data_6JHU # _entry.id 6JHU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JHU pdb_00006jhu 10.2210/pdb6jhu/pdb WWPDB D_1300011063 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JHU _pdbx_database_status.recvd_initial_deposition_date 2019-02-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rajak, M.' 1 0000-0001-9756-5355 'Patel, A.' 2 0000-0001-6134-7794 'Sundd, M.' 3 0000-0002-5611-0861 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_id_ASTM ABCRE6 _citation.journal_id_CSD ? _citation.journal_id_ISSN 1399-0047 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 77 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Leishmania major biotin protein ligase forms a unique cross-handshake dimer' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798321001418 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rajak, M.' 1 0000-0001-9756-5355 primary 'Bhatnagar, S.' 2 ? primary 'Pandey, S.' 3 ? primary 'Kumar, S.' 4 ? primary 'Verma, S.' 5 ? primary 'Patel, A.K.' 6 0000-0001-6134-7794 primary 'Sundd, M.' 7 0000-0002-5611-0861 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 104.569 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6JHU _cell.details ? _cell.formula_units_Z ? _cell.length_a 116.848 _cell.length_a_esd ? _cell.length_b 46.621 _cell.length_b_esd ? _cell.length_c 54.573 _cell.length_c_esd ? _cell.volume 287731.024 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JHU _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Biotin/lipoate protein ligase-like protein' 30560.057 1 6.3.4.15 ? ? ? 2 non-polymer syn BIOTINYL-5-AMP 573.517 1 ? ? ? ? 3 non-polymer nat 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 18 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMPAHCPPNIHFLEEVTSTMDVARTMRATAGGKAFAVVAAEQTAGRGTGGRTWTSPKGNLY MTVGVPQLGQPPCLKEELVPVLPLICGLACRRAVLEVLHLDGALAKASVAADAAKAVATKWPNDIIYNHKKIGGTLIESD GDYLIIGIGMNIAVAPQMTDAGREATMINTIAEDFGVKSCPPRDLANAIWCHLFDICSSPEWTRELVIESFDKVMDKSLK LHKRLPGGRDPEELTAVSLNSWGHLKVRHADGTVEDLSAEYLF ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMPAHCPPNIHFLEEVTSTMDVARTMRATAGGKAFAVVAAEQTAGRGTGGRTWTSPKGNLY MTVGVPQLGQPPCLKEELVPVLPLICGLACRRAVLEVLHLDGALAKASVAADAAKAVATKWPNDIIYNHKKIGGTLIESD GDYLIIGIGMNIAVAPQMTDAGREATMINTIAEDFGVKSCPPRDLANAIWCHLFDICSSPEWTRELVIESFDKVMDKSLK LHKRLPGGRDPEELTAVSLNSWGHLKVRHADGTVEDLSAEYLF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 PRO n 1 23 ALA n 1 24 HIS n 1 25 CYS n 1 26 PRO n 1 27 PRO n 1 28 ASN n 1 29 ILE n 1 30 HIS n 1 31 PHE n 1 32 LEU n 1 33 GLU n 1 34 GLU n 1 35 VAL n 1 36 THR n 1 37 SER n 1 38 THR n 1 39 MET n 1 40 ASP n 1 41 VAL n 1 42 ALA n 1 43 ARG n 1 44 THR n 1 45 MET n 1 46 ARG n 1 47 ALA n 1 48 THR n 1 49 ALA n 1 50 GLY n 1 51 GLY n 1 52 LYS n 1 53 ALA n 1 54 PHE n 1 55 ALA n 1 56 VAL n 1 57 VAL n 1 58 ALA n 1 59 ALA n 1 60 GLU n 1 61 GLN n 1 62 THR n 1 63 ALA n 1 64 GLY n 1 65 ARG n 1 66 GLY n 1 67 THR n 1 68 GLY n 1 69 GLY n 1 70 ARG n 1 71 THR n 1 72 TRP n 1 73 THR n 1 74 SER n 1 75 PRO n 1 76 LYS n 1 77 GLY n 1 78 ASN n 1 79 LEU n 1 80 TYR n 1 81 MET n 1 82 THR n 1 83 VAL n 1 84 GLY n 1 85 VAL n 1 86 PRO n 1 87 GLN n 1 88 LEU n 1 89 GLY n 1 90 GLN n 1 91 PRO n 1 92 PRO n 1 93 CYS n 1 94 LEU n 1 95 LYS n 1 96 GLU n 1 97 GLU n 1 98 LEU n 1 99 VAL n 1 100 PRO n 1 101 VAL n 1 102 LEU n 1 103 PRO n 1 104 LEU n 1 105 ILE n 1 106 CYS n 1 107 GLY n 1 108 LEU n 1 109 ALA n 1 110 CYS n 1 111 ARG n 1 112 ARG n 1 113 ALA n 1 114 VAL n 1 115 LEU n 1 116 GLU n 1 117 VAL n 1 118 LEU n 1 119 HIS n 1 120 LEU n 1 121 ASP n 1 122 GLY n 1 123 ALA n 1 124 LEU n 1 125 ALA n 1 126 LYS n 1 127 ALA n 1 128 SER n 1 129 VAL n 1 130 ALA n 1 131 ALA n 1 132 ASP n 1 133 ALA n 1 134 ALA n 1 135 LYS n 1 136 ALA n 1 137 VAL n 1 138 ALA n 1 139 THR n 1 140 LYS n 1 141 TRP n 1 142 PRO n 1 143 ASN n 1 144 ASP n 1 145 ILE n 1 146 ILE n 1 147 TYR n 1 148 ASN n 1 149 HIS n 1 150 LYS n 1 151 LYS n 1 152 ILE n 1 153 GLY n 1 154 GLY n 1 155 THR n 1 156 LEU n 1 157 ILE n 1 158 GLU n 1 159 SER n 1 160 ASP n 1 161 GLY n 1 162 ASP n 1 163 TYR n 1 164 LEU n 1 165 ILE n 1 166 ILE n 1 167 GLY n 1 168 ILE n 1 169 GLY n 1 170 MET n 1 171 ASN n 1 172 ILE n 1 173 ALA n 1 174 VAL n 1 175 ALA n 1 176 PRO n 1 177 GLN n 1 178 MET n 1 179 THR n 1 180 ASP n 1 181 ALA n 1 182 GLY n 1 183 ARG n 1 184 GLU n 1 185 ALA n 1 186 THR n 1 187 MET n 1 188 ILE n 1 189 ASN n 1 190 THR n 1 191 ILE n 1 192 ALA n 1 193 GLU n 1 194 ASP n 1 195 PHE n 1 196 GLY n 1 197 VAL n 1 198 LYS n 1 199 SER n 1 200 CYS n 1 201 PRO n 1 202 PRO n 1 203 ARG n 1 204 ASP n 1 205 LEU n 1 206 ALA n 1 207 ASN n 1 208 ALA n 1 209 ILE n 1 210 TRP n 1 211 CYS n 1 212 HIS n 1 213 LEU n 1 214 PHE n 1 215 ASP n 1 216 ILE n 1 217 CYS n 1 218 SER n 1 219 SER n 1 220 PRO n 1 221 GLU n 1 222 TRP n 1 223 THR n 1 224 ARG n 1 225 GLU n 1 226 LEU n 1 227 VAL n 1 228 ILE n 1 229 GLU n 1 230 SER n 1 231 PHE n 1 232 ASP n 1 233 LYS n 1 234 VAL n 1 235 MET n 1 236 ASP n 1 237 LYS n 1 238 SER n 1 239 LEU n 1 240 LYS n 1 241 LEU n 1 242 HIS n 1 243 LYS n 1 244 ARG n 1 245 LEU n 1 246 PRO n 1 247 GLY n 1 248 GLY n 1 249 ARG n 1 250 ASP n 1 251 PRO n 1 252 GLU n 1 253 GLU n 1 254 LEU n 1 255 THR n 1 256 ALA n 1 257 VAL n 1 258 SER n 1 259 LEU n 1 260 ASN n 1 261 SER n 1 262 TRP n 1 263 GLY n 1 264 HIS n 1 265 LEU n 1 266 LYS n 1 267 VAL n 1 268 ARG n 1 269 HIS n 1 270 ALA n 1 271 ASP n 1 272 GLY n 1 273 THR n 1 274 VAL n 1 275 GLU n 1 276 ASP n 1 277 LEU n 1 278 SER n 1 279 ALA n 1 280 GLU