data_6JOF # _entry.id 6JOF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JOF pdb_00006jof 10.2210/pdb6jof/pdb WWPDB D_1300011481 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JOF _pdbx_database_status.recvd_initial_deposition_date 2019-03-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhong, W.' 1 0000-0002-7617-8345 'Pasunooti, K.K.' 2 ? 'Balamkundu, S.' 3 ? 'Wong, Y.W.' 4 ? 'Nah, Q.' 5 ? 'Liu, C.F.' 6 ? 'Lescar, J.' 7 ? 'Dedon, P.C.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 7788 _citation.page_last 7805 _citation.title ;Thienopyrimidinone Derivatives That Inhibit Bacterial tRNA (Guanine37-N1)-Methyltransferase (TrmD) by Restructuring the Active Site with a Tyrosine-Flipping Mechanism. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.9b00582 _citation.pdbx_database_id_PubMed 31442049 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhong, W.' 1 ? primary 'Pasunooti, K.K.' 2 ? primary 'Balamkundu, S.' 3 ? primary 'Wong, Y.H.' 4 ? primary 'Nah, Q.' 5 ? primary 'Gadi, V.' 6 ? primary 'Gnanakalai, S.' 7 ? primary 'Chionh, Y.H.' 8 ? primary 'McBee, M.E.' 9 ? primary 'Gopal, P.' 10 ? primary 'Lim, S.H.' 11 ? primary 'Olivier, N.' 12 ? primary 'Buurman, E.T.' 13 ? primary 'Dick, T.' 14 ? primary 'Liu, C.F.' 15 ? primary 'Lescar, J.' 16 ? primary 'Dedon, P.C.' 17 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.19 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6JOF _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.070 _cell.length_a_esd ? _cell.length_b 51.380 _cell.length_b_esd ? _cell.length_c 57.950 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JOF _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'tRNA (guanine-N(1)-)-methyltransferase' 26170.488 1 2.1.1.228 ? ? ? 2 non-polymer syn '~{N}-[[4-[(4-azanylpiperidin-1-yl)methyl]phenyl]methyl]-4-oxidanylidene-3~{H}-thieno[2,3-d]pyrimidine-5-carboxamide' 397.494 1 ? ? ? ? 3 water nat water 18.015 81 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRIDIVTIFPACLDPLRQSLPGKAIESGLVDLNVHDLRRWTHDVHHSVDDAPYGGGPGMVMKAPVWGEALDEICSSETLL IVPTPAGVLFTQATAQRWTTESHLVFACGRYEGIDQRVVQDAARRMRVEEVSIGDYVLPGGESAAVVMVEAVLRLLAGVL GNPASHQDDSHSTGLDGLLEGPSYTRPASWRGLDVPEVLLSGDHARIAAWRREVSLQRTRERRPDLSHPDGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRIDIVTIFPACLDPLRQSLPGKAIESGLVDLNVHDLRRWTHDVHHSVDDAPYGGGPGMVMKAPVWGEALDEICSSETLL IVPTPAGVLFTQATAQRWTTESHLVFACGRYEGIDQRVVQDAARRMRVEEVSIGDYVLPGGESAAVVMVEAVLRLLAGVL GNPASHQDDSHSTGLDGLLEGPSYTRPASWRGLDVPEVLLSGDHARIAAWRREVSLQRTRERRPDLSHPDGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ILE n 1 4 ASP n 1 5 ILE n 1 6 VAL n 1 7 THR n 1 8 ILE n 1 9 PHE n 1 10 PRO n 1 11 ALA n 1 12 CYS n 1 13 LEU n 1 14 ASP n 1 15 PRO n 1 16 LEU n 1 17 ARG n 1 18 GLN n 1 19 SER n 1 20 LEU n 1 21 PRO n 1 22 GLY n 1 23 LYS n 1 24 ALA n 1 25 ILE n 1 26 GLU n 1 27 SER n 1 28 GLY n 1 29 LEU n 1 30 VAL n 1 31 ASP n 1 32 LEU n 1 33 ASN n 1 34 VAL n 1 35 HIS n 1 36 ASP n 1 37 LEU n 1 38 ARG n 1 39 ARG n 1 40 TRP n 1 41 THR n 1 42 HIS n 1 43 ASP n 1 44 VAL n 1 45 HIS n 1 46 HIS n 1 47 SER n 1 48 VAL n 1 49 ASP n 1 50 ASP n 1 51 ALA n 1 52 PRO n 1 53 TYR n 1 54 GLY n 1 55 GLY n 1 56 GLY n 1 57 PRO n 1 58 GLY n 1 59 MET n 1 60 VAL n 1 61 MET n 1 62 LYS n 1 63 ALA n 1 64 PRO n 1 65 VAL n 1 66 TRP n 1 67 GLY n 1 68 GLU n 1 69 ALA n 1 70 LEU n 1 71 ASP n 1 72 GLU n 1 73 ILE n 1 74 CYS n 1 75 SER n 1 76 SER n 1 77 GLU n 1 78 THR n 1 79 LEU n 1 80 LEU n 1 81 ILE n 1 82 VAL n 1 83 PRO n 1 84 THR n 1 85 PRO n 1 86 ALA n 1 87 GLY n 1 88 VAL n 1 89 LEU n 1 90 PHE n 1 91 THR n 1 92 GLN n 1 93 ALA n 1 94 THR n 1 95 ALA n 1 96 GLN n 1 97 ARG n 1 98 TRP n 1 99 THR n 1 100 THR n 1 101 GLU n 1 102 SER n 1 103 HIS n 1 104 LEU n 1 105 VAL n 1 106 PHE n 1 107 ALA n 1 108 CYS n 1 109 GLY n 1 110 ARG n 1 111 TYR n 1 112 GLU n 1 113 GLY n 1 114 ILE n 1 115 ASP n 1 116 GLN n 1 117 ARG n 1 118 VAL n 1 119 VAL n 1 120 GLN n 1 121 ASP n 1 122 ALA n 1 123 ALA n 1 124 ARG n 1 125 ARG n 1 126 MET n 1 127 ARG n 1 128 VAL n 1 129 GLU n 1 130 GLU n 1 131 VAL n 1 132 SER n 1 133 ILE n 1 134 GLY n 1 135 