data_6JMX # _entry.id 6JMX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JMX pdb_00006jmx 10.2210/pdb6jmx/pdb WWPDB D_1300011402 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-15 2 'Structure model' 1 1 2020-02-05 3 'Structure model' 1 2 2022-03-23 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_audit_support 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' 10 3 'Structure model' '_pdbx_audit_support.funding_organization' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JMX _pdbx_database_status.recvd_initial_deposition_date 2019-03-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Min, K.J.' 1 0000-0002-9864-2022 'An, D.R.' 2 ? 'Yoon, H.J.' 3 ? 'Suh, S.W.' 4 ? 'Lee, H.H.' 5 0000-0003-1168-2484 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 458 _citation.page_last 458 _citation.title 'Peptidoglycan reshaping by a noncanonical peptidase for helical cell shape in Campylobacter jejuni.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-019-13934-4 _citation.pdbx_database_id_PubMed 31974386 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Min, K.' 1 0000-0002-9864-2022 primary 'An, D.R.' 2 ? primary 'Yoon, H.J.' 3 ? primary 'Rana, N.' 4 ? primary 'Park, J.S.' 5 ? primary 'Kim, J.' 6 ? primary 'Lee, M.' 7 0000-0001-7432-0427 primary 'Hesek, D.' 8 ? primary 'Ryu, S.' 9 0000-0001-5812-3394 primary 'Kim, B.M.' 10 ? primary 'Mobashery, S.' 11 ? primary 'Suh, S.W.' 12 ? primary 'Lee, H.H.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidase M23' 29488.807 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'D(-)-TARTARIC ACID' 150.087 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 5 water nat water 18.015 242 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSE KLQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGT PIYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPHLHFGILAGGKQV DPLDFVSKFNAIFQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSE KLQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGT PIYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPHLHFGILAGGKQV DPLDFVSKFNAIFQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'D(-)-TARTARIC ACID' TAR 4 GLYCEROL GOL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LEU n 1 4 ILE n 1 5 LYS n 1 6 GLY n 1 7 GLN n 1 8 ALA n 1 9 LEU n 1 10 PHE n 1 11 LEU n 1 12 GLU n 1 13 LEU n 1 14 ASP n 1 15 LYS n 1 16 LYS n 1 17 ASP n 1 18 PHE n 1 19 LEU n 1 20 SER n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 ASN n 1 25 ASP n 1 26 LYS n 1 27 ASN n 1 28 ILE n 1 29 PRO n 1 30 THR n 1 31 PHE n 1 32 ALA n 1 33 HIS n 1 34 PRO n 1 35 LYS n 1 36 ASN n 1 37 GLN n 1 38 GLU n 1 39 LYS n 1 40 ILE n 1 41 LEU n 1 42 ALA n 1 43 ILE n 1 44 PHE n 1 45 SER n 1 46 LEU n 1 47 PRO n 1 48 TYR n 1 49 LYS n 1 50 ASN n 1 51 PRO n 1 52 PRO n 1 53 GLN n 1 54 ASN n 1 55 THR n 1 56 LYS n 1 57 LEU n 1 58 ILE n 1 59 ALA n 1 60 PHE n 1 61 TYR n 1 62 LYS n 1 63 ASP n 1 64 LYS n 1 65 LYS n 1 66 GLU n 1 67 GLU n 1 68 ILE n 1 69 PHE n 1 70 ILE n 1 71 LYS n 1 72 THR n 1 73 LEU n 1 74 GLU n 1 75 GLY n 1 76 ASN n 1 77 TYR n 1 78 LYS n 1 79 SER n 1 80 GLU n 1 81 LYS n 1 82 LEU n 1 83 GLN n 1 84 VAL n 1 85 GLU n 1 86 ASN n 1 87 LYS n 1 88 LYS n 1 89 ILE n 1 90 PHE n 1 91 PRO n 1 92 PRO n 1 93 LYS n 1 94 THR n 1 95 ILE n 1 96 GLN n 1 97 GLU n 1 98 ARG n 1 99 ILE n 1 100 ALA n 1 101 LYS n 1 102 GLU n 1 103 LEU n 1 104 LYS n 1 105 GLU n 1 106 ALA n 1 107 ASN n 1 108 ALA n 1 109 ILE n 1 110 TYR n 1 111 SER n 1 112 SER n 1 113 TYR n 1 114 THR n 1 115 PRO n 1 116 LYS n 1 117 ALA n 1 118 LEU n 1 119 PHE n 1 120 ASN n 1 121 GLY n 1 122 ALA n 1 123 PHE n 1 124 ASN n 1 125 ILE n 1 126 PRO n 1 127 LEU n 1 128 ASN n 1 129 SER n 1 130 PHE n 1 131 ILE n 1 132 THR n 1 133 SER n 1 134 ASP n 1 135 PHE n 1 136 GLY n 1 137 LYS n 1 138 ALA n 1 139 ARG n 1 140 THR n 1 141 PHE n 1 142 ASN n 1 143 GLU n 1 144 LYS n 1 145 VAL n 1 146 ALA n 1 147 SER n 1 148 TYR n 1 149 HIS n 1 150 SER n 1 151 GLY n 1 152 THR n 1 153 ASP n 1 154 PHE n 1 155 ARG n 1 156 ALA n 1 157 ALA n 1 158 THR n 1 159 GLY n 1 160 THR n 1 161 PRO n 1 162 ILE n 1 163 TYR n 1 164 ALA n 1 165 ALA n 1 166 ASN n 1 167 SER n 1 168 GLY n 1 169 VAL n 1 170 VAL n 1 171 LYS n 1 172 ILE n 1 173 ALA n 1 174 LYS n 1 175 ASP n 1 176 ARG n 1 177 TYR n 1 178 PHE n 1 179 ALA n 1 180 GLY n 1 181 ASN n 1 182 SER n 1 183 VAL n 1 184 VAL n 1 185 ILE n 1 186 ASP n 1 187 HIS n 1 188 GLY n 1 189 PHE n 1 190 GLY n 1 191 ILE n 1 192 TYR n 1 193 SER n 1 194 GLN n 1 195 TYR n 1 196 TYR n 1 197 HIS n 1 198 LEU n 1 199 SER n 1 200 LYS n 1 201 ILE n 1 202 ASP n 1 203 VAL n 1 204 LYS n 1 205 VAL n 1 206 GLY n 1 207 GLN n 1 208 LYS n 1 209 ILE n 1 210 LYS n 1 211 LYS n 1 212 GLY n 1 213 GLU n 1 214 LEU n 1 215 ILE n 1 216 GLY n 1 217 LEU n 1 218 SER n 1 219 GLY n 1 220 ALA n 1 221 SER n 1 222 GLY n 1 223 ARG n 1 224 VAL n 1 225 SER n 1 226 GLY n 1 227 PRO n 1 228 HIS n 1 229 LEU n 1 230 HIS n 1 231 PHE n 1 232 GLY n 1 233 ILE n 1 234 LEU n 1 235 ALA n 1 236 GLY n 1 237 GLY n 1 238 LYS n 1 239 GLN n 1 240 VAL n 1 241 ASP n 1 242 PRO n 1 243 LEU n 1 244 ASP n 1 245 PHE n 1 246 VAL n 1 247 SER n 1 248 LYS n 1 249 PHE n 1 250 ASN n 1 251 ALA n 1 252 ILE n 1 253 PHE n 1 254 GLN n 1 255 LEU n 1 256 GLU n 1 257 HIS n 1 258 HIS n 1 259 HIS n 1 260 HIS n 1 261 HIS n 1 262 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 262 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene A8118_01115 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Campylobacter jejuni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 197 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TAR non-polymer . 