n 1 281 TYR n 1 282 LEU n 1 283 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 283 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LMJF_31_1070 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Leishmania major' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5664 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4Q6F6_LEIMA _struct_ref.pdbx_db_accession Q4Q6F6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPAHCPPNIHFLEEVTSTMDVARTMRATAGGKAFAVVAAEQTAGRGTGGRTWTSPKGNLYMTVGVPQLGQPPCLKEELVP VLPLICGLACRRAVLEVLHLDGALAKASVAADAAKAVATKWPNDIIYNHKKIGGTLIESDGDYLIIGIGMNIAVAPQMTD AGREATMINTIAEDFGVKSCPPRDLANAIWCHLFDICSSPEWTRELVIESFDKVMDKSLKLHKRLPGGRDPEELTAVSLN SWGHLKVRHADGTVEDLSAEYLF ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JHU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 283 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4Q6F6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 263 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 263 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6JHU MET A 1 ? UNP Q4Q6F6 ? ? 'expression tag' -19 1 1 6JHU GLY A 2 ? UNP Q4Q6F6 ? ? 'expression tag' -18 2 1 6JHU SER A 3 ? UNP Q4Q6F6 ? ? 'expression tag' -17 3 1 6JHU SER A 4 ? UNP Q4Q6F6 ? ? 'expression tag' -16 4 1 6JHU HIS A 5 ? UNP Q4Q6F6 ? ? 'expression tag' -15 5 1 6JHU HIS A 6 ? UNP Q4Q6F6 ? ? 'expression tag' -14 6 1 6JHU HIS A 7 ? UNP Q4Q6F6 ? ? 'expression tag' -13 7 1 6JHU HIS A 8 ? UNP Q4Q6F6 ? ? 'expression tag' -12 8 1 6JHU HIS A 9 ? UNP Q4Q6F6 ? ? 'expression tag' -11 9 1 6JHU HIS A 10 ? UNP Q4Q6F6 ? ? 'expression tag' -10 10 1 6JHU SER A 11 ? UNP Q4Q6F6 ? ? 'expression tag' -9 11 1 6JHU SER A 12 ? UNP Q4Q6F6 ? ? 'expression tag' -8 12 1 6JHU GLY A 13 ? UNP Q4Q6F6 ? ? 'expression tag' -7 13 1 6JHU LEU A 14 ? UNP Q4Q6F6 ? ? 'expression tag' -6 14 1 6JHU VAL A 15 ? UNP Q4Q6F6 ? ? 'expression tag' -5 15 1 6JHU PRO A 16 ? UNP Q4Q6F6 ? ? 'expression tag' -4 16 1 6JHU ARG A 17 ? UNP Q4Q6F6 ? ? 'expression tag' -3 17 1 6JHU GLY A 18 ? UNP Q4Q6F6 ? ? 'expression tag' -2 18 1 6JHU SER A 19 ? UNP Q4Q6F6 ? ? 'expression tag' -1 19 1 6JHU HIS A 20 ? UNP Q4Q6F6 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BT5 'RNA linking' . BIOTINYL-5-AMP ? 'C20 H28 N7 O9 P S' 573.517 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JHU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '19% PEG 3350, 200 mM Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 277.15 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-07-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979507 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979507 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6JHU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.97 _reflns.d_resolution_low 52.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20353 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.97 _reflns_shell.d_res_low 2.001 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 987 _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.928 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.0 _reflns_shell.pdbx_Rpim_I_all 0.383 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 69.76 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JHU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.97 _refine.ls_d_res_low 52.82 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20315 _refine.ls_number_reflns_R_free 975 _refine.ls_number_reflns_R_work 19340 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.48 _refine.ls_percent_reflns_R_free 4.80 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2181 _refine.ls_R_factor_R_free 0.2478 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2166 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '2ej9, 2dxu' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.7962 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2061 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.97 _refine_hist.d_res_low 52.82 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 1923 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1862 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0062 ? 1941 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9058 ? 2637 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0510 ? 308 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0053 ? 330 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.8626 ? 693 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.97 2.07 . . 140 2717 99.62 . . . 0.3597 . 0.3408 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.07 2.20 . . 151 2735 99.52 . . . 0.3159 . 0.2662 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.20 2.37 . . 159 2725 99.35 . . . 0.2847 . 0.2472 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.37 2.61 . . 141 2763 99.62 . . . 0.2763 . 0.2466 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.61 2.99 . . 130 2770 99.69 . . . 0.3514 . 0.2575 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.99 3.76 . . 108 2796 99.69 . . . 0.2637 . 0.2364 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.76 52.82 . . 146 2834 98.90 . . . 0.2051 . 0.1850 . . . . . . . . . . . # _struct.entry_id 6JHU _struct.title 'Crystal Structure Of Biotin Protein Ligase From Leishmania Major in complex with Biotinyl-5-AMP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JHU _struct_keywords.text 'Enzyme, Biotin Protein ligase, Ligase' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 37 ? ALA A 49 ? SER A 17 ALA A 29 1 ? 