ASP n 1 136 TYR n 1 137 VAL n 1 138 LEU n 1 139 PRO n 1 140 GLY n 1 141 GLY n 1 142 GLU n 1 143 SER n 1 144 ALA n 1 145 ALA n 1 146 VAL n 1 147 VAL n 1 148 MET n 1 149 VAL n 1 150 GLU n 1 151 ALA n 1 152 VAL n 1 153 LEU n 1 154 ARG n 1 155 LEU n 1 156 LEU n 1 157 ALA n 1 158 GLY n 1 159 VAL n 1 160 LEU n 1 161 GLY n 1 162 ASN n 1 163 PRO n 1 164 ALA n 1 165 SER n 1 166 HIS n 1 167 GLN n 1 168 ASP n 1 169 ASP n 1 170 SER n 1 171 HIS n 1 172 SER n 1 173 THR n 1 174 GLY n 1 175 LEU n 1 176 ASP n 1 177 GLY n 1 178 LEU n 1 179 LEU n 1 180 GLU n 1 181 GLY n 1 182 PRO n 1 183 SER n 1 184 TYR n 1 185 THR n 1 186 ARG n 1 187 PRO n 1 188 ALA n 1 189 SER n 1 190 TRP n 1 191 ARG n 1 192 GLY n 1 193 LEU n 1 194 ASP n 1 195 VAL n 1 196 PRO n 1 197 GLU n 1 198 VAL n 1 199 LEU n 1 200 LEU n 1 201 SER n 1 202 GLY n 1 203 ASP n 1 204 HIS n 1 205 ALA n 1 206 ARG n 1 207 ILE n 1 208 ALA n 1 209 ALA n 1 210 TRP n 1 211 ARG n 1 212 ARG n 1 213 GLU n 1 214 VAL n 1 215 SER n 1 216 LEU n 1 217 GLN n 1 218 ARG n 1 219 THR n 1 220 ARG n 1 221 GLU n 1 222 ARG n 1 223 ARG n 1 224 PRO n 1 225 ASP n 1 226 LEU n 1 227 SER n 1 228 HIS n 1 229 PRO n 1 230 ASP n 1 231 GLY n 1 232 SER n 1 233 HIS n 1 234 HIS n 1 235 HIS n 1 236 HIS n 1 237 HIS n 1 238 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 238 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene trmD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain H37Rv _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis H37Rv' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRMD_MYCTU _struct_ref.pdbx_db_accession P9WFY7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRIDIVTIFPACLDPLRQSLPGKAIESGLVDLNVHDLRRWTHDVHHSVDDAPYGGGPGMVMKAPVWGEALDEICSSETLL IVPTPAGVLFTQATAQRWTTESHLVFACGRYEGIDQRVVQDAARRMRVEEVSIGDYVLPGGESAAVVMVEAVLRLLAGVL GNPASHQDDSHSTGLDGLLEGPSYTRPASWRGLDVPEVLLSGDHARIAAWRREVSLQRTRERRPDLSHPD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6JOF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 230 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WFY7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 230 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 230 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6JOF GLY A 231 ? UNP P9WFY7 ? ? 'expression tag' 231 1 1 6JOF SER A 232 ? UNP P9WFY7 ? ? 'expression tag' 232 2 1 6JOF HIS A 233 ? UNP P9WFY7 ? ? 'expression tag' 233 3 1 6JOF HIS A 234 ? UNP P9WFY7 ? ? 'expression tag' 234 4 1 6JOF HIS A 235 ? UNP P9WFY7 ? ? 'expression tag' 235 5 1 6JOF HIS A 236 ? UNP P9WFY7 ? ? 'expression tag' 236 6 1 6JOF HIS A 237 ? UNP P9WFY7 ? ? 'expression tag' 237 7 1 6JOF HIS A 238 ? UNP P9WFY7 ? ? 'expression tag' 238 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BWR non-polymer . '~{N}-[[4-[(4-azanylpiperidin-1-yl)methyl]phenyl]methyl]-4-oxidanylidene-3~{H}-thieno[2,3-d]pyrimidine-5-carboxamide' ? 'C20 H23 N5 O2 S' 397.494 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JOF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.08 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Bis-Tris at pH 6.5, 20% (w/v) PEG3350, 0.1 M ammonium acetate, the crystal was soaked with 1mM inhibitor.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95370 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95370 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 29.69 _reflns.entry_id 6JOF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 42.03 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10831 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.1 _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.065 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 6.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 917 _reflns_shell.percent_possible_all 94.