'D(-)-TARTARIC ACID' ? 'C4 H6 O6' 150.087 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 20 20 MET MET A . n A 1 2 GLU 2 21 21 GLU GLU A . n A 1 3 LEU 3 22 22 LEU LEU A . n A 1 4 ILE 4 23 23 ILE ILE A . n A 1 5 LYS 5 24 24 LYS LYS A . n A 1 6 GLY 6 25 25 GLY GLY A . n A 1 7 GLN 7 26 26 GLN GLN A . n A 1 8 ALA 8 27 27 ALA ALA A . n A 1 9 LEU 9 28 28 LEU LEU A . n A 1 10 PHE 10 29 29 PHE PHE A . n A 1 11 LEU 11 30 30 LEU LEU A . n A 1 12 GLU 12 31 31 GLU GLU A . n A 1 13 LEU 13 32 32 LEU LEU A . n A 1 14 ASP 14 33 33 ASP ASP A . n A 1 15 LYS 15 34 34 LYS LYS A . n A 1 16 LYS 16 35 35 LYS LYS A . n A 1 17 ASP 17 36 36 ASP ASP A . n A 1 18 PHE 18 37 37 PHE PHE A . n A 1 19 LEU 19 38 38 LEU LEU A . n A 1 20 SER 20 39 39 SER SER A . n A 1 21 LEU 21 40 40 LEU LEU A . n A 1 22 LYS 22 41 41 LYS LYS A . n A 1 23 ASN 23 42 42 ASN ASN A . n A 1 24 ASN 24 43 43 ASN ASN A . n A 1 25 ASP 25 44 44 ASP ASP A . n A 1 26 LYS 26 45 45 LYS LYS A . n A 1 27 ASN 27 46 46 ASN ASN A . n A 1 28 ILE 28 47 47 ILE ILE A . n A 1 29 PRO 29 48 48 PRO PRO A . n A 1 30 THR 30 49 49 THR THR A . n A 1 31 PHE 31 50 50 PHE PHE A . n A 1 32 ALA 32 51 51 ALA ALA A . n A 1 33 HIS 33 52 52 HIS HIS A . n A 1 34 PRO 34 53 53 PRO PRO A . n A 1 35 LYS 35 54 54 LYS LYS A . n A 1 36 ASN 36 55 55 ASN ASN A . n A 1 37 GLN 37 56 56 GLN GLN A . n A 1 38 GLU 38 57 57 GLU GLU A . n A 1 39 LYS 39 58 58 LYS LYS A . n A 1 40 ILE 40 59 59 ILE ILE A . n A 1 41 LEU 41 60 60 LEU LEU A . n A 1 42 ALA 42 61 61 ALA ALA A . n A 1 43 ILE 43 62 62 ILE ILE A . n A 1 44 PHE 44 63 63 PHE PHE A . n A 1 45 SER 45 64 64 SER SER A . n A 1 46 LEU 46 65 65 LEU LEU A . n A 1 47 PRO 47 66 66 PRO PRO A . n A 1 48 TYR 48 67 67 TYR TYR A . n A 1 49 LYS 49 68 68 LYS LYS A . n A 1 50 ASN 50 69 69 ASN ASN A . n A 1 51 PRO 51 70 70 PRO PRO A . n A 1 52 PRO 52 71 71 PRO PRO A . n A 1 53 GLN 53 72 72 GLN GLN A . n A 1 54 ASN 54 73 73 ASN ASN A . n A 1 55 THR 55 74 74 THR THR A . n A 1 56 LYS 56 75 75 LYS LYS A . n A 1 57 LEU 57 76 76 LEU LEU A . n A 1 58 ILE 58 77 77 ILE ILE A . n A 1 59 ALA 59 78 78 ALA ALA A . n A 1 60 PHE 60 79 79 PHE PHE A . n A 1 61 TYR 61 80 80 TYR TYR A . n A 1 62 LYS 62 81 81 LYS LYS A . n A 1 63 ASP 63 82 82 ASP ASP A . n A 1 64 LYS 64 83 83 LYS LYS A . n A 1 65 LYS 65 84 84 LYS LYS A . n A 1 66 GLU 66 85 85 GLU GLU A . n A 1 67 GLU 67 86 86 GLU GLU A . n A 1 68 ILE 68 87 87 ILE ILE A . n A 1 69 PHE 69 88 88 PHE PHE A . n A 1 70 ILE 70 89 89 ILE ILE A . n A 1 71 LYS 71 90 90 LYS LYS A . n A 1 72 THR 72 91 91 THR THR A . n A 1 73 LEU 73 92 92 LEU LEU A . n A 1 74 GLU 74 93 93 GLU GLU A . n A 1 75 GLY 75 94 94 GLY GLY A . n A 1 76 ASN 76 95 95 ASN ASN A . n A 1 77 TYR 77 96 96 TYR TYR A . n A 1 78 LYS 78 97 97 LYS LYS A . n A 1 79 SER 79 98 98 SER SER A . n A 1 80 GLU 80 99 99 GLU GLU A . n A 1 81 LYS 81 100 100 LYS LYS A . n A 1 82 LEU 82 101 101 LEU LEU A . n A 1 83 GLN 83 102 102 GLN GLN A . n A 1 84 VAL 84 103 103 VAL VAL A . n A 1 85 GLU 85 104 104 GLU GLU A . n A 1 86 ASN 86 105 105 ASN ASN A . n A 1 87 LYS 87 106 106 LYS LYS A . n A 1 88 LYS 88 107 107 LYS LYS A . n A 1 89 ILE 89 108 108 ILE ILE A . n A 1 90 PHE 90 109 109 PHE PHE A . n A 1 91 PRO 91 110 110 PRO PRO A . n A 1 92 PRO 92 111 111 PRO PRO A . n A 1 93 LYS 93 112 112 LYS LYS A . n A 1 94 THR 94 113 113 THR THR A . n A 1 95 ILE 95 114 114 ILE ILE A . n A 1 96 GLN 96 115 115 GLN GLN A . n A 1 97 GLU 97 116 116 GLU GLU A . n A 1 98 ARG 98 117 117 ARG ARG A . n A 1 99 ILE 99 118 118 ILE ILE A . n A 1 100 ALA 100 119 119 ALA ALA A . n A 1 101 LYS 101 120 120 LYS LYS A . n A 1 102 GLU 102 121 121 GLU GLU A . n A 1 103 LEU 103 122 122 LEU LEU A . n A 1 104 LYS 104 123 123 LYS LYS A . n A 1 105 GLU 105 124 124 GLU GLU A . n A 1 106 ALA 106 125 125 ALA ALA A . n A 1 107 ASN 107 126 126 ASN ASN A . n A 1 108 ALA 108 127 127 ALA ALA A . n A 1 109 ILE 109 128 128 ILE ILE A . n A 1 110 TYR 110 129 129 TYR TYR A . n A 1 111 SER 111 130 130 SER SER A . n A 1 112 SER 112 131 131 SER SER A . n A 1 113 TYR 113 132 132 TYR TYR A . n A 1 114 THR 114 133 133 THR THR A . n A 1 115 PRO 115 134 134 PRO PRO A . n A 1 116 LYS 116 135 135 LYS LYS A . n A 1 117 ALA 117 136 136 ALA ALA A . n A 1 118 LEU 118 137 137 LEU LEU A . n A 1 119 PHE 119 138 138 PHE PHE A . n A 1 120 ASN 120 139 139 ASN ASN A . n A 1 121 GLY 121 140 140 GLY GLY A . n A 1 122 ALA 122 141 141 ALA ALA A . n A 1 123 PHE 123 142 142 PHE PHE A . n A 1 124 ASN 124 143 143 ASN ASN A . n A 1 125 ILE 125 144 144 ILE ILE A . n A 1 126 PRO 126 145 145 PRO PRO A . n A 1 127 LEU 127 146 146 LEU LEU A . n A 1 128 ASN 128 147 147 ASN ASN A . n A 1 129 SER 129 148 148 SER SER A . n A 1 130 PHE 130 149 149 PHE PHE A . n A 1 131 ILE 131 150 150 ILE ILE A . n A 1 132 THR 132 151 151 THR THR A . n A 1 133 SER 133 152 152 SER SER A . n A 1 134 ASP 134 153 153 ASP ASP A . n A 1 135 PHE 135 154 154 PHE PHE A . n A 1 136 GLY 136 155 155 GLY GLY A . n A 1 137 LYS 137 156 156 LYS LYS A . n A 1 138 ALA 