13 HELX_P HELX_P2 AA2 LYS A 95 ? PRO A 100 ? LYS A 75 PRO A 80 5 ? 6 HELX_P HELX_P3 AA3 VAL A 101 ? LEU A 118 ? VAL A 81 LEU A 98 1 ? 18 HELX_P HELX_P4 AA4 LYS A 126 ? ALA A 136 ? LYS A 106 ALA A 116 1 ? 11 HELX_P HELX_P5 AA5 MET A 187 ? GLY A 196 ? MET A 167 GLY A 176 1 ? 10 HELX_P HELX_P6 AA6 PRO A 201 ? LEU A 213 ? PRO A 181 LEU A 193 1 ? 13 HELX_P HELX_P7 AA7 THR A 223 ? MET A 235 ? THR A 203 MET A 215 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 141 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 121 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 142 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 122 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 29 ? VAL A 35 ? ILE A 9 VAL A 15 AA1 2 PHE A 54 ? GLN A 61 ? PHE A 34 GLN A 41 AA1 3 LEU A 79 ? PRO A 86 ? LEU A 59 PRO A 66 AA1 4 TYR A 163 ? MET A 170 ? TYR A 143 MET A 150 AA1 5 LYS A 150 ? ASP A 160 ? LYS A 130 ASP A 140 AA1 6 ASP A 144 ? TYR A 147 ? ASP A 124 TYR A 127 AA1 7 VAL A 137 ? LYS A 140 ? VAL A 117 LYS A 120 AA2 1 THR A 255 ? LEU A 259 ? THR A 235 LEU A 239 AA2 2 LEU A 265 ? ARG A 268 ? LEU A 245 ARG A 248 AA2 3 VAL A 274 ? LEU A 277 ? VAL A 254 LEU A 257 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 30 ? N HIS A 10 O VAL A 57 ? O VAL A 37 AA1 2 3 N PHE A 54 ? N PHE A 34 O GLY A 84 ? O GLY A 64 AA1 3 4 N MET A 81 ? N MET A 61 O ILE A 168 ? O ILE A 148 AA1 4 5 O ILE A 165 ? O ILE A 145 N GLU A 158 ? N GLU A 138 AA1 5 6 O LYS A 150 ? O LYS A 130 N TYR A 147 ? N TYR A 127 AA1 6 7 O ILE A 146 ? O ILE A 126 N ALA A 138 ? N ALA A 118 AA2 1 2 N SER A 258 ? N SER A 238 O LYS A 266 ? O LYS A 246 AA2 2 3 N LEU A 265 ? N LEU A 245 O LEU A 277 ? O LEU A 257 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A BT5 301 ? 24 'binding site for residue BT5 A 301' AC2 Software A SO4 302 ? 3 'binding site for residue SO4 A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 24 SER A 37 ? SER A 17 . ? 1_555 ? 2 AC1 24 THR A 38 ? THR A 18 . ? 1_555 ? 3 AC1 24 MET A 39 ? MET A 19 . ? 1_555 ? 4 AC1 24 GLN A 61 ? GLN A 41 . ? 1_555 ? 5 AC1 24 GLY A 64 ? GLY A 44 . ? 1_555 ? 6 AC1 24 ARG A 65 ? ARG A 45 . ? 1_555 ? 7 AC1 24 GLY A 66 ? GLY A 46 . ? 1_555 ? 8 AC1 24 THR A 67 ? THR A 47 . ? 1_555 ? 9 AC1 24 ARG A 70 ? ARG A 50 . ? 1_555 ? 10 AC1 24 THR A 71 ? THR A 51 . ? 1_555 ? 11 AC1 24 TRP A 72 ? TRP A 52 . ? 1_555 ? 12 AC1 24 THR A 73 ? THR A 53 . ? 1_555 ? 13 AC1 24 MET A 81 ? MET A 61 . ? 1_555 ? 14 AC1 24 ASN A 143 ? ASN A 123 . ? 1_555 ? 15 AC1 24 ASP A 144 ? ASP A 124 . ? 1_555 ? 16 AC1 24 LYS A 151 ? LYS A 131 . ? 1_555 ? 17 AC1 24 GLY A 154 ? GLY A 134 . ? 1_555 ? 18 AC1 24 THR A 155 ? THR A 135 . ? 1_555 ? 19 AC1 24 ILE A 168 ? ILE A 148 . ? 1_555 ? 20 AC1 24 GLY A 169 ? GLY A 149 . ? 1_555 ? 21 AC1 24 ASN A 171 ? ASN A 151 . ? 1_555 ? 22 AC1 24 PRO A 176 ? PRO A 156 . ? 1_555 ? 23 AC1 24 GLN A 177 ? GLN A 157 . ? 1_555 ? 24 AC1 24 ASP A 180 ? ASP A 160 . ? 1_555 ? 25 AC2 3 LYS A 140 ? LYS A 120 . ? 1_555 ? 26 AC2 3 ARG A 244 ? ARG A 224 . ? 1_555 ? 27 AC2 3 ARG A 249 ? ARG A 229 . ? 2_657 ? # _atom_sites.entry_id 6JHU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008558 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002224 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021450 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018933 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 PRO 22 2 ? ? ? A . n A 1 23 ALA 23 3 ? ? ? A . n A 1 24 HIS 24 4 ? ? ? A . n A 1 25 CYS 25 5 5 CYS CYS A . n A 1 26 PRO 26 6 6 PRO PRO A . n A 1 27 PRO 27 7 7 PRO PRO A . n A 1 28 ASN 28 8 8 ASN ASN A . n A 1 29 ILE 29 9 9 ILE ILE A . n A 1 30 HIS 30 10 10 HIS HIS A . n A 1 31 PHE 31 11 11 PHE PHE A . n A 1 32 LEU 32 12 12 LEU LEU A . n A 1 33 GLU 33 13 13 GLU GLU A . n A 1 34 GLU 34 14 14 GLU GLU A . n A 1 35 VAL 35 15 15 VAL VAL A . n A 1 36 THR 36 16 16 THR THR A . n A 1 37 SER 37 17 17 SER SER A . n A 1 38 THR 38 18 18 THR THR A . n A 1 39 MET 39 19 19 MET MET A . n A 1 40 ASP 40 20 20 ASP ASP A . n A 1 41 VAL 41 21 21 VAL VAL A . n A 1 42 ALA 42 22 22 ALA ALA A . n A 1 43 ARG 43 23 23 ARG ARG A . n A 1 44 THR 44 24 24 THR THR A . n A 1 45 MET 45 25 25 MET MET A . n A 1 46 ARG 46 26 26 ARG ARG A . n A 1 47 ALA 47 27 27 ALA ALA A . n A 1 48 THR 48 28 28 THR THR A . n A 1 49 ALA 49 29 29 ALA ALA A . n A 1 50 GLY 50 30 30 GLY GLY A . n A 1 51 GLY 51 31 31 GLY GLY A . n A 1 52 LYS 52 32 32 LYS LYS A . n A 1 53 ALA 53 33 33 ALA ALA A . n A 1 54 PHE 54 34 34 PHE PHE A . n A 1 55 ALA 55 35 35 ALA ALA A . n A 1 56 VAL 56 36 36 VAL VAL A . n A 1 57 VAL 57 37 37 VAL VAL A . n A 1 58 ALA 58 38 38 ALA ALA A . n A 1 59 ALA 59 39 39 ALA ALA A . n A 1 60 GLU 60 40 40 GLU GLU A . n A 1 61 GLN 61 41 41 GLN GLN A . n A 1 62 THR 62 42 42 THR THR A . n A 1 63 ALA 63 43 43 ALA ALA A . n A 1 64 GLY 64 44 44 GLY GLY A . n A 1 65 ARG 65 45 45 ARG ARG A . n A 1 66 GLY 66 46 46 GLY GLY A . n A 1 67 THR 67 47 47 THR THR A . n A 1 68 GLY 68 48 48 GLY GLY A . n A 1 69 GLY 69 49 49 GLY GLY A . n A 1 70 ARG 70 50 50 ARG ARG A . n A 1 71 THR 71 51 51 THR THR A . n A 1 72 TRP 72 52 52 TRP TRP A . n A 1 73 THR 73 53 53 THR THR A . n A 1 74 SER 74 54 54 SER SER A . n A 1 75 PRO 75 55 55 PRO PRO A . n A 1 76 LYS 76 56 56 LYS LYS A . n A 1 77 GLY 77 57 57 GLY GLY A . n A 1 78 ASN 78 58 58 ASN ASN A . n A 1 79 LEU 79 59 59 LEU LEU A . n A 1 80 TYR 80 60 