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.170 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.229 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.945 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -5.53430 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 7.68840 _refine.aniso_B[2][2] 2.22290 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 3.31140 _refine.B_iso_max ? _refine.B_iso_mean 27.40 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.861 _refine.correlation_coeff_Fo_to_Fc_free 0.833 _refine.details 'SF FILE CONTAINS FRIEDEL PAIRS UNDER I/F_MINUS AND I/F_PLUS COLUMNS.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JOF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 42.03 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10818 _refine.ls_number_reflns_R_free 482 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.8 _refine.ls_percent_reflns_R_free 4.460 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.220 _refine.ls_R_factor_R_free 0.262 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.218 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5ZHJ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.231 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.229 _refine.pdbx_overall_SU_R_Blow_DPI 0.323 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.318 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6JOF _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.35 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1597 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 81 _refine_hist.number_atoms_total 1706 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 42.03 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1677 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.04 ? 2286 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 576 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 35 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 250 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1677 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.71 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.58 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 211 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1960 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.20 _refine_ls_shell.d_res_low 2.46 _refine_ls_shell.number_reflns_all 3038 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 146 _refine_ls_shell.number_reflns_R_work 2892 _refine_ls_shell.percent_reflns_obs 97.28 _refine_ls_shell.percent_reflns_R_free 4.81 _refine_ls_shell.R_factor_all 0.220 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.290 _refine_ls_shell.R_factor_R_free_error 0.000 _refine_ls_shell.R_factor_R_work 0.217 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6JOF _struct.title 'Crystal structure of TrmD from Mycobacterium tuberculosis in complex with active-site inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JOF _struct_keywords.text 'tRNA methyltransferase, TRANSFERASE-INHIBITOR complex' _struct_keywords.pdbx_keywords TRANSFERASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 9 ? ARG A 17 ? PHE A 9 ARG A 17 5 ? 9 HELX_P HELX_P2 AA2 GLN A 18 ? SER A 27 ? GLN A 18 SER A 27 1 ? 10 HELX_P HELX_P3 AA3 ARG A 38 ? THR A 41 ? ARG A 38 THR A 41 5 ? 4 HELX_P HELX_P4 AA4 LYS A 62 ? CYS A 74 ? LYS A 62 CYS A 74 1 ? 13 HELX_P HELX_P5 AA5 THR A 91 ? THR A 99 ? THR A 91 THR A 99 1 ? 9 HELX_P HELX_P6 AA6 GLN A 116 ? ALA A 123 ? GLN A 116 ALA A 123 1 ? 8 HELX_P HELX_P7 AA7 GLY A 141 ? ALA A 157 ? GLY A 141 ALA A 157 1 ? 17 HELX_P HELX_P8 AA8 PRO A 196 ? SER A 201 ? PRO A 196 SER A 201 5 ? 6 HELX_P HELX_P9 AA9 ASP A 203 ? ARG A 223 ? ASP A 203 ARG A 223 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 186 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 186 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 187 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 187 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.28 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 31 ? ASP A 36 ? ASP A 31 ASP A 36 AA1 2 ARG A 2 ? THR A 7 ? ARG A 2 THR A 7 AA1 3 HIS A 103 ? ALA A 107 ? HIS A 103 ALA A 107 AA1 4 LEU A 79 ? PRO A 83 ? LEU A 79 PRO A 83 AA1 5 ARG A 127 ? SER A 132 ? ARG A 127 SER A 132 AA1 6 VAL A 88 ? LEU A 89 ? VAL A 88 LEU A 89 AA2 1 ASP A 49 ? ASP