138 157 157 ALA ALA A . n A 1 139 ARG 139 158 158 ARG ARG A . n A 1 140 THR 140 159 159 THR THR A . n A 1 141 PHE 141 160 160 PHE PHE A . n A 1 142 ASN 142 161 161 ASN ASN A . n A 1 143 GLU 143 162 162 GLU GLU A . n A 1 144 LYS 144 163 163 LYS LYS A . n A 1 145 VAL 145 164 164 VAL VAL A . n A 1 146 ALA 146 165 165 ALA ALA A . n A 1 147 SER 147 166 166 SER SER A . n A 1 148 TYR 148 167 167 TYR TYR A . n A 1 149 HIS 149 168 168 HIS HIS A . n A 1 150 SER 150 169 169 SER SER A . n A 1 151 GLY 151 170 170 GLY GLY A . n A 1 152 THR 152 171 171 THR THR A . n A 1 153 ASP 153 172 172 ASP ASP A . n A 1 154 PHE 154 173 173 PHE PHE A . n A 1 155 ARG 155 174 174 ARG ARG A . n A 1 156 ALA 156 175 175 ALA ALA A . n A 1 157 ALA 157 176 176 ALA ALA A . n A 1 158 THR 158 177 177 THR THR A . n A 1 159 GLY 159 178 178 GLY GLY A . n A 1 160 THR 160 179 179 THR THR A . n A 1 161 PRO 161 180 180 PRO PRO A . n A 1 162 ILE 162 181 181 ILE ILE A . n A 1 163 TYR 163 182 182 TYR TYR A . n A 1 164 ALA 164 183 183 ALA ALA A . n A 1 165 ALA 165 184 184 ALA ALA A . n A 1 166 ASN 166 185 185 ASN ASN A . n A 1 167 SER 167 186 186 SER SER A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 VAL 169 188 188 VAL VAL A . n A 1 170 VAL 170 189 189 VAL VAL A . n A 1 171 LYS 171 190 190 LYS LYS A . n A 1 172 ILE 172 191 191 ILE ILE A . n A 1 173 ALA 173 192 192 ALA ALA A . n A 1 174 LYS 174 193 193 LYS LYS A . n A 1 175 ASP 175 194 194 ASP ASP A . n A 1 176 ARG 176 195 195 ARG ARG A . n A 1 177 TYR 177 196 196 TYR TYR A . n A 1 178 PHE 178 197 197 PHE PHE A . n A 1 179 ALA 179 198 198 ALA ALA A . n A 1 180 GLY 180 199 199 GLY GLY A . n A 1 181 ASN 181 200 200 ASN ASN A . n A 1 182 SER 182 201 201 SER SER A . n A 1 183 VAL 183 202 202 VAL VAL A . n A 1 184 VAL 184 203 203 VAL VAL A . n A 1 185 ILE 185 204 204 ILE ILE A . n A 1 186 ASP 186 205 205 ASP ASP A . n A 1 187 HIS 187 206 206 HIS HIS A . n A 1 188 GLY 188 207 207 GLY GLY A . n A 1 189 PHE 189 208 208 PHE PHE A . n A 1 190 GLY 190 209 209 GLY GLY A . n A 1 191 ILE 191 210 210 ILE ILE A . n A 1 192 TYR 192 211 211 TYR TYR A . n A 1 193 SER 193 212 212 SER SER A . n A 1 194 GLN 194 213 213 GLN GLN A . n A 1 195 TYR 195 214 214 TYR TYR A . n A 1 196 TYR 196 215 215 TYR TYR A . n A 1 197 HIS 197 216 216 HIS HIS A . n A 1 198 LEU 198 217 217 LEU LEU A . n A 1 199 SER 199 218 218 SER SER A . n A 1 200 LYS 200 219 219 LYS LYS A . n A 1 201 ILE 201 220 220 ILE ILE A . n A 1 202 ASP 202 221 221 ASP ASP A . n A 1 203 VAL 203 222 222 VAL VAL A . n A 1 204 LYS 204 223 223 LYS LYS A . n A 1 205 VAL 205 224 224 VAL VAL A . n A 1 206 GLY 206 225 225 GLY GLY A . n A 1 207 GLN 207 226 226 GLN GLN A . n A 1 208 LYS 208 227 227 LYS LYS A . n A 1 209 ILE 209 228 228 ILE ILE A . n A 1 210 LYS 210 229 229 LYS LYS A . n A 1 211 LYS 211 230 230 LYS LYS A . n A 1 212 GLY 212 231 231 GLY GLY A . n A 1 213 GLU 213 232 232 GLU GLU A . n A 1 214 LEU 214 233 233 LEU LEU A . n A 1 215 ILE 215 234 234 ILE ILE A . n A 1 216 GLY 216 235 235 GLY GLY A . n A 1 217 LEU 217 236 236 LEU LEU A . n A 1 218 SER 218 237 237 SER SER A . n A 1 219 GLY 219 238 238 GLY GLY A . n A 1 220 ALA 220 239 239 ALA ALA A . n A 1 221 SER 221 240 240 SER SER A . n A 1 222 GLY 222 241 241 GLY GLY A . n A 1 223 ARG 223 242 242 ARG ARG A . n A 1 224 VAL 224 243 243 VAL VAL A . n A 1 225 SER 225 244 244 SER SER A . n A 1 226 GLY 226 245 245 GLY GLY A . n A 1 227 PRO 227 246 246 PRO PRO A . n A 1 228 HIS 228 247 247 HIS HIS A . n A 1 229 LEU 229 248 248 LEU LEU A . n A 1 230 HIS 230 249 249 HIS HIS A . n A 1 231 PHE 231 250 250 PHE PHE A . n A 1 232 GLY 232 251 251 GLY GLY A . n A 1 233 ILE 233 252 252 ILE ILE A . n A 1 234 LEU 234 253 253 LEU LEU A . n A 1 235 ALA 235 254 254 ALA ALA A . n A 1 236 GLY 236 255 255 GLY GLY A . n A 1 237 GLY 237 256 256 GLY GLY A . n A 1 238 LYS 238 257 257 LYS LYS A . n A 1 239 GLN 239 258 258 GLN GLN A . n A 1 240 VAL 240 259 259 VAL VAL A . n A 1 241 ASP 241 260 260 ASP ASP A . n A 1 242 PRO 242 261 261 PRO PRO A . n A 1 243 LEU 243 262 262 LEU LEU A . n A 1 244 ASP 244 263 263 ASP ASP A . n A 1 245 PHE 245 264 264 PHE PHE A . n A 1 246 VAL 246 265 265 VAL VAL A . n A 1 247 SER 247 266 266 SER SER A . n A 1 248 LYS 248 267 267 LYS LYS A . n A 1 249 PHE 249 268 268 PHE PHE A . n A 1 250 ASN 250 269 269 ASN ASN A . n A 1 251 ALA 251 270 270 ALA ALA A . n A 1 252 ILE 252 271 271 ILE ILE A . n A 1 253 PHE 253 272 272 PHE PHE A . n A 1 254 GLN 254 273 273 GLN GLN A . n A 1 255 LEU 255 274 274 LEU LEU A . n A 1 256 GLU 256 275 275 GLU GLU A . n A 1 257 HIS 257 276 ? ? ? A . n A 1 258 HIS 258 277 ? ? ? A . n A 1 259 HIS 259 278 ? ? ? A . n A 1 260 HIS 260 279 ? ? ? A . n A 1 261 HIS 261 280 ? ? ? A . n A 1 262 HIS 262 281 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 300 ZN ZN A . C 3 TAR 1 302 302 TAR TAR A . D 4 GOL 1 303 305 GOL GOL A . E 4 GOL 1 304 306 GOL GOL A . F 4 GOL 1 305 307 GOL GOL A . G 5 HOH 1 401 35 HOH HOH A . G 5 HOH 2 402 41 HOH HOH A . G 5 HOH 3 403 221 HOH HOH A . G 5 HOH 4 404 182 HOH HOH A . G 5 HOH 5 405 169 HOH HOH A . G 5 HOH 6 406 200 HOH HOH A . G 5 HOH 7 407 10 HOH HOH A . G 5 HOH 8 408 86 HOH HOH A . G 5 HOH 9 409 57 HOH HOH A . G 5 HOH 10 410 117 HOH HOH A . G 5 HOH 11 411 113 HOH HOH A . G 5 HOH 12 412 82 HOH HOH A . G 5 HOH 13 413 