60 TYR TYR A . n A 1 81 MET 81 61 61 MET MET A . n A 1 82 THR 82 62 62 THR THR A . n A 1 83 VAL 83 63 63 VAL VAL A . n A 1 84 GLY 84 64 64 GLY GLY A . n A 1 85 VAL 85 65 65 VAL VAL A . n A 1 86 PRO 86 66 66 PRO PRO A . n A 1 87 GLN 87 67 67 GLN GLN A . n A 1 88 LEU 88 68 68 LEU LEU A . n A 1 89 GLY 89 69 ? ? ? A . n A 1 90 GLN 90 70 ? ? ? A . n A 1 91 PRO 91 71 ? ? ? A . n A 1 92 PRO 92 72 72 PRO PRO A . n A 1 93 CYS 93 73 73 CYS CYS A . n A 1 94 LEU 94 74 74 LEU LEU A . n A 1 95 LYS 95 75 75 LYS LYS A . n A 1 96 GLU 96 76 76 GLU GLU A . n A 1 97 GLU 97 77 77 GLU GLU A . n A 1 98 LEU 98 78 78 LEU LEU A . n A 1 99 VAL 99 79 79 VAL VAL A . n A 1 100 PRO 100 80 80 PRO PRO A . n A 1 101 VAL 101 81 81 VAL VAL A . n A 1 102 LEU 102 82 82 LEU LEU A . n A 1 103 PRO 103 83 83 PRO PRO A . n A 1 104 LEU 104 84 84 LEU LEU A . n A 1 105 ILE 105 85 85 ILE ILE A . n A 1 106 CYS 106 86 86 CYS CYS A . n A 1 107 GLY 107 87 87 GLY GLY A . n A 1 108 LEU 108 88 88 LEU LEU A . n A 1 109 ALA 109 89 89 ALA ALA A . n A 1 110 CYS 110 90 90 CYS CYS A . n A 1 111 ARG 111 91 91 ARG ARG A . n A 1 112 ARG 112 92 92 ARG ARG A . n A 1 113 ALA 113 93 93 ALA ALA A . n A 1 114 VAL 114 94 94 VAL VAL A . n A 1 115 LEU 115 95 95 LEU LEU A . n A 1 116 GLU 116 96 96 GLU GLU A . n A 1 117 VAL 117 97 97 VAL VAL A . n A 1 118 LEU 118 98 98 LEU LEU A . n A 1 119 HIS 119 99 99 HIS HIS A . n A 1 120 LEU 120 100 100 LEU LEU A . n A 1 121 ASP 121 101 101 ASP ASP A . n A 1 122 GLY 122 102 102 GLY GLY A . n A 1 123 ALA 123 103 103 ALA ALA A . n A 1 124 LEU 124 104 104 LEU LEU A . n A 1 125 ALA 125 105 105 ALA ALA A . n A 1 126 LYS 126 106 106 LYS LYS A . n A 1 127 ALA 127 107 107 ALA ALA A . n A 1 128 SER 128 108 108 SER SER A . n A 1 129 VAL 129 109 109 VAL VAL A . n A 1 130 ALA 130 110 110 ALA ALA A . n A 1 131 ALA 131 111 111 ALA ALA A . n A 1 132 ASP 132 112 112 ASP ASP A . n A 1 133 ALA 133 113 113 ALA ALA A . n A 1 134 ALA 134 114 114 ALA ALA A . n A 1 135 LYS 135 115 115 LYS LYS A . n A 1 136 ALA 136 116 116 ALA ALA A . n A 1 137 VAL 137 117 117 VAL VAL A . n A 1 138 ALA 138 118 118 ALA ALA A . n A 1 139 THR 139 119 119 THR THR A . n A 1 140 LYS 140 120 120 LYS LYS A . n A 1 141 TRP 141 121 121 TRP TRP A . n A 1 142 PRO 142 122 122 PRO PRO A . n A 1 143 ASN 143 123 123 ASN ASN A . n A 1 144 ASP 144 124 124 ASP ASP A . n A 1 145 ILE 145 125 125 ILE ILE A . n A 1 146 ILE 146 126 126 ILE ILE A . n A 1 147 TYR 147 127 127 TYR TYR A . n A 1 148 ASN 148 128 128 ASN ASN A . n A 1 149 HIS 149 129 129 HIS HIS A . n A 1 150 LYS 150 130 130 LYS LYS A . n A 1 151 LYS 151 131 131 LYS LYS A . n A 1 152 ILE 152 132 132 ILE ILE A . n A 1 153 GLY 153 133 133 GLY GLY A . n A 1 154 GLY 154 134 134 GLY GLY A . n A 1 155 THR 155 135 135 THR THR A . n A 1 156 LEU 156 136 136 LEU LEU A . n A 1 157 ILE 157 137 137 ILE ILE A . n A 1 158 GLU 158 138 138 GLU GLU A . n A 1 159 SER 159 139 139 SER SER A . n A 1 160 ASP 160 140 140 ASP ASP A . n A 1 161 GLY 161 141 141 GLY GLY A . n A 1 162 ASP 162 142 142 ASP ASP A . n A 1 163 TYR 163 143 143 TYR TYR A . n A 1 164 LEU 164 144 144 LEU LEU A . n A 1 165 ILE 165 145 145 ILE ILE A . n A 1 166 ILE 166 146 146 ILE ILE A . n A 1 167 GLY 167 147 147 GLY GLY A . n A 1 168 ILE 168 148 148 ILE ILE A . n A 1 169 GLY 169 149 149 GLY GLY A . n A 1 170 MET 170 150 150 MET MET A . n A 1 171 ASN 171 151 151 ASN ASN A . n A 1 172 ILE 172 152 152 ILE ILE A . n A 1 173 ALA 173 153 153 ALA ALA A . n A 1 174 VAL 174 154 154 VAL VAL A . n A 1 175 ALA 175 155 155 ALA ALA A . n A 1 176 PRO 176 156 156 PRO PRO A . n A 1 177 GLN 177 157 157 GLN GLN A . n A 1 178 MET 178 158 158 MET MET A . n A 1 179 THR 179 159 159 THR THR A . n A 1 180 ASP 180 160 160 ASP ASP A . n A 1 181 ALA 181 161 ? ? ? A . n A 1 182 GLY 182 162 ? ? ? A . n A 1 183 ARG 183 163 163 ARG ARG A . n A 1 184 GLU 184 164 164 GLU GLU A . n A 1 185 ALA 185 165 165 ALA ALA A . n A 1 186 THR 186 166 166 THR THR A . n A 1 187 MET 187 167 167 MET MET A . n A 1 188 ILE 188 168 168 ILE ILE A . n A 1 189 ASN 189 169 169 ASN ASN A . n A 1 190 THR 190 170 170 THR THR A . n A 1 191 ILE 191 171 171 ILE ILE A . n A 1 192 ALA 192 172 172 ALA ALA A . n A 1 193 GLU 193 173 173 GLU GLU A . n A 1 194 ASP 194 174 174 ASP ASP A . n A 1 195 PHE 195 175 175 PHE PHE A . n A 1 196 GLY 196 176 176 GLY GLY A . n A 1 197 VAL 197 177 177 VAL VAL A . n A 1 198 LYS 198 178 178 LYS LYS A . n A 1 199 SER 199 179 179 SER SER A . n A 1 200 CYS 200 180 180 CYS CYS A . n A 1 201 PRO 201 181 181 PRO PRO A . n A 1 202 PRO 202 182 182 PRO PRO A . n A 1 203 ARG 203 183 183 ARG ARG A . n A 1 204 ASP 204 184 184 ASP ASP A . n A 1 205 LEU 205 185 185 LEU LEU A . n A 1 206 ALA 206 186 186 ALA ALA A . n A 1 207 ASN 207 187 187 ASN ASN A . n A 1 208 ALA 208 188 188 ALA ALA A . n A 1 209 ILE 209 189 189 ILE ILE A . n A 1 210 TRP 210 190 190 TRP TRP A . n A 1 211 CYS 211 191 191 CYS CYS A . n A 1 212 HIS 212 192 192 HIS HIS A . n A 1 213 LEU 213 193 193 LEU LEU A . n A 1 214 PHE 214 194 194 PHE PHE A . n A 1 215 ASP 215 195 195 ASP ASP A . n A 1 216 ILE 216 196 196 ILE ILE A . n A 1 217 CYS 217 197 197 CYS CYS A . n A 1 218 SER 218 198 198 SER SER A . n A 1 219 SER 219 199 ? ? ? A . n A 1 220 PRO 220 200 ? ? ? A . n A 1 221 GLU 221 201 201 GLU GLU A . n A 1 222 TRP 222 202 202 TRP TRP A . n A 1 223 THR 223 203 203 THR THR A . n A 1 224 ARG 224 204 204 ARG ARG A . n A 1 225 GLU 225 205 205 GLU GLU A . n A 1 226 LEU 226 206 206 LEU