A 50 ? ASP A 49 ASP A 50 AA2 2 VAL A 60 ? MET A 61 ? VAL A 60 MET A 61 AA3 1 SER A 189 ? TRP A 190 ? SER A 189 TRP A 190 AA3 2 LEU A 193 ? ASP A 194 ? LEU A 193 ASP A 194 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 35 ? O HIS A 35 N ILE A 5 ? N ILE A 5 AA1 2 3 N VAL A 6 ? N VAL A 6 O PHE A 106 ? O PHE A 106 AA1 3 4 O VAL A 105 ? O VAL A 105 N ILE A 81 ? N ILE A 81 AA1 4 5 N VAL A 82 ? N VAL A 82 O GLU A 129 ? O GLU A 129 AA1 5 6 O SER A 132 ? O SER A 132 N VAL A 88 ? N VAL A 88 AA2 1 2 N ASP A 50 ? N ASP A 50 O VAL A 60 ? O VAL A 60 AA3 1 2 N TRP A 190 ? N TRP A 190 O LEU A 193 ? O LEU A 193 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id BWR _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'binding site for residue BWR A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 PRO A 83 ? PRO A 83 . ? 1_555 ? 2 AC1 16 THR A 84 ? THR A 84 . ? 1_555 ? 3 AC1 16 PRO A 85 ? PRO A 85 . ? 1_555 ? 4 AC1 16 GLU A 112 ? GLU A 112 . ? 1_555 ? 5 AC1 16 SER A 132 ? SER A 132 . ? 1_555 ? 6 AC1 16 ILE A 133 ? ILE A 133 . ? 1_555 ? 7 AC1 16 GLY A 134 ? GLY A 134 . ? 1_555 ? 8 AC1 16 TYR A 136 ? TYR A 136 . ? 1_555 ? 9 AC1 16 VAL A 137 ? VAL A 137 . ? 1_555 ? 10 AC1 16 LEU A 138 ? LEU A 138 . ? 1_555 ? 11 AC1 16 GLY A 140 ? GLY A 140 . ? 1_555 ? 12 AC1 16 GLY A 141 ? GLY A 141 . ? 1_555 ? 13 AC1 16 ALA A 144 ? ALA A 144 . ? 1_555 ? 14 AC1 16 ARG A 154 ? ARG A 154 . ? 2_555 ? 15 AC1 16 GLU A 180 ? GLU A 180 . ? 2_555 ? 16 AC1 16 HOH C . ? HOH A 401 . ? 1_555 ? # _atom_sites.entry_id 6JOF _atom_sites.fract_transf_matrix[1][1] 0.013686 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000045 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019463 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017256 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 MET 148 148 148 MET MET A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 VAL 159 159 ? ? ? A . n A 1 160 LEU 160 160 ? ? ? A . n A 1 161 GLY 161 161 ? ? ? A . n A 1 162 ASN 162 162 ? ? ? A . n A 1 163 PRO 163 163 ? ? ? A . n A 1 164 ALA 164 164 ? ? ? A . n A 1 165 SER 165 165 ? ? ? A . n A 1 166 HIS 166 166 ? ? ? A . n A 1 167 GLN 167 167 ? ? ? A . n A 1 168 ASP 168 168 ? ? ? A . n A 1 169 ASP 169 169 ? ? ? A . n A 1 170 SER 170 170 ? ? ? A . n A 1 171 HIS 171 171 ? ? ? A . n A 1 172 SER 172 172 ? ? ? A . n A 1 173 THR 173 173 ? ? ? A . n A 1 174 GLY 174 174 ? ? ? A . n A 1 175 LEU 175 175 ? ? ? A . n A 1 176 ASP 176 176 ? ? ? A . n A 1 177 GLY 177 177 ? ? ? A . n A 1 178 LEU 178 178 ? ? ? A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 TRP 190 190 190 TRP TRP A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 TRP 210 210 210 TRP TRP A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ARG 212 212 212 ARG ARG A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 SER 227 227 ? ? ? A . n A 1 228 HIS 228 228 ? ? ? A . n A 1 229 PRO 229 229 ? ? ? A . n A 1 230 ASP 230 230 ? ? ? A . n A 1 231 GLY 231 231 ? ? ? A . n A 1 232 SER 232 232 ? ? ? A . n A 1 233 HIS 233 233 ? ? ? A . n A 1 234 HIS 234 234 ? ? ? A . n A 1 235 HIS 235 235 ? ? ? A . n A 1 236 HIS 236 236 ? ? ? A . n A 1 237 HIS 237 237 ? ? ? A . n A 1 238 HIS 238 238 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BWR 1 301 301 BWR DRG A . C 3 HOH 1 401 50 HOH HOH A . C 3 HOH 2 402 116 HOH HOH A . C 3 HOH 3 403 24 HOH HOH A . C 3 HOH 4 404 1 HOH HOH A . C 3 HOH 5 405 60 HOH HOH A . C 3 HOH 6 406 65 HOH HOH A . C 3 HOH 7 407 2 HOH HOH A . C 3 HOH 8 408 54 HOH HOH A . C 3 HOH 9 409 49 HOH HOH A . C 3 HOH 10 410 3 HOH HOH A . C 3 HOH 11 411 59 HOH HOH A . C 3 HOH 12 412 7 HOH HOH A . C 3 HOH 13 413 64 HOH HOH A . C 3 HOH 14 414 56 HOH HOH A . C 3 HOH 15 415 13 HOH HOH A . C 3 HOH 16 416 55 HOH HOH A . C 3 HOH 17 417 21 HOH HOH A . C 3 HOH 18 418 31 HOH HOH A . C 3 HOH 19 419 8 HOH HOH A . C 3 HOH 20 420 30 HOH HOH A . C 3 HOH 21 421 61 HOH HOH A . C 3 HOH 22 422 47 HOH HOH A . C 3 HOH 23 423 19 HOH HOH A . C 3 HOH 24 424 42 HOH HOH A . C 3 HOH 25 425 51 HOH HOH A . C 3 HOH 26 426 28 HOH HOH A . C 3 HOH 27 427 22 HOH HOH A . C 3 HOH 