11 HOH HOH A . G 5 HOH 14 414 5 HOH HOH A . G 5 HOH 15 415 225 HOH HOH A . G 5 HOH 16 416 175 HOH HOH A . G 5 HOH 17 417 216 HOH HOH A . G 5 HOH 18 418 27 HOH HOH A . G 5 HOH 19 419 142 HOH HOH A . G 5 HOH 20 420 242 HOH HOH A . G 5 HOH 21 421 47 HOH HOH A . G 5 HOH 22 422 20 HOH HOH A . G 5 HOH 23 423 177 HOH HOH A . G 5 HOH 24 424 114 HOH HOH A . G 5 HOH 25 425 13 HOH HOH A . G 5 HOH 26 426 138 HOH HOH A . G 5 HOH 27 427 48 HOH HOH A . G 5 HOH 28 428 62 HOH HOH A . G 5 HOH 29 429 132 HOH HOH A . G 5 HOH 30 430 55 HOH HOH A . G 5 HOH 31 431 49 HOH HOH A . G 5 HOH 32 432 162 HOH HOH A . G 5 HOH 33 433 81 HOH HOH A . G 5 HOH 34 434 203 HOH HOH A . G 5 HOH 35 435 78 HOH HOH A . G 5 HOH 36 436 164 HOH HOH A . G 5 HOH 37 437 42 HOH HOH A . G 5 HOH 38 438 54 HOH HOH A . G 5 HOH 39 439 9 HOH HOH A . G 5 HOH 40 440 110 HOH HOH A . G 5 HOH 41 441 178 HOH HOH A . G 5 HOH 42 442 90 HOH HOH A . G 5 HOH 43 443 126 HOH HOH A . G 5 HOH 44 444 244 HOH HOH A . G 5 HOH 45 445 85 HOH HOH A . G 5 HOH 46 446 227 HOH HOH A . G 5 HOH 47 447 99 HOH HOH A . G 5 HOH 48 448 68 HOH HOH A . G 5 HOH 49 449 134 HOH HOH A . G 5 HOH 50 450 226 HOH HOH A . G 5 HOH 51 451 3 HOH HOH A . G 5 HOH 52 452 60 HOH HOH A . G 5 HOH 53 453 45 HOH HOH A . G 5 HOH 54 454 141 HOH HOH A . G 5 HOH 55 455 218 HOH HOH A . G 5 HOH 56 456 22 HOH HOH A . G 5 HOH 57 457 112 HOH HOH A . G 5 HOH 58 458 32 HOH HOH A . G 5 HOH 59 459 173 HOH HOH A . G 5 HOH 60 460 70 HOH HOH A . G 5 HOH 61 461 8 HOH HOH A . G 5 HOH 62 462 166 HOH HOH A . G 5 HOH 63 463 155 HOH HOH A . G 5 HOH 64 464 40 HOH HOH A . G 5 HOH 65 465 34 HOH HOH A . G 5 HOH 66 466 19 HOH HOH A . G 5 HOH 67 467 17 HOH HOH A . G 5 HOH 68 468 37 HOH HOH A . G 5 HOH 69 469 214 HOH HOH A . G 5 HOH 70 470 188 HOH HOH A . G 5 HOH 71 471 118 HOH HOH A . G 5 HOH 72 472 67 HOH HOH A . G 5 HOH 73 473 144 HOH HOH A . G 5 HOH 74 474 1 HOH HOH A . G 5 HOH 75 475 56 HOH HOH A . G 5 HOH 76 476 73 HOH HOH A . G 5 HOH 77 477 119 HOH HOH A . G 5 HOH 78 478 61 HOH HOH A . G 5 HOH 79 479 2 HOH HOH A . G 5 HOH 80 480 18 HOH HOH A . G 5 HOH 81 481 23 HOH HOH A . G 5 HOH 82 482 167 HOH HOH A . G 5 HOH 83 483 154 HOH HOH A . G 5 HOH 84 484 53 HOH HOH A . G 5 HOH 85 485 102 HOH HOH A . G 5 HOH 86 486 190 HOH HOH A . G 5 HOH 87 487 28 HOH HOH A . G 5 HOH 88 488 24 HOH HOH A . G 5 HOH 89 489 92 HOH HOH A . G 5 HOH 90 490 168 HOH HOH A . G 5 HOH 91 491 91 HOH HOH A . G 5 HOH 92 492 84 HOH HOH A . G 5 HOH 93 493 193 HOH HOH A . G 5 HOH 94 494 72 HOH HOH A . G 5 HOH 95 495 74 HOH HOH A . G 5 HOH 96 496 4 HOH HOH A . G 5 HOH 97 497 121 HOH HOH A . G 5 HOH 98 498 29 HOH HOH A . G 5 HOH 99 499 115 HOH HOH A . G 5 HOH 100 500 250 HOH HOH A . G 5 HOH 101 501 83 HOH HOH A . G 5 HOH 102 502 94 HOH HOH A . G 5 HOH 103 503 237 HOH HOH A . G 5 HOH 104 504 201 HOH HOH A . G 5 HOH 105 505 77 HOH HOH A . G 5 HOH 106 506 71 HOH HOH A . G 5 HOH 107 507 208 HOH HOH A . G 5 HOH 108 508 163 HOH HOH A . G 5 HOH 109 509 209 HOH HOH A . G 5 HOH 110 510 139 HOH HOH A . G 5 HOH 111 511 180 HOH HOH A . G 5 HOH 112 512 15 HOH HOH A . G 5 HOH 113 513 181 HOH HOH A . G 5 HOH 114 514 36 HOH HOH A . G 5 HOH 115 515 50 HOH HOH A . G 5 HOH 116 516 39 HOH HOH A . G 5 HOH 117 517 206 HOH HOH A . G 5 HOH 118 518 66 HOH HOH A . G 5 HOH 119 519 148 HOH HOH A . G 5 HOH 120 520 156 HOH HOH A . G 5 HOH 121 521 195 HOH HOH A . G 5 HOH 122 522 107 HOH HOH A . G 5 HOH 123 523 58 HOH HOH A . G 5 HOH 124 524 31 HOH HOH A . G 5 HOH 125 525 26 HOH HOH A . G 5 HOH 126 526 33 HOH HOH A . G 5 HOH 127 527 21 HOH HOH A . G 5 HOH 128 528 220 HOH HOH A . G 5 HOH 129 529 151 HOH HOH A . G 5 HOH 130 530 25 HOH HOH A . G 5 HOH 131 531 127 HOH HOH A . G 5 HOH 132 532 69 HOH HOH A . G 5 HOH 133 533 7 HOH HOH A . G 5 HOH 134 534 46 HOH HOH A . G 5 HOH 135 535 243 HOH HOH A . G 5 HOH 136 536 106 HOH HOH A . G 5 HOH 137 537 158 HOH HOH A . G 5 HOH 138 538 179 HOH HOH A . G 5 HOH 139 539 30 HOH HOH A . G 5 HOH 140 540 104 HOH HOH A . G 5 HOH 141 541 137 HOH HOH A . G 5 HOH 142 542 79 HOH HOH A . G 5 HOH 143 543 191 HOH HOH A . G 5 HOH 144 544 44 HOH HOH A . G 5 HOH 145 545 101 HOH HOH A . G 5 HOH 146 546 51 HOH HOH A . G 5 HOH 147 547 98 HOH HOH A . G 5 HOH 148 548 14 HOH HOH A . G 5 HOH 149 549 59 HOH HOH A . G 5 HOH 150 550 116 HOH HOH A . G 5 HOH 151 551 96 HOH HOH A . G 5 HOH 152 552 232 HOH HOH A . G 5 HOH 153 553 234 HOH HOH A . G 5 HOH 154 554 194 HOH HOH A . G 5 HOH 155 555 105 HOH HOH A . G 5 HOH 156 556 80 HOH HOH A . G 5 HOH 157 557 233 HOH HOH A . G 5 HOH 158 558 38 HOH HOH A . G 5 HOH 159 559 219 HOH HOH A . G 5 HOH 160 560 52 HOH HOH A . G 5 HOH 161 561 64 HOH HOH A . G 5 HOH 162 562 6 HOH HOH A . G 5 HOH 163 563 88 HOH HOH A . G 5 HOH 164 564 16 HOH HOH A . G 5 HOH 165 565 128 HOH HOH A . G 5 HOH 166 566 93 HOH HOH A . G 5 HOH 167 567 197 HOH HOH A . G 5 HOH 168 568 210 HOH HOH A . G 5 HOH 169 569 147 HOH HOH A . G 5 HOH 170 570 213 HOH HOH A . G 5 HOH 171 571 240 HOH HOH A . G 5 HOH 172 572 211 HOH HOH A . G 5 HOH 173 573 224 HOH HOH A . G 5 HOH 174 574 12 HOH HOH A . G 5 HOH 175 575 192 HOH HOH A . G 5 HOH 176 576 248 HOH HOH A . G 5 HOH 177 577 75 HOH HOH A . G 5 HOH 178 578 205 HOH HOH A . G 5 HOH 179 579 185 HOH HOH A . G 5 HOH 180 580 170 HOH HOH A . G 5 HOH 181 581 241 HOH HOH A . G 5 HOH 182 582 131 HOH HOH A . G 5 HOH 