LEU A . n A 1 227 VAL 227 207 207 VAL VAL A . n A 1 228 ILE 228 208 208 ILE ILE A . n A 1 229 GLU 229 209 209 GLU GLU A . n A 1 230 SER 230 210 210 SER SER A . n A 1 231 PHE 231 211 211 PHE PHE A . n A 1 232 ASP 232 212 212 ASP ASP A . n A 1 233 LYS 233 213 213 LYS LYS A . n A 1 234 VAL 234 214 214 VAL VAL A . n A 1 235 MET 235 215 215 MET MET A . n A 1 236 ASP 236 216 216 ASP ASP A . n A 1 237 LYS 237 217 217 LYS LYS A . n A 1 238 SER 238 218 218 SER SER A . n A 1 239 LEU 239 219 219 LEU LEU A . n A 1 240 LYS 240 220 220 LYS LYS A . n A 1 241 LEU 241 221 221 LEU LEU A . n A 1 242 HIS 242 222 222 HIS HIS A . n A 1 243 LYS 243 223 223 LYS LYS A . n A 1 244 ARG 244 224 224 ARG ARG A . n A 1 245 LEU 245 225 225 LEU LEU A . n A 1 246 PRO 246 226 226 PRO PRO A . n A 1 247 GLY 247 227 227 GLY GLY A . n A 1 248 GLY 248 228 228 GLY GLY A . n A 1 249 ARG 249 229 229 ARG ARG A . n A 1 250 ASP 250 230 230 ASP ASP A . n A 1 251 PRO 251 231 231 PRO PRO A . n A 1 252 GLU 252 232 232 GLU GLU A . n A 1 253 GLU 253 233 233 GLU GLU A . n A 1 254 LEU 254 234 234 LEU LEU A . n A 1 255 THR 255 235 235 THR THR A . n A 1 256 ALA 256 236 236 ALA ALA A . n A 1 257 VAL 257 237 237 VAL VAL A . n A 1 258 SER 258 238 238 SER SER A . n A 1 259 LEU 259 239 239 LEU LEU A . n A 1 260 ASN 260 240 240 ASN ASN A . n A 1 261 SER 261 241 241 SER SER A . n A 1 262 TRP 262 242 242 TRP TRP A . n A 1 263 GLY 263 243 243 GLY GLY A . n A 1 264 HIS 264 244 244 HIS HIS A . n A 1 265 LEU 265 245 245 LEU LEU A . n A 1 266 LYS 266 246 246 LYS LYS A . n A 1 267 VAL 267 247 247 VAL VAL A . n A 1 268 ARG 268 248 248 ARG ARG A . n A 1 269 HIS 269 249 249 HIS HIS A . n A 1 270 ALA 270 250 250 ALA ALA A . n A 1 271 ASP 271 251 251 ASP ASP A . n A 1 272 GLY 272 252 252 GLY GLY A . n A 1 273 THR 273 253 253 THR THR A . n A 1 274 VAL 274 254 254 VAL VAL A . n A 1 275 GLU 275 255 255 GLU GLU A . n A 1 276 ASP 276 256 256 ASP ASP A . n A 1 277 LEU 277 257 257 LEU LEU A . n A 1 278 SER 278 258 258 SER SER A . n A 1 279 ALA 279 259 259 ALA ALA A . n A 1 280 GLU 280 260 ? ? ? A . n A 1 281 TYR 281 261 ? ? ? A . n A 1 282 LEU 282 262 ? ? ? A . n A 1 283 PHE 283 263 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BT5 1 301 1 BT5 BT5 A . C 3 SO4 1 302 1 SO4 SO4 A . D 4 HOH 1 401 18 HOH HOH A . D 4 HOH 2 402 11 HOH HOH A . D 4 HOH 3 403 7 HOH HOH A . D 4 HOH 4 404 1 HOH HOH A . D 4 HOH 5 405 13 HOH HOH A . D 4 HOH 6 406 9 HOH HOH A . D 4 HOH 7 407 6 HOH HOH A . D 4 HOH 8 408 16 HOH HOH A . D 4 HOH 9 409 2 HOH HOH A . D 4 HOH 10 410 17 HOH HOH A . D 4 HOH 11 411 3 HOH HOH A . D 4 HOH 12 412 5 HOH HOH A . D 4 HOH 13 413 14 HOH HOH A . D 4 HOH 14 414 12 HOH HOH A . D 4 HOH 15 415 10 HOH HOH A . D 4 HOH 16 416 15 HOH HOH A . D 4 HOH 17 417 8 HOH HOH A . D 4 HOH 18 418 4 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6830 ? 1 MORE -56 ? 1 'SSA (A^2)' 22330 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_657 -x+1,y,-z+2 -1.0000000000 0.0000000000 0.0000000000 89.3927886264 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 105.6364552815 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-08 2 'Structure model' 1 1 2020-10-21 3 'Structure model' 1 2 2021-04-14 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_struct_assembly 2 2 'Structure model' pdbx_struct_assembly_gen 3 2 'Structure model' pdbx_struct_assembly_prop 4 2 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' citation 6 3 'Structure model' citation_author 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 10 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 2 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 3 2 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 4 2 'Structure model' '_pdbx_struct_assembly_prop.value' 5 3 'Structure model' '_citation.country' 6 3 'Structure model' '_citation.journal_abbrev' 7 3 'Structure model' '_citation.journal_id_ASTM' 8 3 'Structure model' '_citation.journal_id_CSD' 9 3 'Structure model' '_citation.journal_id_ISSN' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.pdbx_database_id_DOI' 12 3 'Structure model' '_citation.title' 13 3 'Structure model' '_citation.year' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6JHU _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 7 ? ? -96.96 58.07 2 1 GLU A 13 ? ? -79.71 -78.50 3 1 ALA A 43 ? ? -145.40 52.35 4 1 CYS A 73 ? ? -141.07 55.73 5 1 MET A 158 ? ? -127.09 -168.79 6 1 VAL A 237 ? ? -97.14 -66.91 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PRO 72 ? N ? A PRO 92 N 2 1 Y 1 A PRO 72 ? CA ? A PRO 92 CA 3 1 Y 1 A PRO 72 ? CB ? A PRO 92 CB 4 1 Y 1 A PRO 72 ? CG ? A PRO 92 CG 5 1 Y 1 A PRO 72 ? CD ? A PRO 92 CD 6 1 Y 1 A LEU 74 ? CG ? A LEU 94 CG 7 1 Y 1 A LEU 74 ? CD1 ? A LEU 94 CD1 8 1 Y 1 A LEU 74 ? CD2 ? A LEU 94 CD2 9 1 Y 1 A GLU 77 ? CG ? A GLU 97 CG 10 1 Y 1 A GLU 77 ? CD ? A GLU 97 CD 11 1 Y 1 A GLU 77 ? OE1 ? A GLU 97 OE1 12 1 Y 1 A GLU 77 ? OE2 ? A GLU 97 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 A PRO 2 ? A PRO 22 23 1 Y 1 A ALA 3 ? A ALA 23 24 1 Y 1 A HIS 4 ? A HIS 24 25 1 Y 1 A GLY 69 ? A GLY 89 26 1 Y 1 A GLN 70 ? A GLN 90 27 1 Y 1 A PRO 71 ? A PRO 91 28 1 Y 1 A ALA 161 ? A ALA 181 29 1 Y 1 A GLY 162 ? A GLY 182 30 1 Y 1 A SER 199 ? A SER 219 31 1 Y 1 A PRO 200 ? A PRO 220 32 1 Y 1 A GLU 260 ? A GLU 280 33 1 Y 1 A TYR 261 ? A TYR 281 34 1 Y 1 A LEU 262 ? A LEU 282 35 1 Y 1 A PHE 263 ? A PHE 283 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BT5 