28 428 75 HOH HOH A . C 3 HOH 29 429 58 HOH HOH A . C 3 HOH 30 430 119 HOH HOH A . C 3 HOH 31 431 53 HOH HOH A . C 3 HOH 32 432 90 HOH HOH A . C 3 HOH 33 433 48 HOH HOH A . C 3 HOH 34 434 26 HOH HOH A . C 3 HOH 35 435 33 HOH HOH A . C 3 HOH 36 436 81 HOH HOH A . C 3 HOH 37 437 73 HOH HOH A . C 3 HOH 38 438 37 HOH HOH A . C 3 HOH 39 439 95 HOH HOH A . C 3 HOH 40 440 92 HOH HOH A . C 3 HOH 41 441 41 HOH HOH A . C 3 HOH 42 442 67 HOH HOH A . C 3 HOH 43 443 25 HOH HOH A . C 3 HOH 44 444 57 HOH HOH A . C 3 HOH 45 445 69 HOH HOH A . C 3 HOH 46 446 63 HOH HOH A . C 3 HOH 47 447 52 HOH HOH A . C 3 HOH 48 448 16 HOH HOH A . C 3 HOH 49 449 23 HOH HOH A . C 3 HOH 50 450 11 HOH HOH A . C 3 HOH 51 451 70 HOH HOH A . C 3 HOH 52 452 121 HOH HOH A . C 3 HOH 53 453 27 HOH HOH A . C 3 HOH 54 454 35 HOH HOH A . C 3 HOH 55 455 17 HOH HOH A . C 3 HOH 56 456 40 HOH HOH A . C 3 HOH 57 457 34 HOH HOH A . C 3 HOH 58 458 62 HOH HOH A . C 3 HOH 59 459 113 HOH HOH A . C 3 HOH 60 460 15 HOH HOH A . C 3 HOH 61 461 120 HOH HOH A . C 3 HOH 62 462 94 HOH HOH A . C 3 HOH 63 463 96 HOH HOH A . C 3 HOH 64 464 20 HOH HOH A . C 3 HOH 65 465 39 HOH HOH A . C 3 HOH 66 466 118 HOH HOH A . C 3 HOH 67 467 6 HOH HOH A . C 3 HOH 68 468 66 HOH HOH A . C 3 HOH 69 469 117 HOH HOH A . C 3 HOH 70 470 32 HOH HOH A . C 3 HOH 71 471 93 HOH HOH A . C 3 HOH 72 472 115 HOH HOH A . C 3 HOH 73 473 29 HOH HOH A . C 3 HOH 74 474 114 HOH HOH A . C 3 HOH 75 475 5 HOH HOH A . C 3 HOH 76 476 10 HOH HOH A . C 3 HOH 77 477 18 HOH HOH A . C 3 HOH 78 478 38 HOH HOH A . C 3 HOH 79 479 43 HOH HOH A . C 3 HOH 80 480 46 HOH HOH A . C 3 HOH 81 481 44 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7220 ? 1 MORE -21 ? 1 'SSA (A^2)' 18290 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-04 2 'Structure model' 1 1 2019-09-25 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 12.5911 24.0057 -3.9856 -0.0932 -0.0042 -0.0275 0.0067 0.1373 0.0162 0.9841 0.8614 0.8437 0.1587 -0.2561 -0.1566 0.0109 -0.0686 0.0577 0.0123 0.0637 -0.0336 -0.0107 -0.0974 0.0097 'X-RAY DIFFRACTION' 2 ? refined -13.8765 9.2625 19.7937 -0.0754 0.0398 -0.0392 0.0146 0.1623 0.0449 2.1436 1.3635 -0.0063 -0.5195 -0.9470 0.2595 -0.0395 0.0995 -0.0599 0.0178 -0.0936 -0.0866 0.1084 0.0346 -0.0158 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 158 '{ A|1 - A|158 }' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 179 A 226 '{ A|179 - A|226 }' ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 19 ? ? 53.36 -144.56 2 1 TYR A 111 ? ? 58.75 -128.30 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 479 ? 6.24 . 2 1 O ? A HOH 480 ? 6.73 . 3 1 O ? A HOH 481 ? 7.45 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 159 ? A VAL 159 2 1 Y 1 A LEU 160 ? A LEU 160 3 1 Y 1 A GLY 161 ? A GLY 161 4 1 Y 1 A ASN 162 ? A ASN 162 5 1 Y 1 A PRO 163 ? A PRO 163 6 1 Y 1 A ALA 164 ? A ALA 164 7 1 Y 1 A SER 165 ? A SER 165 8 1 Y 1 A HIS 166 ? A HIS 166 9 1 Y 1 A GLN 167 ? A GLN 167 10 1 Y 1 A ASP 168 ? A ASP 168 11 1 Y 1 A ASP 169 ? A ASP 169 12 1 Y 1 A SER 170 ? A SER 170 13 1 Y 1 A HIS 171 ? A HIS 171 14 1 Y 1 A SER 172 ? A SER 172 15 1 Y 1 A THR 173 ? A THR 173 16 1 Y 1 A GLY 174 ? A GLY 174 17 1 Y 1 A LEU 175 ? A LEU 175 18 1 Y 1 A ASP 176 ? A ASP 176 19 1 Y 1 A GLY 177 ? A GLY 177 20 1 Y 1 A LEU 178 ? A LEU 178 21 1 Y 1 A SER 227 ? A SER 227 22 1 Y 1 A HIS 228 ? A HIS 228 23 1 Y 1 A PRO 229 ? A PRO 229 24 1 Y 1 A ASP 230 ? A ASP 230 25 1 Y 1 A GLY 231 ? A GLY 231 26 1 Y 1 A SER 232 ? A SER 232 27 1 Y 1 A HIS 233 ? A HIS 233 28 1 Y 1 A HIS 234 ? A HIS 234 29 1 Y 1 A HIS 235 ? A HIS 235 30 1 Y 1 A HIS 236 ? A HIS 236 31 1 Y 1 A HIS 237 ? A HIS 237 32 1 Y 1 A HIS 238 ? A HIS 238 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BWR CAL C N N 74 BWR CAJ C N N 75 BWR CBA C N N 76 BWR NAA N N N 77 BWR CAK C N N 78 BWR CAM C N N 79 BWR NBB N N N 80 BWR CAO C N N 81 BWR CAV C Y N 82 BWR CAG C Y N 83 BWR CAE C Y N 84 BWR CAF C Y N 85 BWR CAD C Y N 86 BWR CAU C Y N 87 BWR CAN C N N 88 BWR NAQ N N N 89 BWR CAT C N N 90 BWR OAB O N N 91 BWR CAW C Y N 92 BWR CAZ C Y N 93 