183 583 199 HOH HOH A . G 5 HOH 184 584 161 HOH HOH A . G 5 HOH 185 585 125 HOH HOH A . G 5 HOH 186 586 159 HOH HOH A . G 5 HOH 187 587 143 HOH HOH A . G 5 HOH 188 588 184 HOH HOH A . G 5 HOH 189 589 171 HOH HOH A . G 5 HOH 190 590 249 HOH HOH A . G 5 HOH 191 591 247 HOH HOH A . G 5 HOH 192 592 97 HOH HOH A . G 5 HOH 193 593 136 HOH HOH A . G 5 HOH 194 594 239 HOH HOH A . G 5 HOH 195 595 100 HOH HOH A . G 5 HOH 196 596 149 HOH HOH A . G 5 HOH 197 597 212 HOH HOH A . G 5 HOH 198 598 165 HOH HOH A . G 5 HOH 199 599 146 HOH HOH A . G 5 HOH 200 600 176 HOH HOH A . G 5 HOH 201 601 109 HOH HOH A . G 5 HOH 202 602 251 HOH HOH A . G 5 HOH 203 603 108 HOH HOH A . G 5 HOH 204 604 238 HOH HOH A . G 5 HOH 205 605 122 HOH HOH A . G 5 HOH 206 606 235 HOH HOH A . G 5 HOH 207 607 103 HOH HOH A . G 5 HOH 208 608 222 HOH HOH A . G 5 HOH 209 609 183 HOH HOH A . G 5 HOH 210 610 65 HOH HOH A . G 5 HOH 211 611 87 HOH HOH A . G 5 HOH 212 612 189 HOH HOH A . G 5 HOH 213 613 120 HOH HOH A . G 5 HOH 214 614 172 HOH HOH A . G 5 HOH 215 615 236 HOH HOH A . G 5 HOH 216 616 124 HOH HOH A . G 5 HOH 217 617 130 HOH HOH A . G 5 HOH 218 618 111 HOH HOH A . G 5 HOH 219 619 157 HOH HOH A . G 5 HOH 220 620 43 HOH HOH A . G 5 HOH 221 621 150 HOH HOH A . G 5 HOH 222 622 204 HOH HOH A . G 5 HOH 223 623 135 HOH HOH A . G 5 HOH 224 624 245 HOH HOH A . G 5 HOH 225 625 123 HOH HOH A . G 5 HOH 226 626 202 HOH HOH A . G 5 HOH 227 627 152 HOH HOH A . G 5 HOH 228 628 89 HOH HOH A . G 5 HOH 229 629 187 HOH HOH A . G 5 HOH 230 630 196 HOH HOH A . G 5 HOH 231 631 246 HOH HOH A . G 5 HOH 232 632 223 HOH HOH A . G 5 HOH 233 633 95 HOH HOH A . G 5 HOH 234 634 145 HOH HOH A . G 5 HOH 235 635 230 HOH HOH A . G 5 HOH 236 636 133 HOH HOH A . G 5 HOH 237 637 215 HOH HOH A . G 5 HOH 238 638 140 HOH HOH A . G 5 HOH 239 639 186 HOH HOH A . G 5 HOH 240 640 252 HOH HOH A . G 5 HOH 241 641 160 HOH HOH A . G 5 HOH 242 642 228 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6JMX _cell.details ? _cell.formula_units_Z ? _cell.length_a 114.519 _cell.length_a_esd ? _cell.length_b 114.519 _cell.length_b_esd ? _cell.length_c 57.908 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JMX _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JMX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '200mM potassium sodium tartrate, 100mM tri-sodium citrate at pH 5.6, 2M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6JMX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.750 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 85298 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.100 _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.172 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.074 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.750 1.780 ? ? ? ? ? ? 4259 100.000 ? ? ? ? 0.722 ? ? ? ? ? ? ? ? 7.200 ? 0.509 ? ? 0.778 0.288 ? 1 1 0.851 ? 1.780 1.810 ? ? ? ? ? ? 4241 100.000 ? ? ? ? 0.595 ? ? ? ? ? ? ? ? 7.100 ? 0.529 ? ? 0.642 0.239 ? 2 1 0.907 ? 1.810 1.850 ? ? ? ? ? ? 4297 100.000 ? ? ? ? 0.493 ? ? ? ? ? ? ? ? 6.900 ? 0.584 ? ? 0.533 0.200 ? 3 1 0.913 ? 1.850 1.890 ? ? ? ? ? ? 4227 100.000 ? ? ? ? 0.415 ? ? ? ? ? ? ? ? 6.700 ? 0.616 ? ? 0.450 0.173 ? 4 1 0.929 ? 1.890 1.930 ? ? ? ? ? ? 4274 100.000 ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 6.600 ? 0.699 ? ? 0.367 0.142 ? 5 1 0.943 ? 1.930 1.970 ? ? ? ? ? ? 4269 100.000 ? ? ? ? 0.275 ? ? ? ? ? ? ? ? 7.200 ? 0.761 ? ? 0.296 0.110 ? 6 1 0.963 ? 1.970 2.020 ? ? ? ? ? ? 4225 100.000 ? ? ? ? 0.235 ? ? ? ? ? ? ? ? 7.300 ? 0.861 ? ? 0.254 0.094 ? 7 1 0.968 ? 2.020 2.070 ? ? ? ? ? ? 4292 100.000 ? ? ? ? 0.205 ? ? ? ? ? ? ? ? 7.300 ? 0.941 ? ? 0.221 0.082 ? 8 1 0.973 ? 2.070 2.140 ? ? ? ? ? ? 4285 100.000 ? ? ? ? 0.180 ? ? ? ? ? ? ? ? 7.200 ? 1.013 ? ? 0.194 0.072 ? 9 1 0.978 ? 2.140 2.200 ? ? ? ? ? ? 4273 100.000 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? 7.100 ? 1.107 ? ? 0.170 0.064 ? 10 1 0.982 ? 2.200 2.280 ? ? ? ? ? ? 4262 100.000 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 6.700 ? 1.206 ? ? 0.148 0.057 ? 11 1 0.985 ? 2.280 2.380 ? ? ? ? ? ? 4248 100.000 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 6.900 ? 1.293 ? ? 0.136 0.052 ? 12 1 0.987 ? 2.380 2.480 ? ? ? ? ? ? 4258 100.000 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 7.400 ? 1.350 ? ? 0.125 0.046 ? 13 1 0.989 ? 2.480 2.610 ? ? ? ? ? ? 4315 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 7.400 ? 1.422 ? ? 0.112 0.041 ? 14 1 0.992 ? 2.610 2.780 ? ? ? ? ? ? 4233 100.000 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 7.300 ? 1.623 ? ? 0.100 0.037 ? 15 1 0.993 ? 2.780 2.990 ? ? ? ? ? ? 4272 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 6.800 ? 1.727 ? ? 0.091 0.035 ? 16 1 0.993 ? 2.990 3.290 ? ? ? ? ? ? 4269 100.000 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 7.400 ? 1.871 ? ? 0.078 0.028 ? 17 1 0.996 ? 3.290 3.770 ? ? ? ? ? ? 4276 100.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 7.500 ? 2.025 ? ? 0.067 0.024 ? 18 1 0.997 ? 3.770 4.750 ? ? ? ? ? ? 4254 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 7.000 ? 1.782 ? ? 0.056 0.021 ? 19 1 0.998 ? 4.750 50.000 ? ? ? ? ? ? 4269 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 7.400 ? 1.371 ? ? 0.047 0.017 ? 