CBB C N N 74 BT5 OBB O N N 75 BT5 OCB O N N 76 BT5 CAB C N N 77 BT5 C9B C N N 78 BT5 C8B C N N 79 BT5 C7B C N N 80 BT5 C2B C N S 81 BT5 S1B S N N 82 BT5 C6B C N N 83 BT5 C5B C N R 84 BT5 N1B N N N 85 BT5 C3B C N N 86 BT5 O3B O N N 87 BT5 N2B N N N 88 BT5 C4B C N S 89 BT5 P P N R 90 BT5 OP1 O N N 91 BT5 OP2 O N N 92 BT5 "O5'" O N N 93 BT5 "C5'" C N N 94 BT5 "C4'" C N R 95 BT5 "O4'" O N N 96 BT5 "C3'" C N S 97 BT5 "O3'" O N N 98 BT5 "C2'" C N R 99 BT5 "O2'" O N N 100 BT5 "C1'" C N R 101 BT5 N9 N Y N 102 BT5 C8 C Y N 103 BT5 N7 N Y N 104 BT5 C5 C Y N 105 BT5 C6 C Y N 106 BT5 N6 N N N 107 BT5 N1 N Y N 108 BT5 C2 C Y N 109 BT5 N3 N Y N 110 BT5 C4 C Y N 111 BT5 H101 H N N 112 BT5 H102 H N N 113 BT5 H9B1 H N N 114 BT5 H9B2 H N N 115 BT5 H8B1 H N N 116 BT5 H8B2 H N N 117 BT5 H7B1 H N N 118 BT5 H7B2 H N N 119 BT5 H2B H N N 120 BT5 H6B1 H N N 121 BT5 H6B2 H N N 122 BT5 H5B H N N 123 BT5 H1B H N N 124 BT5 H4 H N N 125 BT5 H4B H N N 126 BT5 H2P H N N 127 BT5 "H5'" H N N 128 BT5 "H5''" H N N 129 BT5 "H4'" H N N 130 BT5 "H3'" H N N 131 BT5 H2 H N N 132 BT5 H1 H N N 133 BT5 "H2'" H N N 134 BT5 "H1'" H N N 135 BT5 H8 H N N 136 BT5 HN61 H N N 137 BT5 HN62 H N N 138 BT5 H3 H N N 139 CYS N N N N 140 CYS CA C N R 141 CYS C C N N 142 CYS O O N N 143 CYS CB C N N 144 CYS SG S N N 145 CYS OXT O N N 146 CYS H H N N 147 CYS H2 H N N 148 CYS HA H N N 149 CYS HB2 H N N 150 CYS HB3 H N N 151 CYS HG H N N 152 CYS HXT H N N 153 GLN N N N N 154 GLN CA C N S 155 GLN C C N N 156 GLN O O N N 157 GLN CB C N N 158 GLN CG C N N 159 GLN CD C N N 160 GLN OE1 O N N 161 GLN NE2 N N N 162 GLN OXT O N N 163 GLN H H N N 164 GLN H2 H N N 165 GLN HA H N N 166 GLN HB2 H N N 167 GLN HB3 H N N 168 GLN HG2 H N N 169 GLN HG3 H N N 170 GLN HE21 H N N 171 GLN HE22 H N N 172 GLN HXT H N N 173 GLU N N N N 174 GLU CA C N S 175 GLU C C N N 176 GLU O O N N 177 GLU CB C N N 178 GLU CG C N N 179 GLU CD C N N 180 GLU OE1 O N N 181 GLU OE2 O N N 182 GLU OXT O N N 183 GLU H H N N 184 GLU H2 H N N 185 GLU HA H N N 186 GLU HB2 H N N 187 GLU HB3 H N N 188 GLU HG2 H N N 189 GLU HG3 H N N 190 GLU HE2 H N N 191 GLU HXT H N N 192 GLY N N N N 193 GLY CA C N N 194 GLY C C N N 195 GLY O O N N 196 GLY OXT O N N 197 GLY H H N N 198 GLY H2 H N N 199 GLY HA2 H N N 200 GLY HA3 H N N 201 GLY HXT H N N 202 HIS N N N N 203 HIS CA C N S 204 HIS C C N N 205 HIS O O N N 206 HIS CB C N N 207 HIS CG C Y N 208 HIS ND1 N Y N 209 HIS CD2 C Y N 210 HIS CE1 C Y N 211 HIS NE2 N Y N 212 HIS OXT O N N 213 HIS H H N N 214 HIS H2 H N N 215 HIS HA H N N 216 HIS HB2 H N N 217 HIS HB3 H N N 218 HIS HD1 H N N 219 HIS HD2 H N N 220 HIS HE1 H N N 221 HIS HE2 H N N 222 HIS HXT H N N 223 HOH O O N N 224 HOH H1 H N N 225 HOH H2 H N N 226 ILE N N N N 227 ILE CA C N S 228 ILE C C N N 229 ILE O O N N 230 ILE CB C N S 231 ILE CG1 C N N 232 ILE CG2 C N N 233 ILE CD1 C N N 234 ILE OXT O N N 235 ILE H H N N 236 ILE H2 H N N 237 ILE HA H N N 238 ILE HB H N N 239 ILE HG12 H N N 240 ILE HG13 H N N 241 ILE HG21 H N N 242 ILE HG22 H N N 243 ILE HG23 H N N 244 ILE HD11 H N N 245 ILE HD12 H N N 246 ILE HD13 H N N 247 ILE HXT H N N 248 LEU N N N N 249 LEU CA C N S 250 LEU C C N N 251 LEU O O N N 252 LEU CB C N N 253 LEU CG C N N 254 LEU CD1 C N N 255 LEU CD2 C N N 256 LEU OXT O N N 257 LEU H H N N 258 LEU H2 H N N 259 LEU HA H N N 260 LEU HB2 H N N 261 LEU HB3 H N N 262 LEU HG H N N 263 LEU HD11 H N N 264 LEU HD12 H N N 265 LEU HD13 H N N 266 LEU HD21 H N N 267 LEU HD22 H N N 268 LEU HD23 H N N 269 LEU HXT H N N 270 LYS N N N N 271 LYS CA C N S 272 LYS C C N N 273 LYS O O N N 274 LYS CB C N N 275 LYS CG C N N 276 LYS CD C N N 277 LYS CE C N N 278 LYS NZ N N N 279 LYS OXT O N N 280 LYS H H N N 281 LYS H2 H N N 282 LYS HA H N N 283 LYS HB2 H N N 284 LYS HB3 H N N 285 LYS HG2 H N N 286 LYS HG3 H N N 287 LYS HD2 H N N 288 LYS HD3 H N N 289 LYS HE2 H N N 290 LYS HE3 H N N 291 LYS HZ1 H N N 292 LYS HZ2 H N N 293 LYS HZ3 H N N 294 LYS HXT H N N 295 MET N N N N 296 MET CA C N S 297 MET C C N N 298 MET O O N N 299 MET CB C N N 300 MET CG C N N 301 MET SD S N N 302 MET CE C N N 303 MET OXT O N N 304 MET H H N N 305 MET H2 H N N 306 MET HA H N N 307 MET HB2 H N N 308 MET HB3 H N N 309 MET HG2 H N N 310 MET HG3 H N N 311 MET HE1 H N N 312 MET HE2 H N N 313 MET HE3 H N N 314 MET HXT H N N 315 PHE N N N N 316 PHE CA C N S 317 PHE C C N N 318 PHE O O N N 319 PHE CB C N N 320 PHE CG C Y N 321 PHE CD1 C Y N 322 PHE CD2 C Y N 323 PHE CE1 C Y N 324 PHE CE2 C Y N 325 PHE CZ C Y N 326 PHE OXT O N N 327 PHE H H N N 328 PHE H2 H N N 329 PHE HA H N N 330 PHE HB2 H N N 331 PHE HB3 H N N 332 PHE HD1 H N N 333 PHE HD2 H N N 334 PHE HE1 H N N 335 PHE HE2 H N N 336 PHE HZ H N N 337 PHE HXT H N N 338 PRO N N N N 339 PRO CA C N S 340 PRO C C N N 341 PRO O O N N 342 PRO CB C N N 343 PRO CG C N N 344 PRO CD C N N 345 PRO OXT O N N 346 PRO H H N N 347 PRO HA H N N 348 PRO HB2 H N N 349 PRO HB3 H N N 350 PRO HG2 H N N 351 PRO HG3 H N N 352 PRO HD2 H N N 353 PRO HD3 H N N 354 PRO HXT H N N 355 SER N N N N 356 SER CA C N S 357 SER C C N N 358 SER O O N N 359 SER CB C N N 360 SER OG O N N 361 SER OXT O N N 362 SER H H N N 363 SER H2 H N N 364 SER HA H N N 365 SER HB2 H N N 366 SER HB3 H N N 367 SER HG H N N 368 SER HXT H N N 369 SO4 S S N N 370 SO4 O1 O N N 371 SO4 O2 O N N 372 SO4 O3 O N N 373 SO4 O4 O N N 374 THR N N N N 375 THR CA C N S 376 THR C C N N 377 THR O O N N 378 THR CB C N R 379 THR OG1 O N N 380 THR CG2 C N N 381 THR OXT O N N 382 