BWR CAX C N N 94 BWR OAC O N N 95 BWR NAR N N N 96 BWR CAH C N N 97 BWR NAP N N N 98 BWR CAY C Y N 99 BWR SAS S Y N 100 BWR CAI C Y N 101 BWR H1 H N N 102 BWR H2 H N N 103 BWR H3 H N N 104 BWR H4 H N N 105 BWR H5 H N N 106 BWR H6 H N N 107 BWR H7 H N N 108 BWR H9 H N N 109 BWR H10 H N N 110 BWR H11 H N N 111 BWR H12 H N N 112 BWR H14 H N N 113 BWR H15 H N N 114 BWR H16 H N N 115 BWR H17 H N N 116 BWR H18 H N N 117 BWR H19 H N N 118 BWR H20 H N N 119 BWR H21 H N N 120 BWR H22 H N N 121 BWR H23 H N N 122 BWR H25 H N N 123 BWR H8 H N N 124 CYS N N N N 125 CYS CA C N R 126 CYS C C N N 127 CYS O O N N 128 CYS CB C N N 129 CYS SG S N N 130 CYS OXT O N N 131 CYS H H N N 132 CYS H2 H N N 133 CYS HA H N N 134 CYS HB2 H N N 135 CYS HB3 H N N 136 CYS HG H N N 137 CYS HXT H N N 138 GLN N N N N 139 GLN CA C N S 140 GLN C C N N 141 GLN O O N N 142 GLN CB C N N 143 GLN CG C N N 144 GLN CD C N N 145 GLN OE1 O N N 146 GLN NE2 N N N 147 GLN OXT O N N 148 GLN H H N N 149 GLN H2 H N N 150 GLN HA H N N 151 GLN HB2 H N N 152 GLN HB3 H N N 153 GLN HG2 H N N 154 GLN HG3 H N N 155 GLN HE21 H N N 156 GLN HE22 H N N 157 GLN HXT H N N 158 GLU N N N N 159 GLU CA C N S 160 GLU C C N N 161 GLU O O N N 162 GLU CB C N N 163 GLU CG C N N 164 GLU CD C N N 165 GLU OE1 O N N 166 GLU OE2 O N N 167 GLU OXT O N N 168 GLU H H N N 169 GLU H2 H N N 170 GLU HA H N N 171 GLU HB2 H N N 172 GLU HB3 H N N 173 GLU HG2 H N N 174 GLU HG3 H N N 175 GLU HE2 H N N 176 GLU HXT H N N 177 GLY N N N N 178 GLY CA C N N 179 GLY C C N N 180 GLY O O N N 181 GLY OXT O N N 182 GLY H H N N 183 GLY H2 H N N 184 GLY HA2 H N N 185 GLY HA3 H N N 186 GLY HXT H N N 187 HIS N N N N 188 HIS CA C N S 189 HIS C C N N 190 HIS O O N N 191 HIS CB C N N 192 HIS CG C Y N 193 HIS ND1 N Y N 194 HIS CD2 C Y N 195 HIS CE1 C Y N 196 HIS NE2 N Y N 197 HIS OXT O N N 198 HIS H H N N 199 HIS H2 H N N 200 HIS HA H N N 201 HIS HB2 H N N 202 HIS HB3 H N N 203 HIS HD1 H N N 204 HIS HD2 H N N 205 HIS HE1 H N N 206 HIS HE2 H N N 207 HIS HXT H N N 208 HOH O O N N 209 HOH H1 H N N 210 HOH H2 H N N 211 ILE N N N N 212 ILE CA C N S 213 ILE C C N N 214 ILE O O N N 215 ILE CB C N S 216 ILE CG1 C N N 217 ILE CG2 C N N 218 ILE CD1 C N N 219 ILE OXT O N N 220 ILE H H N N 221 ILE H2 H N N 222 ILE HA H N N 223 ILE HB H N N 224 ILE HG12 H N N 225 ILE HG13 H N N 226 ILE HG21 H N N 227 ILE HG22 H N N 228 ILE HG23 H N N 229 ILE HD11 H N N 230 ILE HD12 H N N 231 ILE HD13 H N N 232 ILE HXT H N N 233 LEU N N N N 234 LEU CA C N S 235 LEU C C N N 236 LEU O O N N 237 LEU CB C N N 238 LEU CG C N N 239 LEU CD1 C N N 240 LEU CD2 C N N 241 LEU OXT O N N 242 LEU H H N N 243 LEU H2 H N N 244 LEU HA H N N 245 LEU HB2 H N N 246 LEU HB3 H N N 247 LEU HG H N N 248 LEU HD11 H N N 249 LEU HD12 H N N 250 LEU HD13 H N N 251 LEU HD21 H N N 252 LEU HD22 H N N 253 LEU HD23 H N N 254 LEU HXT H N N 255 LYS N N N N 256 LYS CA C N S 257 LYS C C N N 258 LYS O O N N 259 LYS CB C N N 260 LYS CG C N N 261 LYS CD C N N 262 LYS CE C N N 263 LYS NZ N N N 264 LYS OXT O N N 265 LYS H H N N 266 LYS H2 H N N 267 LYS HA H N N 268 LYS HB2 H N N 269 LYS HB3 H N N 270 LYS HG2 H N N 271 LYS HG3 H N N 272 LYS HD2 H N N 273 LYS HD3 H N N 274 LYS HE2 H N N 275 LYS HE3 H N N 276 LYS HZ1 H N N 277 LYS HZ2 H N N 278 LYS HZ3 H N N 279 LYS HXT H N N 280 MET N N N N 281 MET CA C N S 282 MET C C N N 283 MET O O N N 284 MET CB C N N 285 MET CG C N N 286 MET SD S N N 287 MET CE C N N 288 MET OXT O N N 289 MET H H N N 290 MET H2 H N N 291 MET HA H N N 292 MET HB2 H N N 293 MET HB3 H N N 294 MET HG2 H N N 295 MET HG3 H N N 296 MET HE1 H N N 297 MET HE2 H N N 298 MET HE3 H N N 299 MET HXT H N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 SER N N N N 341 SER CA C N S 342 SER C C N N 343 SER O O N N 344 SER CB C N N 345 SER OG O N N 346 SER OXT O N N 347 SER H H N N 348 SER H2 H N N 349 SER HA H N N 350 SER HB2 H N N 351 SER HB3 H N N 352 SER HG H N N 353 SER HXT H N N 354 THR N N N N 355 THR CA C N S 356 THR C C N N 357 THR O O N N 358 THR CB C N R 359 THR OG1 O N N 360 THR CG2 C N N 361 THR OXT O N N 362 THR H H N N 363 