20 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 135.500 _refine.B_iso_mean 44.6564 _refine.B_iso_min 21.540 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JMX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8590 _refine.ls_d_res_low 28.7100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36434 _refine.ls_number_reflns_R_free 1880 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6400 _refine.ls_percent_reflns_R_free 5.1600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1737 _refine.ls_R_factor_R_free 0.1988 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1723 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.4800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8590 _refine_hist.d_res_low 28.7100 _refine_hist.number_atoms_solvent 242 _refine_hist.number_atoms_total 2299 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 256 _refine_hist.pdbx_B_iso_mean_ligand 59.43 _refine_hist.pdbx_B_iso_mean_solvent 50.28 _refine_hist.pdbx_number_atoms_protein 2028 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8590 1.9090 . . 138 2558 98.0000 . . . 0.2812 0.0000 0.2181 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9090 1.9652 . . 126 2672 100.0000 . . . 0.2324 0.0000 0.2036 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9652 2.0286 . . 160 2628 100.0000 . . . 0.2027 0.0000 0.1849 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0286 2.1011 . . 146 2649 100.0000 . . . 0.2287 0.0000 0.1812 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1011 2.1852 . . 123 2669 100.0000 . . . 0.2241 0.0000 0.1854 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1852 2.2846 . . 176 2641 100.0000 . . . 0.2491 0.0000 0.1756 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2846 2.4050 . . 144 2636 99.0000 . . . 0.2234 0.0000 0.1930 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4050 2.5556 . . 109 2688 100.0000 . . . 0.2640 0.0000 0.1923 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5556 2.7528 . . 150 2669 100.0000 . . . 0.2081 0.0000 0.1994 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7528 3.0295 . . 155 2657 100.0000 . . . 0.2633 0.0000 0.1981 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0295 3.4673 . . 165 2661 100.0000 . . . 0.2140 0.0000 0.1805 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4673 4.3659 . . 121 2692 100.0000 . . . 0.1587 0.0000 0.1409 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3659 28.7100 . . 167 2734 99.0000 . . . 0.1508 0.0000 0.1557 . . . . . . . . . . # _struct.entry_id 6JMX _struct.title 'Structure of open form of peptidoglycan peptidase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JMX _struct_keywords.text 'Peptidoglycan, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1J6PWI8_CAMJU _struct_ref.pdbx_db_accession A0A1J6PWI8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSEK LQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGTP IYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPHLHFGILAGGKQVD PLDFVSKFNAIFQ ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JMX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 254 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1J6PWI8 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 273 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 273 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6JMX MET A 1 ? UNP A0A1J6PWI8 ? ? 'initiating methionine' 20 1 1 6JMX LEU A 255 ? UNP A0A1J6PWI8 ? ? 'expression tag' 274 2 1 6JMX GLU A 256 ? UNP A0A1J6PWI8 ? ? 'expression tag' 275 3 1 6JMX HIS A 257 ? UNP A0A1J6PWI8 ? ? 'expression tag' 276 4 1 6JMX HIS A 258 ? UNP A0A1J6PWI8 ? ? 'expression tag' 277 5 1 6JMX HIS A 259 ? UNP A0A1J6PWI8 ? ? 'expression tag' 278 6 1 6JMX HIS A 260 ? UNP A0A1J6PWI8 ? ? 'expression tag' 279 7 1 6JMX HIS A 261 ? UNP A0A1J6PWI8 ? ? 'expression tag' 280 8 1 6JMX HIS A 262 ? UNP A0A1J6PWI8 ? ? 'expression tag' 281 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 70 ? 1 MORE -22 ? 1 'SSA (A^2)' 13400 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 92 ? SER A 111 ? PRO A 111 SER A 130 1 ? 20 HELX_P HELX_P2 AA2 ASP A 241 ? GLN A 254 ? ASP A 260 GLN A 273 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 149 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 168 A ZN 301 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc2 metalc ? ? A ASP 153 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 172 A ZN 301 1_555 ? ? ? ? ? ? ? 2.071 ? ? metalc3 metalc ? ? A HIS 230 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 249 A ZN 301 1_555 ? ? ? ? ? ? ? 2.089 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C TAR . O3 ? ? A ZN 301 A TAR 302 1_555 ? ? ? ? ? ? ? 2.594 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C TAR . O4 ? ? A ZN 301 A TAR 302 1_555 ? ? ? ? ? ? ? 2.157 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 98.6 ? 2 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 109.4 ? 3 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 101.7 ? 4 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O3 ? C TAR . ? A TAR 302 ? 1_555 139.8 ? 5 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O3 ? C TAR . ? A TAR 302 ? 1_555 92.7 ? 6 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O3 ? C TAR . ? A TAR 302 ? 1_555 105.8 ? 