THR H H N N 383 THR H2 H N N 384 THR HA H N N 385 THR HB H N N 386 THR HG1 H N N 387 THR HG21 H N N 388 THR HG22 H N N 389 THR HG23 H N N 390 THR HXT H N N 391 TRP N N N N 392 TRP CA C N S 393 TRP C C N N 394 TRP O O N N 395 TRP CB C N N 396 TRP CG C Y N 397 TRP CD1 C Y N 398 TRP CD2 C Y N 399 TRP NE1 N Y N 400 TRP CE2 C Y N 401 TRP CE3 C Y N 402 TRP CZ2 C Y N 403 TRP CZ3 C Y N 404 TRP CH2 C Y N 405 TRP OXT O N N 406 TRP H H N N 407 TRP H2 H N N 408 TRP HA H N N 409 TRP HB2 H N N 410 TRP HB3 H N N 411 TRP HD1 H N N 412 TRP HE1 H N N 413 TRP HE3 H N N 414 TRP HZ2 H N N 415 TRP HZ3 H N N 416 TRP HH2 H N N 417 TRP HXT H N N 418 TYR N N N N 419 TYR CA C N S 420 TYR C C N N 421 TYR O O N N 422 TYR CB C N N 423 TYR CG C Y N 424 TYR CD1 C Y N 425 TYR CD2 C Y N 426 TYR CE1 C Y N 427 TYR CE2 C Y N 428 TYR CZ C Y N 429 TYR OH O N N 430 TYR OXT O N N 431 TYR H H N N 432 TYR H2 H N N 433 TYR HA H N N 434 TYR HB2 H N N 435 TYR HB3 H N N 436 TYR HD1 H N N 437 TYR HD2 H N N 438 TYR HE1 H N N 439 TYR HE2 H N N 440 TYR HH H N N 441 TYR HXT H N N 442 VAL N N N N 443 VAL CA C N S 444 VAL C C N N 445 VAL O O N N 446 VAL CB C N N 447 VAL CG1 C N N 448 VAL CG2 C N N 449 VAL OXT O N N 450 VAL H H N N 451 VAL H2 H N N 452 VAL HA H N N 453 VAL HB H N N 454 VAL HG11 H N N 455 VAL HG12 H N N 456 VAL HG13 H N N 457 VAL HG21 H N N 458 VAL HG22 H N N 459 VAL HG23 H N N 460 VAL HXT H N N 461 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BT5 CBB OBB sing N N 70 BT5 CBB OCB doub N N 71 BT5 CBB CAB sing N N 72 BT5 OBB P sing N N 73 BT5 CAB C9B sing N N 74 BT5 CAB H101 sing N N 75 BT5 CAB H102 sing N N 76 BT5 C9B C8B sing N N 77 BT5 C9B H9B1 sing N N 78 BT5 C9B H9B2 sing N N 79 BT5 C8B C7B sing N N 80 BT5 C8B H8B1 sing N N 81 BT5 C8B H8B2 sing N N 82 BT5 C7B C2B sing N N 83 BT5 C7B H7B1 sing N N 84 BT5 C7B H7B2 sing N N 85 BT5 C2B S1B sing N N 86 BT5 C2B C4B sing N N 87 BT5 C2B H2B sing N N 88 BT5 S1B C6B sing N N 89 BT5 C6B C5B sing N N 90 BT5 C6B H6B1 sing N N 91 BT5 C6B H6B2 sing N N 92 BT5 C5B N1B sing N N 93 BT5 C5B C4B sing N N 94 BT5 C5B H5B sing N N 95 BT5 N1B C3B sing N N 96 BT5 N1B H1B sing N N 97 BT5 C3B O3B doub N N 98 BT5 C3B N2B sing N N 99 BT5 N2B C4B sing N N 100 BT5 N2B H4 sing N N 101 BT5 C4B H4B sing N N 102 BT5 P OP1 doub N N 103 BT5 P OP2 sing N N 104 BT5 P "O5'" sing N N 105 BT5 OP2 H2P sing N N 106 BT5 "O5'" "C5'" sing N N 107 BT5 "C5'" "C4'" sing N N 108 BT5 "C5'" "H5'" sing N N 109 BT5 "C5'" "H5''" sing N N 110 BT5 "C4'" "O4'" sing N N 111 BT5 "C4'" "C3'" sing N N 112 BT5 "C4'" "H4'" sing N N 113 BT5 "O4'" "C1'" sing N N 114 BT5 "C3'" "O3'" sing N N 115 BT5 "C3'" "C2'" sing N N 116 BT5 "C3'" "H3'" sing N N 117 BT5 "O3'" H2 sing N N 118 BT5 "C2'" "O2'" sing N N 119 BT5 "C2'" "C1'" sing N N 120 BT5 "C2'" H1 sing N N 121 BT5 "O2'" "H2'" sing N N 122 BT5 "C1'" N9 sing N N 123 BT5 "C1'" "H1'" sing N N 124 BT5 N9 C8 sing Y N 125 BT5 N9 C4 sing Y N 126 BT5 C8 N7 doub Y N 127 BT5 C8 H8 sing N N 128 BT5 N7 C5 sing Y N 129 BT5 C5 C6 doub Y N 130 BT5 C5 C4 sing Y N 131 BT5 C6 N6 sing N N 132 BT5 C6 N1 sing Y N 133 BT5 N6 HN61 sing N N 134 BT5 N6 HN62 sing N N 135 BT5 N1 C2 doub Y N 136 BT5 C2 N3 sing Y N 137 BT5 C2 H3 sing N N 138 BT5 N3 C4 doub Y N 139 CYS N CA sing N N 140 CYS N H sing N N 141 CYS N H2 sing N N 142 CYS CA C sing N N 143 CYS CA CB sing N N 144 CYS CA HA sing N N 145 CYS C O doub N N 146 CYS C OXT sing N N 147 CYS CB SG sing N N 148 CYS CB HB2 sing N N 149 CYS CB HB3 sing N N 150 CYS SG HG sing N N 151 CYS OXT HXT sing N N 152 GLN N CA sing N N 153 GLN N H sing N N 154 GLN N H2 sing N N 155 GLN CA C sing N N 156 GLN CA CB sing N N 157 GLN CA HA sing N N 158 GLN C O doub N N 159 GLN C OXT sing N N 160 GLN CB CG sing N N 161 GLN CB HB2 sing N N 162 GLN CB HB3 sing N N 163 GLN CG CD sing N N 164 GLN CG HG2 sing N N 165 GLN CG HG3 sing N N 166 GLN CD OE1 doub N N 167 GLN CD NE2 sing N N 168 GLN NE2 HE21 sing N N 169 GLN NE2 HE22 sing N N 170 GLN OXT HXT sing N N 171 GLU N CA sing N N 172 GLU N H sing N N 173 GLU N H2 sing N N 174 GLU CA C sing N N 175 GLU CA CB sing N N 176 GLU CA HA sing N N 177 GLU C O doub N N 178 GLU C OXT sing N N 179 GLU CB CG sing N N 180 GLU CB HB2 sing N N 181 GLU CB HB3 sing N N 182 GLU CG CD sing N N 183 GLU CG HG2 sing N N 184 GLU CG HG3 sing N N 185 GLU CD OE1 doub N N 186 GLU CD OE2 sing N N 187 GLU OE2 HE2 sing N N 188 GLU OXT HXT sing N N 189 GLY N CA sing N N 190 GLY N H sing N N 191 GLY N H2 sing N N 192 GLY CA C sing N N 193 GLY CA HA2 sing N N 194 GLY CA HA3 sing N N 195 GLY C O doub N N 196 GLY C OXT sing N N 197 GLY OXT HXT sing N N 198 HIS N CA sing N N 199 HIS N H sing N N 200 HIS N H2 sing N N 201 HIS CA C sing N N 202 HIS CA CB sing N N 203 HIS CA HA sing N N 204 HIS C O doub N N 205 HIS C OXT sing N N 206 HIS CB CG sing N N 207 HIS CB HB2 sing N N 208 HIS CB HB3 sing N N 209 HIS CG ND1 sing Y N 210 HIS CG CD2 doub Y N 211 HIS ND1 CE1 doub Y N 212 HIS ND1 HD1 sing N N 213 HIS CD2 NE2 sing Y N 214 HIS CD2 HD2 sing N N 215 HIS CE1 NE2 sing Y N 216 HIS CE1 HE1 sing N N 217 HIS NE2 HE2 sing N N 218 HIS OXT HXT sing N N 219 HOH O H1 sing N N 220 HOH O H2 sing N N 221 ILE N CA sing N N 222 ILE N H sing N N 223 ILE N H2 sing N N 224 ILE CA C sing N N 225 ILE CA CB sing N N 226 ILE CA HA sing N N 227 ILE C O doub N N 228 ILE C OXT sing N N 229 ILE CB CG1 sing N N 230 ILE CB CG2 sing N N 231 ILE CB HB sing N N 232 ILE CG1 CD1 sing N N 233 ILE CG1 HG12 sing N N 234 ILE