 GLU A 5 ? ? -47.38 157.69 356 18 LYS A 7 ? ? -37.32 -28.40 357 18 PRO A 10 ? ? -69.81 -163.87 358 18 ASP A 11 ? ? -116.52 60.28 359 18 ASP A 13 ? ? 65.21 131.74 360 18 ILE A 16 ? ? -78.88 -70.21 361 18 LYS A 20 ? ? -34.39 139.65 362 18 ALA A 24 ? ? 54.70 168.82 363 18 SER A 33 ? ? -37.73 156.82 364 18 ALA A 35 ? ? -151.73 -53.65 365 18 LEU A 36 ? ? -66.89 -70.38 366 18 SER A 38 ? ? 161.02 -20.83 367 18 HIS A 43 ? ? -154.48 79.66 368 18 LEU A 44 ? ? -34.61 109.68 369 18 SER A 48 ? ? 83.33 40.02 370 18 PHE A 51 ? ? 167.36 166.38 371 18 LEU A 57 ? ? -37.30 -28.33 372 18 ASN A 64 ? ? 34.12 57.73 373 18 ASP A 66 ? ? -155.33 -36.47 374 18 SER A 68 ? ? -150.21 -89.57 375 18 LEU A 69 ? ? -172.00 -179.65 376 19 GLU A 5 ? ? -38.97 145.50 377 19 PRO A 10 ? ? -69.79 -90.84 378 19 ASP A 11 ? ? 163.13 35.37 379 19 ASP A 13 ? ? 64.88 129.66 380 19 CYS A 14 ? ? -42.12 163.11 381 19 MET A 18 ? ? 35.27 43.78 382 19 THR A 23 ? ? -83.97 31.98 383 19 ALA A 24 ? ? 56.28 176.36 384 19 THR A 31 ? ? -41.02 91.90 385 19 ALA A 35 ? ? -158.45 -36.22 386 19 LEU A 39 ? ? -177.42 56.59 387 19 ALA A 40 ? ? -161.27 92.32 388 19 SER A 48 ? ? 66.24 83.23 389 19 ALA A 50 ? ? 84.84 138.64 390 19 PHE A 51 ? ? -170.70 -157.14 391 19 LEU A 53 ? ? -35.87 -33.87 392 19 TYR A 60 ? ? -47.55 -19.90 393 19 ASN A 62 ? ? -97.48 -63.65 394 19 ASN A 64 ? ? 34.34 46.45 395 19 SER A 68 ? ? -154.97 -74.19 396 19 LEU A 69 ? ? 176.47 -173.64 397 19 LYS A 75 ? ? 48.90 18.50 398 20 GLU A 4 ? ? -34.05 93.23 399 20 LYS A 7 ? ? -36.91 -28.94 400 20 PRO A 10 ? ? -69.70 -163.98 401 20 GLU A 12 ? ? -120.78 -97.82 402 20 ASP A 13 ? ? 159.51 149.11 403 20 ILE A 16 ? ? -76.80 -70.78 404 20 ALA A 24 ? ? 80.50 -176.89 405 20 VAL A 30 ? ? -103.68 -80.98 406 20 THR A 31 ? ? -44.84 102.58 407 20 LEU A 39 ? ? -149.90 52.90 408 20 LEU A 44 ? ? -38.02 132.62 409 20 SER A 48 ? ? 59.16 72.94 410 20 HIS A 49 ? ? -117.29 -101.11 411 20 ALA A 50 ? ? 158.79 130.88 412 20 LEU A 54 ? ? -56.87 -70.06 413 20 ASN A 64 ? ? 69.88 -69.28 414 20 LYS A 65 ? ? 34.34 87.47 415 20 ASP A 66 ? ? -160.95 57.41 416 20 SER A 68 ? ? -168.26 -98.03 417 20 LEU A 69 ? ? -172.33 -174.01 418 20 PRO A 72 ? ? -69.86 3.92 419 20 SER A 73 ? ? -100.69 -72.22 420 20 LYS A 75 ? ? 33.65 34.74 # _pdbx_nmr_ensemble.entry_id 6IR0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6IR0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM U-13C, 15N Zinc finger domain of the human DTX protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'zinc finger' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Zinc finger domain of the human DTX protein' _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'U-13C, 