7 NE2 ? A HIS 149 ? A HIS 168 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O4 ? C TAR . ? A TAR 302 ? 1_555 88.1 ? 8 OD1 ? A ASP 153 ? A ASP 172 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O4 ? C TAR . ? A TAR 302 ? 1_555 166.9 ? 9 ND1 ? A HIS 230 ? A HIS 249 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O4 ? C TAR . ? A TAR 302 ? 1_555 86.4 ? 10 O3 ? C TAR . ? A TAR 302 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O4 ? C TAR . ? A TAR 302 ? 1_555 75.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 255 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 274 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLU _struct_mon_prot_cis.pdbx_label_seq_id_2 256 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLU _struct_mon_prot_cis.pdbx_auth_seq_id_2 275 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.72 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 3 ? AA4 ? 7 ? AA5 ? 4 ? AA6 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 2 ? ILE A 4 ? GLU A 21 ILE A 23 AA1 2 LYS A 65 ? LEU A 73 ? LYS A 84 LEU A 92 AA1 3 ASN A 54 ? TYR A 61 ? ASN A 73 TYR A 80 AA1 4 PHE A 18 ? ASN A 23 ? PHE A 37 ASN A 42 AA1 5 LYS A 26 ? ILE A 28 ? LYS A 45 ILE A 47 AA2 1 ALA A 8 ? ASP A 14 ? ALA A 27 ASP A 33 AA2 2 LYS A 39 ? SER A 45 ? LYS A 58 SER A 64 AA2 3 PHE A 31 ? ALA A 32 ? PHE A 50 ALA A 51 AA3 1 SER A 79 ? LYS A 81 ? SER A 98 LYS A 100 AA3 2 ALA A 138 ? THR A 140 ? ALA A 157 THR A 159 AA3 3 VAL A 145 ? TYR A 148 ? VAL A 164 TYR A 167 AA4 1 ILE A 131 ? SER A 133 ? ILE A 150 SER A 152 AA4 2 THR A 152 ? PHE A 154 ? THR A 171 PHE A 173 AA4 3 LEU A 229 ? ALA A 235 ? LEU A 248 ALA A 254 AA4 4 TYR A 192 ? LEU A 198 ? TYR A 211 LEU A 217 AA4 5 GLY A 180 ? ASP A 186 ? GLY A 199 ASP A 205 AA4 6 GLY A 168 ? ARG A 176 ? GLY A 187 ARG A 195 AA4 7 LYS A 208 ? ILE A 209 ? LYS A 227 ILE A 228 AA5 1 ILE A 131 ? SER A 133 ? ILE A 150 SER A 152 AA5 2 THR A 152 ? PHE A 154 ? THR A 171 PHE A 173 AA5 3 LEU A 229 ? ALA A 235 ? LEU A 248 ALA A 254 AA5 4 LYS A 238 ? VAL A 240 ? LYS A 257 VAL A 259 AA6 1 PRO A 161 ? TYR A 163 ? PRO A 180 TYR A 182 AA6 2 LEU A 214 ? LEU A 217 ? LEU A 233 LEU A 236 AA6 3 LYS A 200 ? ILE A 201 ? LYS A 219 ILE A 220 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 3 ? N LEU A 22 O LYS A 71 ? O LYS A 90 AA1 2 3 O ILE A 68 ? O ILE A 87 N LEU A 57 ? N LEU A 76 AA1 3 4 O PHE A 60 ? O PHE A 79 N SER A 20 ? N SER A 39 AA1 4 5 N ASN A 23 ? N ASN A 42 O LYS A 26 ? O LYS A 45 AA2 1 2 N LEU A 11 ? N LEU A 30 O ALA A 42 ? O ALA A 61 AA2 2 3 O LEU A 41 ? O LEU A 60 N PHE A 31 ? N PHE A 50 AA3 1 2 N GLU A 80 ? N GLU A 99 O THR A 140 ? O THR A 159 AA3 2 3 N ARG A 139 ? N ARG A 158 O ALA A 146 ? O ALA A 165 AA4 1 2 N THR A 132 ? N THR A 151 O ASP A 153 ? O ASP A 172 AA4 2 3 N THR A 152 ? N THR A 171 O PHE A 231 ? O PHE A 250 AA4 3 4 O LEU A 234 ? O LEU A 253 N TYR A 192 ? N TYR A 211 AA4 4 5 O TYR A 195 ? O TYR A 214 N VAL A 183 ? N VAL A 202 AA4 5 6 O ASP A 186 ? O ASP A 205 N VAL A 169 ? N VAL A 188 AA4 6 7 N GLY A 168 ? N GLY A 187 O ILE A 209 ? O ILE A 228 AA5 1 2 N THR A 132 ? N THR A 151 O ASP A 153 ? O ASP A 172 AA5 2 3 N THR A 152 ? N THR A 171 O PHE A 231 ? O PHE A 250 AA5 3 4 N ILE A 233 ? N ILE A 252 O VAL A 240 ? O VAL A 259 AA6 1 2 N ILE A 162 ? N ILE A 181 O ILE A 215 ? O ILE A 234 AA6 2 3 O LEU A 217 ? O LEU A 236 N LYS A 200 ? N LYS A 219 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 4 'binding site for residue ZN A 301' AC2 Software A TAR 302 ? 10 'binding site for residue TAR A 302' AC3 Software A GOL 303 ? 7 'binding site for residue GOL A 303' AC4 Software A GOL 304 ? 8 'binding site for residue GOL A 304' AC5 Software A GOL 305 ? 5 'binding site for residue GOL A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 149 ? HIS A 168 . ? 1_555 ? 2 AC1 4 ASP A 153 ? ASP A 172 . ? 1_555 ? 3 AC1 4 HIS A 230 ? HIS A 249 . ? 1_555 ? 4 AC1 4 TAR C . ? TAR A 302 . ? 1_555 ? 5 AC2 10 HIS A 149 ? HIS A 168 . ? 1_555 ? 6 AC2 10 ASP A 153 ? ASP A 172 . ? 1_555 ? 7 AC2 10 HIS A 197 ? HIS A 216 . ? 1_555 ? 8 AC2 10 ARG A 223 ? ARG A 242 . ? 1_555 ? 9 AC2 10 VAL A 224 ? VAL A 243 . ? 1_555 ? 10 AC2 10 SER A 225 ? SER A 244 . ? 1_555 ? 11 AC2 10 HIS A 228 ? HIS A 247 . ? 1_555 ? 12 AC2 10 HIS A 230 ? HIS A 249 . ? 1_555 ? 13 AC2 10 ZN B . ? ZN A 301 . ? 1_555 ? 14 AC2 10 GOL D . ? GOL A 303 . ? 1_555 ? 15 AC3 7 SER A 150 ? SER A 169 . ? 1_555 ? 16 AC3 7 PHE A 178 ? PHE A 197 . ? 1_555 ? 17 AC3 7 ALA A 179 ? ALA A 198 . ? 1_555 ? 18 AC3 7 HIS A 197 ? HIS A 216 . ? 1_555 ? 19 AC3 7 HIS A 230 ? HIS A 249 . ? 1_555 ? 20 AC3 7 TAR C . ? TAR A 302 . ? 1_555 ? 21 AC3 7 GOL E . ? GOL A 304 . ? 1_555 ? 22 AC4 8 TYR A 110 ? TYR A 129 . ? 1_555 ? 23 AC4 8 ARG A 176 ? ARG A 195 . ? 1_555 ? 24 AC4 8 GLN A 194 ? GLN A 213 . ? 1_555 ? 25 AC4 8 TYR A 196 ? TYR A 215 . ? 1_555 ? 26 AC4 8 GLN A 239 ? GLN A 258 . ? 1_555 ? 27 AC4 8 GOL D . ? GOL A 303 . ? 1_555 ? 28 AC4 8 HOH G . ? HOH A 404 . ? 1_555 ? 29 AC4 8 HOH G . ? HOH A 431 . ? 1_555 ? 30 AC5 5 LYS A 49 ? LYS A 68 . ? 1_555 ? 31 AC5 5 SER A 147 ? SER A 166 . ? 1_555 ? 32 AC5 5 TYR A 148 ? TYR A 167 . ? 1_555 ? 33 AC5 5 SER A 150 ? SER A 169 . ? 1_555 ? 34 AC5 5 HOH G . ? HOH A 524 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 43 ? ? 56.38 -123.40 2 1 PRO A 134 ? ? -87.47 38.71 3 1 ASN A 147 ? ? -91.39 38.27 4 1 SER A 148 ? ? -108.50 -148.30 5 1 ALA A 175 ? ? -161.61 119.30 6 1 ALA A 192 ? ? -154.80 68.44 7 1 ALA A 239 ? ? -146.70 41.88 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -27.5804 _pdbx_refine_tls.origin_y -41.7323 _pdbx_refine_tls.origin_z 0.6535 _pdbx_refine_tls.T[1][1] 0.1924 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0562 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0206 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.2648 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0088 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2067 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.1663 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -1.4097 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.6581 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.2639 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.6945 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.4271 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1045 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0673 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0216 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0386 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0340 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0285 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0438 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0884 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0002 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 20 ? ? A 275 ? all 2 'X-RAY DIFFRACTION' 1 ? ? A 300 ? ? A 307 ? all 3 'X-RAY DIFFRACTION' 1 ? ? S 1 ? ? S 252 ? all # _pdbx_entry_details.entry_id 6JMX _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 276 ? A HIS 257 2 1 Y 1 A HIS 277 ? A HIS 258 3 1 Y 1 A HIS 278 ? A HIS 259 4 1 Y 1 A HIS 279 ? A HIS 260 5 1 Y 1 A HIS 280 ? A HIS 261 6 1 Y 1 A HIS 281 ? A HIS 262 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 TAR O1 O N N 304 TAR O11 O N N 305 TAR C1 C N N 306 TAR C2 C N S 307 TAR O2 O N N 308 TAR C3 C N S 309 TAR O3 O N N 310 TAR C4 C N N 311 TAR O4 O N N 312 TAR O41 O N N 313 TAR HO1 H N N 314 TAR H2 H N N 315 TAR HO2 H N N 316 TAR H3 H N N 317 TAR HO3 H N N 318 TAR HO4 H N N 319 THR N N N N 320 THR CA C N S 321 THR C C N N 322 THR O O N N 323 THR CB C N R 324 THR OG1 O N N 325 THR CG2 C N N 326 THR OXT O N N 327 THR H H N N 328 THR H2 H N N 329 THR HA H N N 330 THR HB H N N 331 THR HG1 H N N 332 THR HG21 H N N 333 THR HG22 H N N 334 THR HG23 H N N 335 THR HXT H N N 336 TYR N N N N 337 TYR CA C N S 338 TYR C C N N 339 TYR O O N N 340 TYR CB C N N 341 TYR CG C Y N 342 TYR CD1 C Y N 343 TYR CD2 C Y N 344 TYR CE1 C Y N 345 TYR CE2 C Y N 346 TYR CZ C Y N 347 TYR OH O N N 348 TYR OXT O N N 349 TYR H H N N 350 TYR H2 H N N 351 TYR HA H N N 352 TYR HB2 H N N 353 TYR HB3 H N N 354 TYR HD1 H N N 355 TYR HD2 H N N 356 TYR HE1 H N N 357 TYR HE2 H N N 358 TYR HH H N N 359 TYR HXT H N N 360 VAL N N N N 361 VAL CA C N S 362 VAL C C N N 363 VAL O O N N 364 VAL CB C N N 365 VAL CG1 C N N 366 VAL CG2 C N N 367 VAL OXT O N N 368 VAL H H N N 369 VAL H2 H N N 370 VAL HA H N N 371 VAL HB H N N 372 VAL HG11 H N N 373 VAL HG12 H N N 374 VAL HG13 H N N 375 VAL HG21 H N N 376 VAL HG22 H N N 377 VAL HG23 H N N 378 VAL HXT H N N 379 ZN ZN ZN N N 380 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 TAR O1 C1 doub N N 290 TAR O11 C1 sing N N 291 TAR O11 HO1 sing N N 292 TAR C1 C2 sing N N 293 TAR C2 O2 sing N N 294 TAR C2 C3 sing N N 295 TAR C2 H2 sing N N 296 TAR O2 HO2 sing N N 297 TAR C3 O3 sing N N 298 TAR C3 C4 sing N N 299 TAR C3 H3 sing N N 300 TAR O3 HO3 sing N N 301 TAR C4 O4 doub N N 302 TAR C4 O41 sing N N 303 TAR O41 HO4 sing N N 304 THR N CA sing N N 305 THR N H sing N N 306 THR N H2 sing N N 307 THR CA C sing N N 308 THR CA CB sing N N 309 THR CA HA sing N N 310 THR C O doub N N 311 THR C OXT sing N N 312 THR CB OG1 sing N N 313 THR CB CG2 sing N N 314 THR CB HB sing N N 315 THR OG1 HG1 sing N N 316 THR CG2 HG21 sing N N 317 THR CG2 HG22 sing N N 318 THR CG2 HG23 sing N N 319 THR OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Research Foundation (Korea)' 'Korea, Republic Of' 2015R1A5A1008958 1 'National Research Foundation (Korea)' 'Korea, Republic Of' 2015R1C1A1A01054842 2 'National Research Foundation (Korea)' 'Korea, Republic Of' 2018R1A2B2008142 3 'Ministry of Science, ICT and Future Planning' 'Korea, Republic Of' 2014M1A8A1049296 4 'Ministry of Science, ICT and Future Planning' 'Korea, Republic Of' 2013R1A2A1A05067303 5 'National Research Foundation (Korea)' 'Korea, Republic Of' 2018R1D1A1B07040808 6 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' AI090348 7 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM61629 8 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 GOL ? ? GOL ? ? 'SUBJECT OF INVESTIGATION' ? 2 TAR ? ? TAR ? ? 'SUBJECT OF INVESTIGATION' ? 3 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # _atom_sites.entry_id 6JMX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008732 _atom_sites.fract_transf_matrix[1][2] 0.005042 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010083 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017269 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_