THR H2 H N N 364 THR HA H N N 365 THR HB H N N 366 THR HG1 H N N 367 THR HG21 H N N 368 THR HG22 H N N 369 THR HG23 H N N 370 THR HXT H N N 371 TRP N N N N 372 TRP CA C N S 373 TRP C C N N 374 TRP O O N N 375 TRP CB C N N 376 TRP CG C Y N 377 TRP CD1 C Y N 378 TRP CD2 C Y N 379 TRP NE1 N Y N 380 TRP CE2 C Y N 381 TRP CE3 C Y N 382 TRP CZ2 C Y N 383 TRP CZ3 C Y N 384 TRP CH2 C Y N 385 TRP OXT O N N 386 TRP H H N N 387 TRP H2 H N N 388 TRP HA H N N 389 TRP HB2 H N N 390 TRP HB3 H N N 391 TRP HD1 H N N 392 TRP HE1 H N N 393 TRP HE3 H N N 394 TRP HZ2 H N N 395 TRP HZ3 H N N 396 TRP HH2 H N N 397 TRP HXT H N N 398 TYR N N N N 399 TYR CA C N S 400 TYR C C N N 401 TYR O O N N 402 TYR CB C N N 403 TYR CG C Y N 404 TYR CD1 C Y N 405 TYR CD2 C Y N 406 TYR CE1 C Y N 407 TYR CE2 C Y N 408 TYR CZ C Y N 409 TYR OH O N N 410 TYR OXT O N N 411 TYR H H N N 412 TYR H2 H N N 413 TYR HA H N N 414 TYR HB2 H N N 415 TYR HB3 H N N 416 TYR HD1 H N N 417 TYR HD2 H N N 418 TYR HE1 H N N 419 TYR HE2 H N N 420 TYR HH H N N 421 TYR HXT H N N 422 VAL N N N N 423 VAL CA C N S 424 VAL C C N N 425 VAL O O N N 426 VAL CB C N N 427 VAL CG1 C N N 428 VAL CG2 C N N 429 VAL OXT O N N 430 VAL H H N N 431 VAL H2 H N N 432 VAL HA H N N 433 VAL HB H N N 434 VAL HG11 H N N 435 VAL HG12 H N N 436 VAL HG13 H N N 437 VAL HG21 H N N 438 VAL HG22 H N N 439 VAL HG23 H N N 440 VAL HXT H N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BWR NAA CBA sing N N 70 BWR CAK CBA sing N N 71 BWR CAK CAM sing N N 72 BWR CBA CAJ sing N N 73 BWR CAM NBB sing N N 74 BWR CAJ CAL sing N N 75 BWR NBB CAL sing N N 76 BWR NBB CAO sing N N 77 BWR CAO CAV sing N N 78 BWR CAG CAV doub Y N 79 BWR CAG CAE sing Y N 80 BWR CAV CAF sing Y N 81 BWR CAE CAU doub Y N 82 BWR CAF CAD doub Y N 83 BWR CAU CAD sing Y N 84 BWR CAU CAN sing N N 85 BWR CAN NAQ sing N N 86 BWR NAQ CAT sing N N 87 BWR OAB CAT doub N N 88 BWR OAC CAX doub N N 89 BWR CAT CAW sing N N 90 BWR CAX CAZ sing N N 91 BWR CAX NAR sing N N 92 BWR CAW CAZ sing Y N 93 BWR CAW CAI doub Y N 94 BWR CAZ CAY doub Y N 95 BWR NAR CAH sing N N 96 BWR CAI SAS sing Y N 97 BWR CAY SAS sing Y N 98 BWR CAY NAP sing N N 99 BWR CAH NAP doub N N 100 BWR CAL H1 sing N N 101 BWR CAL H2 sing N N 102 BWR CAJ H3 sing N N 103 BWR CAJ H4 sing N N 104 BWR CBA H5 sing N N 105 BWR NAA H6 sing N N 106 BWR NAA H7 sing N N 107 BWR CAK H9 sing N N 108 BWR CAK H10 sing N N 109 BWR CAM H11 sing N N 110 BWR CAM H12 sing N N 111 BWR CAO H14 sing N N 112 BWR CAO H15 sing N N 113 BWR CAG H16 sing N N 114 BWR CAE H17 sing N N 115 BWR CAF H18 sing N N 116 BWR CAD H19 sing N N 117 BWR CAN H20 sing N N 118 BWR CAN H21 sing N N 119 BWR NAQ H22 sing N N 120 BWR CAH H23 sing N N 121 BWR CAI H25 sing N N 122 BWR NAR H8 sing N N 123 CYS N CA sing N N 124 CYS N H sing N N 125 CYS N H2 sing N N 126 CYS CA C sing N N 127 CYS CA CB sing N N 128 CYS CA HA sing N N 129 CYS C O doub N N 130 CYS C OXT sing N N 131 CYS CB SG sing N N 132 CYS CB HB2 sing N N 133 CYS CB HB3 sing N N 134 CYS SG HG sing N N 135 CYS OXT HXT sing N N 136 GLN N CA sing N N 137 GLN N H sing N N 138 GLN N H2 sing N N 139 GLN CA C sing N N 140 GLN CA CB sing N N 141 GLN CA HA sing N N 142 GLN C O doub N N 143 GLN C OXT sing N N 144 GLN CB CG sing N N 145 GLN CB HB2 sing N N 146 GLN CB HB3 sing N N 147 GLN CG CD sing N N 148 GLN CG HG2 sing N N 149 GLN CG HG3 sing N N 150 GLN CD OE1 doub N N 151 GLN CD NE2 sing N N 152 GLN NE2 HE21 sing N N 153 GLN NE2 HE22 sing N N 154 GLN OXT HXT sing N N 155 GLU N CA sing N N 156 GLU N H sing N N 157 GLU N H2 sing N N 158 GLU CA C sing N N 159 GLU CA CB sing N N 160 GLU CA HA sing N N 161 GLU C O doub N N 162 GLU C OXT sing N N 163 GLU CB CG sing N N 164 GLU CB HB2 sing N N 165 GLU CB HB3 sing N N 166 GLU CG CD sing N N 167 GLU CG HG2 sing N N 168 GLU CG HG3 sing N N 169 GLU CD OE1 doub N N 170 GLU CD OE2 sing N N 171 GLU OE2 HE2 sing N N 172 GLU OXT HXT sing N N 173 GLY N CA sing N N 174 GLY N H sing N N 175 GLY N H2 sing N N 176 GLY CA C sing N N 177 GLY CA HA2 sing N N 178 GLY CA HA3 sing N N 179 GLY C O doub N N 180 GLY