15N' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 5 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type NOESY _pdbx_nmr_exptl.spectrometer_id 2 _pdbx_nmr_exptl.sample_state isotropic # _pdbx_nmr_refine.entry_id 6IR0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'ver. 2.1' _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 4 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TYR N N N N 291 TYR CA C N S 292 TYR C C N N 293 TYR O O N N 294 TYR CB C N N 295 TYR CG C Y N 296 TYR CD1 C Y N 297 TYR CD2 C Y N 298 TYR CE1 C Y N 299 TYR CE2 C Y N 300 TYR CZ C Y N 301 TYR OH O N N 302 TYR OXT O N N 303 TYR H H N N 304 TYR H2 H N N 305 TYR HA H N N 306 TYR HB2 H N N 307 TYR HB3 H N N 308 TYR HD1 H N N 309 TYR HD2 H N N 310 TYR HE1 H N N 311 TYR HE2 H N N 312 TYR HH H N N 313 TYR HXT H N N 314 VAL N N N N 315 VAL CA C N S 316 VAL C C N N 317 VAL O O N N 318 VAL CB C N N 319 VAL CG1 C N N 320 VAL CG2 C N N 321 VAL OXT O N N 322 VAL H H N N 323 VAL H2 H N N 324 VAL HA H N N 325 VAL HB H N N 326 VAL HG11 H N N 327 VAL HG12 H N N 328 VAL HG13 H N N 329 VAL HG21 H N N 330 VAL HG22 H N N 331 VAL HG23 H N N 332 VAL HXT H N N 333 ZN ZN ZN N N 334 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PHE N CA sing N N 209 PHE N H sing N N 210 PHE N H2 sing N N 211 PHE CA C sing N N 212 PHE CA CB sing N N 213 PHE CA HA sing N N 214 PHE C O doub N N 215 PHE C OXT sing N N 216 PHE CB CG sing N N 217 PHE CB HB2 sing N N 218 PHE CB HB3 sing N N 219 PHE CG CD1 doub Y N 220 PHE CG CD2 sing Y N 221 PHE CD1 CE1 sing Y N 222 PHE CD1 HD1 sing N N 223 PHE CD2 CE2 doub Y N 224 PHE CD2 HD2 sing N N 225 PHE CE1 CZ doub Y N 226 PHE CE1 HE1 sing N N 227 PHE CE2 CZ sing Y N 228 PHE CE2 HE2 sing N N 229 PHE CZ HZ sing N N 230 PHE OXT HXT sing N N 231 PRO N CA sing N N 232 PRO N CD sing N N 233 PRO N H sing N N 234 PRO CA C sing N N 235 PRO CA CB sing N N 236 PRO CA HA sing N N 237 PRO C O doub N N 238 PRO C OXT sing N N 239 PRO CB CG sing N N 240 PRO CB HB2 sing N N 241 PRO CB HB3 sing N N 242 PRO CG CD sing N N 243 PRO CG HG2 sing N N 244 PRO CG HG3 sing N N 245 PRO CD HD2 sing N N 246 PRO CD HD3 sing N N 247 PRO OXT HXT sing N N 248 SER N CA sing N N 249 SER N H sing N N 250 SER N H2 sing N N 251 SER CA C sing N N 252 SER CA CB sing N N 253 SER CA HA sing N N 254 SER C O doub N N 255 SER C OXT sing N N 256 SER CB OG sing N N 257 SER CB HB2 sing N N 258 SER CB HB3 sing N N 259 SER OG HG sing N N 260 SER OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_nmr_spectrometer.spectrometer_id 2 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6IR0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_