CG1 HG13 sing N N 235 ILE CG2 HG21 sing N N 236 ILE CG2 HG22 sing N N 237 ILE CG2 HG23 sing N N 238 ILE CD1 HD11 sing N N 239 ILE CD1 HD12 sing N N 240 ILE CD1 HD13 sing N N 241 ILE OXT HXT sing N N 242 LEU N CA sing N N 243 LEU N H sing N N 244 LEU N H2 sing N N 245 LEU CA C sing N N 246 LEU CA CB sing N N 247 LEU CA HA sing N N 248 LEU C O doub N N 249 LEU C OXT sing N N 250 LEU CB CG sing N N 251 LEU CB HB2 sing N N 252 LEU CB HB3 sing N N 253 LEU CG CD1 sing N N 254 LEU CG CD2 sing N N 255 LEU CG HG sing N N 256 LEU CD1 HD11 sing N N 257 LEU CD1 HD12 sing N N 258 LEU CD1 HD13 sing N N 259 LEU CD2 HD21 sing N N 260 LEU CD2 HD22 sing N N 261 LEU CD2 HD23 sing N N 262 LEU OXT HXT sing N N 263 LYS N CA sing N N 264 LYS N H sing N N 265 LYS N H2 sing N N 266 LYS CA C sing N N 267 LYS CA CB sing N N 268 LYS CA HA sing N N 269 LYS C O doub N N 270 LYS C OXT sing N N 271 LYS CB CG sing N N 272 LYS CB HB2 sing N N 273 LYS CB HB3 sing N N 274 LYS CG CD sing N N 275 LYS CG HG2 sing N N 276 LYS CG HG3 sing N N 277 LYS CD CE sing N N 278 LYS CD HD2 sing N N 279 LYS CD HD3 sing N N 280 LYS CE NZ sing N N 281 LYS CE HE2 sing N N 282 LYS CE HE3 sing N N 283 LYS NZ HZ1 sing N N 284 LYS NZ HZ2 sing N N 285 LYS NZ HZ3 sing N N 286 LYS OXT HXT sing N N 287 MET N CA sing N N 288 MET N H sing N N 289 MET N H2 sing N N 290 MET CA C sing N N 291 MET CA CB sing N N 292 MET CA HA sing N N 293 MET C O doub N N 294 MET C OXT sing N N 295 MET CB CG sing N N 296 MET CB HB2 sing N N 297 MET CB HB3 sing N N 298 MET CG SD sing N N 299 MET CG HG2 sing N N 300 MET CG HG3 sing N N 301 MET SD CE sing N N 302 MET CE HE1 sing N N 303 MET CE HE2 sing N N 304 MET CE HE3 sing N N 305 MET OXT HXT sing N N 306 PHE N CA sing N N 307 PHE N H sing N N 308 PHE N H2 sing N N 309 PHE CA C sing N N 310 PHE CA CB sing N N 311 PHE CA HA sing N N 312 PHE C O doub N N 313 PHE C OXT sing N N 314 PHE CB CG sing N N 315 PHE CB HB2 sing N N 316 PHE CB HB3 sing N N 317 PHE CG CD1 doub Y N 318 PHE CG CD2 sing Y N 319 PHE CD1 CE1 sing Y N 320 PHE CD1 HD1 sing N N 321 PHE CD2 CE2 doub Y N 322 PHE CD2 HD2 sing N N 323 PHE CE1 CZ doub Y N 324 PHE CE1 HE1 sing N N 325 PHE CE2 CZ sing Y N 326 PHE CE2 HE2 sing N N 327 PHE CZ HZ sing N N 328 PHE OXT HXT sing N N 329 PRO N CA sing N N 330 PRO N CD sing N N 331 PRO N H sing N N 332 PRO CA C sing N N 333 PRO CA CB sing N N 334 PRO CA HA sing N N 335 PRO C O doub N N 336 PRO C OXT sing N N 337 PRO CB CG sing N N 338 PRO CB HB2 sing N N 339 PRO CB HB3 sing N N 340 PRO CG CD sing N N 341 PRO CG HG2 sing N N 342 PRO CG HG3 sing N N 343 PRO CD HD2 sing N N 344 PRO CD HD3 sing N N 345 PRO OXT HXT sing N N 346 SER N CA sing N N 347 SER N H sing N N 348 SER N H2 sing N N 349 SER CA C sing N N 350 SER CA CB sing N N 351 SER CA HA sing N N 352 SER C O doub N N 353 SER C OXT sing N N 354 SER CB OG sing N N 355 SER CB HB2 sing N N 356 SER CB HB3 sing N N 357 SER OG HG sing N N 358 SER OXT HXT sing N N 359 SO4 S O1 doub N N 360 SO4 S O2 doub N N 361 SO4 S O3 sing N N 362 SO4 S O4 sing N N 363 THR N CA sing N N 364 THR N H sing N N 365 THR N H2 sing N N 366 THR CA C sing N N 367 THR CA CB sing N N 368 THR CA HA sing N N 369 THR C O doub N N 370 THR C OXT sing N N 371 THR CB OG1 sing N N 372 THR CB CG2 sing N N 373 THR CB HB sing N N 374 THR OG1 HG1 sing N N 375 THR CG2 HG21 sing N N 376 THR CG2 HG22 sing N N 377 THR CG2 HG23 sing N N 378 THR OXT HXT sing N N 379 TRP N CA sing N N 380 TRP N H sing N N 381 TRP N H2 sing N N 382 TRP CA C sing N N 383 TRP CA CB sing N N 384 TRP CA HA sing N N 385 TRP C O doub N N 386 TRP C OXT sing N N 387 TRP CB CG sing N N 388 TRP CB HB2 sing N N 389 TRP CB HB3 sing N N 390 TRP CG CD1 doub Y N 391 TRP CG CD2 sing Y N 392 TRP CD1 NE1 sing Y N 393 TRP CD1 HD1 sing N N 394 TRP CD2 CE2 doub Y N 395 TRP CD2 CE3 sing Y N 396 TRP NE1 CE2 sing Y N 397 TRP NE1 HE1 sing N N 398 TRP CE2 CZ2 sing Y N 399 TRP CE3 CZ3 doub Y N 400 TRP CE3 HE3 sing N N 401 TRP CZ2 CH2 doub Y N 402 TRP CZ2 HZ2 sing N N 403 TRP CZ3 CH2 sing Y N 404 TRP CZ3 HZ3 sing N N 405 TRP CH2 HH2 sing N N 406 TRP OXT HXT sing N N 407 TYR N CA sing N N 408 TYR N H sing N N 409 TYR N H2 sing N N 410 TYR CA C sing N N 411 TYR CA CB sing N N 412 TYR CA HA sing N N 413 TYR C O doub N N 414 TYR C OXT sing N N 415 TYR CB CG sing N N 416 TYR CB HB2 sing N N 417 TYR CB HB3 sing N N 418 TYR CG CD1 doub Y N 419 TYR CG CD2 sing Y N 420 TYR CD1 CE1 sing Y N 421 TYR CD1 HD1 sing N N 422 TYR CD2 CE2 doub Y N 423 TYR CD2 HD2 sing N N 424 TYR CE1 CZ doub Y N 425 TYR CE1 HE1 sing N N 426 TYR CE2 CZ sing Y N 427 TYR CE2 HE2 sing N N 428 TYR CZ OH sing N N 429 TYR OH HH sing N N 430 TYR OXT HXT sing N N 431 VAL N CA sing N N 432 VAL N H sing N N 433 VAL N H2 sing N N 434 VAL CA C sing N N 435 VAL CA CB sing N N 436 VAL CA HA sing N N 437 VAL C O doub N N 438 VAL C OXT sing N N 439 VAL CB CG1 sing N N 440 VAL CB CG2 sing N N 441 VAL CB HB sing N N 442 VAL CG1 HG11 sing N N 443 VAL CG1 HG12 sing N N 444 VAL CG1 HG13 sing N N 445 VAL CG2 HG21 sing N N 446 VAL CG2 HG22 sing N N 447 VAL CG2 HG23 sing N N 448 VAL OXT HXT sing N N 449 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BT5 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BT5 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 BIOTINYL-5-AMP BT5 3 'SULFATE ION' SO4 4 water HOH # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 2EJ9 '2ej9, 2dxu' 2 ? 'experimental model' PDB 2DXU '2ej9, 2dxu' #