C OXT sing N N 181 GLY OXT HXT sing N N 182 HIS N CA sing N N 183 HIS N H sing N N 184 HIS N H2 sing N N 185 HIS CA C sing N N 186 HIS CA CB sing N N 187 HIS CA HA sing N N 188 HIS C O doub N N 189 HIS C OXT sing N N 190 HIS CB CG sing N N 191 HIS CB HB2 sing N N 192 HIS CB HB3 sing N N 193 HIS CG ND1 sing Y N 194 HIS CG CD2 doub Y N 195 HIS ND1 CE1 doub Y N 196 HIS ND1 HD1 sing N N 197 HIS CD2 NE2 sing Y N 198 HIS CD2 HD2 sing N N 199 HIS CE1 NE2 sing Y N 200 HIS CE1 HE1 sing N N 201 HIS NE2 HE2 sing N N 202 HIS OXT HXT sing N N 203 HOH O H1 sing N N 204 HOH O H2 sing N N 205 ILE N CA sing N N 206 ILE N H sing N N 207 ILE N H2 sing N N 208 ILE CA C sing N N 209 ILE CA CB sing N N 210 ILE CA HA sing N N 211 ILE C O doub N N 212 ILE C OXT sing N N 213 ILE CB CG1 sing N N 214 ILE CB CG2 sing N N 215 ILE CB HB sing N N 216 ILE CG1 CD1 sing N N 217 ILE CG1 HG12 sing N N 218 ILE CG1 HG13 sing N N 219 ILE CG2 HG21 sing N N 220 ILE CG2 HG22 sing N N 221 ILE CG2 HG23 sing N N 222 ILE CD1 HD11 sing N N 223 ILE CD1 HD12 sing N N 224 ILE CD1 HD13 sing N N 225 ILE OXT HXT sing N N 226 LEU N CA sing N N 227 LEU N H sing N N 228 LEU N H2 sing N N 229 LEU CA C sing N N 230 LEU CA CB sing N N 231 LEU CA HA sing N N 232 LEU C O doub N N 233 LEU C OXT sing N N 234 LEU CB CG sing N N 235 LEU CB HB2 sing N N 236 LEU CB HB3 sing N N 237 LEU CG CD1 sing N N 238 LEU CG CD2 sing N N 239 LEU CG HG sing N N 240 LEU CD1 HD11 sing N N 241 LEU CD1 HD12 sing N N 242 LEU CD1 HD13 sing N N 243 LEU CD2 HD21 sing N N 244 LEU CD2 HD22 sing N N 245 LEU CD2 HD23 sing N N 246 LEU OXT HXT sing N N 247 LYS N CA sing N N 248 LYS N H sing N N 249 LYS N H2 sing N N 250 LYS CA C sing N N 251 LYS CA CB sing N N 252 LYS CA HA sing N N 253 LYS C O doub N N 254 LYS C OXT sing N N 255 LYS CB CG sing N N 256 LYS CB HB2 sing N N 257 LYS CB HB3 sing N N 258 LYS CG CD sing N N 259 LYS CG HG2 sing N N 260 LYS CG HG3 sing N N 261 LYS CD CE sing N N 262 LYS CD HD2 sing N N 263 LYS CD HD3 sing N N 264 LYS CE NZ sing N N 265 LYS CE HE2 sing N N 266 LYS CE HE3 sing N N 267 LYS NZ HZ1 sing N N 268 LYS NZ HZ2 sing N N 269 LYS NZ HZ3 sing N N 270 LYS OXT HXT sing N N 271 MET N CA sing N N 272 MET N H sing N N 273 MET N H2 sing N N 274 MET CA C sing N N 275 MET CA CB sing N N 276 MET CA HA sing N N 277 MET C O doub N N 278 MET C OXT sing N N 279 MET CB CG sing N N 280 MET CB HB2 sing N N 281 MET CB HB3 sing N N 282 MET CG SD sing N N 283 MET CG HG2 sing N N 284 MET CG HG3 sing N N 285 MET SD CE sing N N 286 MET CE HE1 sing N N 287 MET CE HE2 sing N N 288 MET CE HE3 sing N N 289 MET OXT HXT sing N N 290 PHE N CA sing N N 291 PHE N H sing N N 292 PHE N H2 sing N N 293 PHE CA C sing N N 294 PHE CA CB sing N N 295 PHE CA HA sing N N 296 PHE C O doub N N 297 PHE C OXT sing N N 298 PHE CB CG sing N N 299 PHE CB HB2 sing N N 300 PHE CB HB3 sing N N 301 PHE CG CD1 doub Y N 302 PHE CG CD2 sing Y N 303 PHE CD1 CE1 sing Y N 304 PHE CD1 HD1 sing N N 305 PHE CD2 CE2 doub Y N 306 PHE CD2 HD2 sing N N 307 PHE CE1 CZ doub Y N 308 PHE CE1 HE1 sing N N 309 PHE CE2 CZ sing Y N 310 PHE CE2 HE2 sing N N 311 PHE CZ HZ sing N N 312 PHE OXT HXT sing N N 313 PRO N CA sing N N 314 PRO N CD sing N N 315 PRO N H sing N N 316 PRO CA C sing N N 317 PRO CA CB sing N N 318 PRO CA HA sing N N 319 PRO C O doub N N 320 PRO C OXT sing N N 321 PRO CB CG sing N N 322 PRO CB HB2 sing N N 323 PRO CB HB3 sing N N 324 PRO CG CD sing N N 325 PRO CG HG2 sing N N 326 PRO CG HG3 sing N N 327 PRO CD HD2 sing N N 328 PRO CD HD3 sing N N 329 PRO OXT HXT sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # _pdbx_audit_support.funding_organization 'National Research Foundation (Singapore)' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BWR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BWR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[[4-[(4-azanylpiperidin-1-yl)methyl]phenyl]methyl]-4-oxidanylidene-3~{H}-thieno[2,3-d]pyrimidine-5-carboxamide' BWR 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5ZHJ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #