data_6JQK # _entry.id 6JQK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JQK pdb_00006jqk 10.2210/pdb6jqk/pdb WWPDB D_1300011577 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-08 2 'Structure model' 1 1 2023-11-22 3 'Structure model' 1 2 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Database references' 4 2 'Structure model' 'Refinement description' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_unobs_or_zero_occ_residues 6 3 'Structure model' pdbx_entry_details 7 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JQK _pdbx_database_status.recvd_initial_deposition_date 2019-03-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yu, D.W.' 1 ? 'Qin, B.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of C34M/N36' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, D.W.' 1 ? primary 'Qin, B.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn N36 4152.843 1 ? ? ? ? 2 polymer syn C34M 4221.552 1 ? ? ? ? 3 water nat water 18.015 41 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes '(ACE)SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL' XSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL N ? 2 'polypeptide(L)' no yes '(ACE)WASLWNWFNNYTSLIHSLIEESQNQQEKNEQELL' XWASLWNWFNNYTSLIHSLIEESQNQQEKNEQELL C ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 SER n 1 3 GLY n 1 4 ILE n 1 5 VAL n 1 6 GLN n 1 7 GLN n 1 8 GLN n 1 9 ASN n 1 10 ASN n 1 11 LEU n 1 12 LEU n 1 13 ARG n 1 14 ALA n 1 15 ILE n 1 16 GLU n 1 17 ALA n 1 18 GLN n 1 19 GLN n 1 20 HIS n 1 21 LEU n 1 22 LEU n 1 23 GLN n 1 24 LEU n 1 25 THR n 1 26 VAL n 1 27 TRP n 1 28 GLY n 1 29 ILE n 1 30 LYS n 1 31 GLN n 1 32 LEU n 1 33 GLN n 1 34 ALA n 1 35 ARG n 1 36 ILE n 1 37 LEU n 2 1 ACE n 2 2 TRP n 2 3 ALA n 2 4 SER n 2 5 LEU n 2 6 TRP n 2 7 ASN n 2 8 TRP n 2 9 PHE n 2 10 ASN n 2 11 ASN n 2 12 TYR n 2 13 THR n 2 14 SER n 2 15 LEU n 2 16 ILE n 2 17 HIS n 2 18 SER n 2 19 LEU n 2 20 ILE n 2 21 GLU n 2 22 GLU n 2 23 SER n 2 24 GLN n 2 25 ASN n 2 26 GLN n 2 27 GLN n 2 28 GLU n 2 29 LYS n 2 30 ASN n 2 31 GLU n 2 32 GLN n 2 33 GLU n 2 34 LEU n 2 35 LEU n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 37 'Human immunodeficiency virus 1' ? 11676 ? 2 1 sample 1 35 'Human immunodeficiency virus 1' ? 11676 ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 545 545 ACE ACE N . n A 1 2 SER 2 546 546 SER SER N . n A 1 3 GLY 3 547 547 GLY GLY N . n A 1 4 ILE 4 548 548 ILE ILE N . n A 1 5 VAL 5 549 549 VAL VAL N . n A 1 6 GLN 6 550 550 GLN GLN N . n A 1 7 GLN 7 551 551 GLN GLN N . n A 1 8 GLN 8 552 552 GLN GLN N . n A 1 9 ASN 9 553 553 ASN ASN N . n A 1 10 ASN 10 554 554 ASN ASN N . n A 1 11 LEU 11 555 555 LEU LEU N . n A 1 12 LEU 12 556 556 LEU LEU N . n A 1 13 ARG 13 557 557 ARG ARG N . n A 1 14 ALA 14 558 558 ALA ALA N . n A 1 15 ILE 15 559 559 ILE ILE N . n A 1 16 GLU 16 560 560 GLU GLU N . n A 1 17 ALA 17 561 561 ALA ALA N . n A 1 18 GLN 18 562 562 GLN GLN N . n A 1 19 GLN 19 563 563 GLN GLN N . n A 1 20 HIS 20 564 564 HIS HIS N . n A 1 21 LEU 21 565 565 LEU LEU N . n A 1 22 LEU 22 566 566 LEU LEU N . n A 1 23 GLN 23 567 567 GLN GLN N . n A 1 24 LEU 24 568 568 LEU LEU N . n A 1 25 THR 25 569 569 THR THR N . n A 1 26 VAL 26 570 570 VAL VAL N . n A 1 27 TRP 27 571 571 TRP TRP N . n A 1 28 GLY 28 572 572 GLY GLY N . n A 1 29 ILE 29 573 573 ILE ILE N . n A 1 30 LYS 30 574 574 LYS LYS N . n A 1 31 GLN 31 575 575 GLN GLN N . n A 1 32 LEU 32 576 576 LEU LEU N . n A 1 33 GLN 33 577 577 GLN GLN N . n A 1 34 ALA 34 578 578 ALA ALA N . n A 1 35 ARG 35 579 579 ARG ARG N . n A 1 36 ILE 36 580 580 ILE ILE N . n A 1 37 LEU 37 581 581 LEU LEU N . n B 2 1 ACE 1 627 627 ACE ACE C . n B 2 2 TRP 2 628 628 TRP TRP C . n B 2 3 ALA 3 629 629 ALA ALA C . n B 2 4 SER 4 630 630 SER SER C . n B 2 5 LEU 5 631 631 LEU LEU C . n B 2 6 TRP 6 632 632 TRP TRP C . n B 2 7 ASN 7 633 633 ASN ASN C . n B 2 8 TRP 8 634 634 TRP TRP C . n B 2 9 PHE 9 635 635 PHE PHE C . n B 2 10 ASN 10 636 636 ASN ASN C . n B 2 11 ASN 11 637 637 ASN ASN C . n B 2 12 TYR 12 638 638 TYR TYR C . n B 2 13 THR 13 639 639 THR THR C . n B 2 14 SER 14 640 640 SER SER C . n B 2 15 LEU 15 641 641 LEU LEU C . n B 2 16 ILE 16 642 642 ILE ILE C . n B 2 17 HIS 17 643 643 HIS HIS C . n B 2 18 SER 18 644 644 SER SER C . n B 2 19 LEU 19 645 645 LEU LEU C . n B 2 20 ILE 20 646 646 ILE ILE C . n B 2 21 GLU 21 647 647 GLU GLU C . n B 2 22 GLU 22 648 648 GLU GLU C . n B 2 23 SER 23 649 649 SER SER C . n B 2 24 GLN 24 650 650 GLN GLN C . n B 2 25 ASN 25 651 651 ASN ASN C . n B 2 26 GLN 26 652 652 GLN GLN C . n B 2 27 GLN 27 653 653 GLN GLN C . n B 2 28 GLU 28 654 654 GLU GLU C . n B 2 29 LYS 29 655 655 LYS LYS C . n B 2 30 ASN 30 656 656 ASN ASN C . n B 2 31 GLU 31 657 657 GLU GLU C . n B 2 32 GLN 32 658 658 GLN GLN C . n B 2 33 GLU 33 659 659 GLU GLU C . n B 2 34 LEU 34 660 660 LEU LEU C . n B 2 35 LEU 35 661 661 LEU LEU C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 601 32 HOH HOH N . C 3 HOH 2 602 4 HOH HOH N . C 3 HOH 3 603 2 HOH HOH N . C 3 HOH 4 604 9 HOH HOH N . C 3 HOH 5 605 27 HOH HOH N . C 3 HOH 6 606 37 HOH HOH N . C 3 HOH 7 607 1 HOH HOH N . C 3 HOH 8 608 16 HOH HOH N . C 3 HOH 9 609 20 HOH HOH N . C 3 HOH 10 610 7 HOH HOH N . C 3 HOH 11 611 19 HOH HOH N . C 3 HOH 12 612 23 HOH HOH N . C 3 HOH 13 613 21 HOH HOH N . C 3 HOH 14 614 26 HOH HOH N . C 3 HOH 15 615 39 HOH HOH N . C 3 HOH 16 616 41 HOH HOH N . C 3 HOH 17 617 14 HOH HOH N . C 3 HOH 18 618 22 HOH HOH N . D 3 HOH 1 701 24 HOH HOH C . D 3 HOH 2 702 40 HOH HOH C . D 3 HOH 3 703 34 HOH HOH C . D 3 HOH 4 704 33 HOH HOH C . D 3 HOH 5 705 3 HOH HOH C . D 3 HOH 6 706 10 HOH HOH C . D 3 HOH 7 707 30 HOH HOH C . D 3 HOH 8 708 11 HOH HOH C . D 3 HOH 9 709 18 HOH HOH C . D 3 HOH 10 710 35 HOH HOH C . D 3 HOH 11 711 8 HOH HOH C . D 3 HOH 12 712 6 HOH HOH C . D 3 HOH 13 713 12 HOH HOH C . D 3 HOH 14 714 13 HOH HOH C . D 3 HOH 15 715 15 HOH HOH C . D 3 HOH 16 716 25 HOH HOH C . D 3 HOH 17 717 29 HOH HOH C . D 3 HOH 18 718 17 HOH HOH C . D 3 HOH 19 719 31 HOH HOH C . D 3 HOH 20 720 38 HOH HOH C . D 3 HOH 21 721 28 HOH HOH C . D 3 HOH 22 722 36 HOH HOH C . D 3 HOH 23 723 5 HOH HOH C . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6JQK _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.126 _cell.length_a_esd ? _cell.length_b 46.126 _cell.length_b_esd ? _cell.length_c 143.351 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JQK _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JQK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 29.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Sodium chloride,0.1 M BIS-TRIS pH 5.5,25% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'SI(111) silicon crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97892 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97892 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 22.1 _reflns.entry_id 6JQK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.498 _reflns.d_resolution_low 38.48 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9811 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F -3 _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.96 _reflns.pdbx_Rmerge_I_obs 0.035 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.34 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.5 _reflns_shell.d_res_low 1.59 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.43 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1561 _reflns_shell.percent_possible_all 94.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.242 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.89 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.967 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JQK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.498 _refine.ls_d_res_low 38.480 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9623 _refine.ls_number_reflns_R_free 454 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.83 _refine.ls_percent_reflns_R_free 4.72 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2067 _refine.ls_R_factor_R_free 0.2269 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2054 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1AIK _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.12 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.22 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 593 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 634 _refine_hist.d_res_high 1.498 _refine_hist.d_res_low 38.480 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 621 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.803 ? 845 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.653 ? 228 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.062 ? 92 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 110 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4981 1.7149 . . 142 2966 97.00 . . . 0.3332 . 0.2548 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7149 2.1606 . . 150 3075 99.00 . . . 0.2673 . 0.2357 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1606 38.4929 . . 162 3128 98.00 . . . 0.2064 . 0.1910 . . . . . . . . . . # _struct.entry_id 6JQK _struct.title 'Structure of C34M/N36' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JQK _struct_keywords.text 'HIV, envlope, T20, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 6JQK 6JQK ? 1 ? 1 2 PDB 6JQK 6JQK ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6JQK N 1 ? 37 ? 6JQK 545 ? 581 ? 545 581 2 2 6JQK C 1 ? 35 ? 6JQK 627 ? 661 ? 627 661 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1760 ? 1 MORE -14 ? 1 'SSA (A^2)' 5710 ? 2 'ABSA (A^2)' 12300 ? 2 MORE -111 ? 2 'SSA (A^2)' 10110 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2,3 A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -y,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 -23.0630000000 0.8660254038 -0.5000000000 0.0000000000 39.9462877750 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_455 -x+y-1,-x,z -0.5000000000 0.8660254038 0.0000000000 -46.1260000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? LEU A 37 ? SER N 546 LEU N 581 1 ? 36 HELX_P HELX_P2 AA2 TRP B 2 ? LEU B 35 ? TRP C 628 LEU C 661 1 ? 34 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A SER 2 N ? ? N ACE 545 N SER 546 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? B ACE 1 C ? ? ? 1_555 B TRP 2 N ? ? C ACE 627 C TRP 628 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 ACE A 1 ? SER A 2 ? ACE N 545 ? 1_555 SER N 546 ? 1_555 . . SER 6 ACE None 'Terminal acetylation' 2 ACE B 1 ? TRP B 2 ? ACE C 627 ? 1_555 TRP C 628 ? 1_555 . . TRP 16 ACE None 'Terminal acetylation' # _pdbx_entry_details.entry_id 6JQK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NE N ARG 579 ? ? O N HOH 601 ? ? 2.12 2 1 O N HOH 613 ? ? O N HOH 616 ? ? 2.14 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O C HOH 707 ? ? 1_555 O C HOH 714 ? ? 5_555 1.99 2 1 O C HOH 715 ? ? 1_555 O C HOH 722 ? ? 10_455 2.17 3 1 O C HOH 704 ? ? 1_555 O C HOH 713 ? ? 10_455 2.17 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 N HOH 602 ? C HOH . 2 1 N HOH 607 ? C HOH . 3 1 N HOH 612 ? C HOH . 4 1 N HOH 617 ? C HOH . 5 1 C HOH 723 ? D HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 0 N ACE 545 ? A ACE 1 2 1 Y 0 C ACE 627 ? B ACE 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 GLN N N N N 65 GLN CA C N S 66 GLN C C N N 67 GLN O O N N 68 GLN CB C N N 69 GLN CG C N N 70 GLN CD C N N 71 GLN OE1 O N N 72 GLN NE2 N N N 73 GLN OXT O N N 74 GLN H H N N 75 GLN H2 H N N 76 GLN HA H N N 77 GLN HB2 H N N 78 GLN HB3 H N N 79 GLN HG2 H N N 80 GLN HG3 H N N 81 GLN HE21 H N N 82 GLN HE22 H N N 83 GLN HXT H N N 84 GLU N N N N 85 GLU CA C N S 86 GLU C C N N 87 GLU O O N N 88 GLU CB C N N 89 GLU CG C N N 90 GLU CD C N N 91 GLU OE1 O N N 92 GLU OE2 O N N 93 GLU OXT O N N 94 GLU H H N N 95 GLU H2 H N N 96 GLU HA H N N 97 GLU HB2 H N N 98 GLU HB3 H N N 99 GLU HG2 H N N 100 GLU HG3 H N N 101 GLU HE2 H N N 102 GLU HXT H N N 103 GLY N N N N 104 GLY CA C N N 105 GLY C C N N 106 GLY O O N N 107 GLY OXT O N N 108 GLY H H N N 109 GLY H2 H N N 110 GLY HA2 H N N 111 GLY HA3 H N N 112 GLY HXT H N N 113 HIS N N N N 114 HIS CA C N S 115 HIS C C N N 116 HIS O O N N 117 HIS CB C N N 118 HIS CG C Y N 119 HIS ND1 N Y N 120 HIS CD2 C Y N 121 HIS CE1 C Y N 122 HIS NE2 N Y N 123 HIS OXT O N N 124 HIS H H N N 125 HIS H2 H N N 126 HIS HA H N N 127 HIS HB2 H N N 128 HIS HB3 H N N 129 HIS HD1 H N N 130 HIS HD2 H N N 131 HIS HE1 H N N 132 HIS HE2 H N N 133 HIS HXT H N N 134 HOH O O N N 135 HOH H1 H N N 136 HOH H2 H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 PHE N N N N 207 PHE CA C N S 208 PHE C C N N 209 PHE O O N N 210 PHE CB C N N 211 PHE CG C Y N 212 PHE CD1 C Y N 213 PHE CD2 C Y N 214 PHE CE1 C Y N 215 PHE CE2 C Y N 216 PHE CZ C Y N 217 PHE OXT O N N 218 PHE H H N N 219 PHE H2 H N N 220 PHE HA H N N 221 PHE HB2 H N N 222 PHE HB3 H N N 223 PHE HD1 H N N 224 PHE HD2 H N N 225 PHE HE1 H N N 226 PHE HE2 H N N 227 PHE HZ H N N 228 PHE HXT H N N 229 SER N N N N 230 SER CA C N S 231 SER C C N N 232 SER O O N N 233 SER CB C N N 234 SER OG O N N 235 SER OXT O N N 236 SER H H N N 237 SER H2 H N N 238 SER HA H N N 239 SER HB2 H N N 240 SER HB3 H N N 241 SER HG H N N 242 SER HXT H N N 243 THR N N N N 244 THR CA C N S 245 THR C C N N 246 THR O O N N 247 THR CB C N R 248 THR OG1 O N N 249 THR CG2 C N N 250 THR OXT O N N 251 THR H H N N 252 THR H2 H N N 253 THR HA H N N 254 THR HB H N N 255 THR HG1 H N N 256 THR HG21 H N N 257 THR HG22 H N N 258 THR HG23 H N N 259 THR HXT H N N 260 TRP N N N N 261 TRP CA C N S 262 TRP C C N N 263 TRP O O N N 264 TRP CB C N N 265 TRP CG C Y N 266 TRP CD1 C Y N 267 TRP CD2 C Y N 268 TRP NE1 N Y N 269 TRP CE2 C Y N 270 TRP CE3 C Y N 271 TRP CZ2 C Y N 272 TRP CZ3 C Y N 273 TRP CH2 C Y N 274 TRP OXT O N N 275 TRP H H N N 276 TRP H2 H N N 277 TRP HA H N N 278 TRP HB2 H N N 279 TRP HB3 H N N 280 TRP HD1 H N N 281 TRP HE1 H N N 282 TRP HE3 H N N 283 TRP HZ2 H N N 284 TRP HZ3 H N N 285 TRP HH2 H N N 286 TRP HXT H N N 287 TYR N N N N 288 TYR CA C N S 289 TYR C C N N 290 TYR O O N N 291 TYR CB C N N 292 TYR CG C Y N 293 TYR CD1 C Y N 294 TYR CD2 C Y N 295 TYR CE1 C Y N 296 TYR CE2 C Y N 297 TYR CZ C Y N 298 TYR OH O N N 299 TYR OXT O N N 300 TYR H H N N 301 TYR H2 H N N 302 TYR HA H N N 303 TYR HB2 H N N 304 TYR HB3 H N N 305 TYR HD1 H N N 306 TYR HD2 H N N 307 TYR HE1 H N N 308 TYR HE2 H N N 309 TYR HH H N N 310 TYR HXT H N N 311 VAL N N N N 312 VAL CA C N S 313 VAL C C N N 314 VAL O O N N 315 VAL CB C N N 316 VAL CG1 C N N 317 VAL CG2 C N N 318 VAL OXT O N N 319 VAL H H N N 320 VAL H2 H N N 321 VAL HA H N N 322 VAL HB H N N 323 VAL HG11 H N N 324 VAL HG12 H N N 325 VAL HG13 H N N 326 VAL HG21 H N N 327 VAL HG22 H N N 328 VAL HG23 H N N 329 VAL HXT H N N 330 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 GLN N CA sing N N 61 GLN N H sing N N 62 GLN N H2 sing N N 63 GLN CA C sing N N 64 GLN CA CB sing N N 65 GLN CA HA sing N N 66 GLN C O doub N N 67 GLN C OXT sing N N 68 GLN CB CG sing N N 69 GLN CB HB2 sing N N 70 GLN CB HB3 sing N N 71 GLN CG CD sing N N 72 GLN CG HG2 sing N N 73 GLN CG HG3 sing N N 74 GLN CD OE1 doub N N 75 GLN CD NE2 sing N N 76 GLN NE2 HE21 sing N N 77 GLN NE2 HE22 sing N N 78 GLN OXT HXT sing N N 79 GLU N CA sing N N 80 GLU N H sing N N 81 GLU N H2 sing N N 82 GLU CA C sing N N 83 GLU CA CB sing N N 84 GLU CA HA sing N N 85 GLU C O doub N N 86 GLU C OXT sing N N 87 GLU CB CG sing N N 88 GLU CB HB2 sing N N 89 GLU CB HB3 sing N N 90 GLU CG CD sing N N 91 GLU CG HG2 sing N N 92 GLU CG HG3 sing N N 93 GLU CD OE1 doub N N 94 GLU CD OE2 sing N N 95 GLU OE2 HE2 sing N N 96 GLU OXT HXT sing N N 97 GLY N CA sing N N 98 GLY N H sing N N 99 GLY N H2 sing N N 100 GLY CA C sing N N 101 GLY CA HA2 sing N N 102 GLY CA HA3 sing N N 103 GLY C O doub N N 104 GLY C OXT sing N N 105 GLY OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 HOH O H1 sing N N 128 HOH O H2 sing N N 129 ILE N CA sing N N 130 ILE N H sing N N 131 ILE N H2 sing N N 132 ILE CA C sing N N 133 ILE CA CB sing N N 134 ILE CA HA sing N N 135 ILE C O doub N N 136 ILE C OXT sing N N 137 ILE CB CG1 sing N N 138 ILE CB CG2 sing N N 139 ILE CB HB sing N N 140 ILE CG1 CD1 sing N N 141 ILE CG1 HG12 sing N N 142 ILE CG1 HG13 sing N N 143 ILE CG2 HG21 sing N N 144 ILE CG2 HG22 sing N N 145 ILE CG2 HG23 sing N N 146 ILE CD1 HD11 sing N N 147 ILE CD1 HD12 sing N N 148 ILE CD1 HD13 sing N N 149 ILE OXT HXT sing N N 150 LEU N CA sing N N 151 LEU N H sing N N 152 LEU N H2 sing N N 153 LEU CA C sing N N 154 LEU CA CB sing N N 155 LEU CA HA sing N N 156 LEU C O doub N N 157 LEU C OXT sing N N 158 LEU CB CG sing N N 159 LEU CB HB2 sing N N 160 LEU CB HB3 sing N N 161 LEU CG CD1 sing N N 162 LEU CG CD2 sing N N 163 LEU CG HG sing N N 164 LEU CD1 HD11 sing N N 165 LEU CD1 HD12 sing N N 166 LEU CD1 HD13 sing N N 167 LEU CD2 HD21 sing N N 168 LEU CD2 HD22 sing N N 169 LEU CD2 HD23 sing N N 170 LEU OXT HXT sing N N 171 LYS N CA sing N N 172 LYS N H sing N N 173 LYS N H2 sing N N 174 LYS CA C sing N N 175 LYS CA CB sing N N 176 LYS CA HA sing N N 177 LYS C O doub N N 178 LYS C OXT sing N N 179 LYS CB CG sing N N 180 LYS CB HB2 sing N N 181 LYS CB HB3 sing N N 182 LYS CG CD sing N N 183 LYS CG HG2 sing N N 184 LYS CG HG3 sing N N 185 LYS CD CE sing N N 186 LYS CD HD2 sing N N 187 LYS CD HD3 sing N N 188 LYS CE NZ sing N N 189 LYS CE HE2 sing N N 190 LYS CE HE3 sing N N 191 LYS NZ HZ1 sing N N 192 LYS NZ HZ2 sing N N 193 LYS NZ HZ3 sing N N 194 LYS OXT HXT sing N N 195 PHE N CA sing N N 196 PHE N H sing N N 197 PHE N H2 sing N N 198 PHE CA C sing N N 199 PHE CA CB sing N N 200 PHE CA HA sing N N 201 PHE C O doub N N 202 PHE C OXT sing N N 203 PHE CB CG sing N N 204 PHE CB HB2 sing N N 205 PHE CB HB3 sing N N 206 PHE CG CD1 doub Y N 207 PHE CG CD2 sing Y N 208 PHE CD1 CE1 sing Y N 209 PHE CD1 HD1 sing N N 210 PHE CD2 CE2 doub Y N 211 PHE CD2 HD2 sing N N 212 PHE CE1 CZ doub Y N 213 PHE CE1 HE1 sing N N 214 PHE CE2 CZ sing Y N 215 PHE CE2 HE2 sing N N 216 PHE CZ HZ sing N N 217 PHE OXT HXT sing N N 218 SER N CA sing N N 219 SER N H sing N N 220 SER N H2 sing N N 221 SER CA C sing N N 222 SER CA CB sing N N 223 SER CA HA sing N N 224 SER C O doub N N 225 SER C OXT sing N N 226 SER CB OG sing N N 227 SER CB HB2 sing N N 228 SER CB HB3 sing N N 229 SER OG HG sing N N 230 SER OXT HXT sing N N 231 THR N CA sing N N 232 THR N H sing N N 233 THR N H2 sing N N 234 THR CA C sing N N 235 THR CA CB sing N N 236 THR CA HA sing N N 237 THR C O doub N N 238 THR C OXT sing N N 239 THR CB OG1 sing N N 240 THR CB CG2 sing N N 241 THR CB HB sing N N 242 THR OG1 HG1 sing N N 243 THR CG2 HG21 sing N N 244 THR CG2 HG22 sing N N 245 THR CG2 HG23 sing N N 246 THR OXT HXT sing N N 247 TRP N CA sing N N 248 TRP N H sing N N 249 TRP N H2 sing N N 250 TRP CA C sing N N 251 TRP CA CB sing N N 252 TRP CA HA sing N N 253 TRP C O doub N N 254 TRP C OXT sing N N 255 TRP CB CG sing N N 256 TRP CB HB2 sing N N 257 TRP CB HB3 sing N N 258 TRP CG CD1 doub Y N 259 TRP CG CD2 sing Y N 260 TRP CD1 NE1 sing Y N 261 TRP CD1 HD1 sing N N 262 TRP CD2 CE2 doub Y N 263 TRP CD2 CE3 sing Y N 264 TRP NE1 CE2 sing Y N 265 TRP NE1 HE1 sing N N 266 TRP CE2 CZ2 sing Y N 267 TRP CE3 CZ3 doub Y N 268 TRP CE3 HE3 sing N N 269 TRP CZ2 CH2 doub Y N 270 TRP CZ2 HZ2 sing N N 271 TRP CZ3 CH2 sing Y N 272 TRP CZ3 HZ3 sing N N 273 TRP CH2 HH2 sing N N 274 TRP OXT HXT sing N N 275 TYR N CA sing N N 276 TYR N H sing N N 277 TYR N H2 sing N N 278 TYR CA C sing N N 279 TYR CA CB sing N N 280 TYR CA HA sing N N 281 TYR C O doub N N 282 TYR C OXT sing N N 283 TYR CB CG sing N N 284 TYR CB HB2 sing N N 285 TYR CB HB3 sing N N 286 TYR CG CD1 doub Y N 287 TYR CG CD2 sing Y N 288 TYR CD1 CE1 sing Y N 289 TYR CD1 HD1 sing N N 290 TYR CD2 CE2 doub Y N 291 TYR CD2 HD2 sing N N 292 TYR CE1 CZ doub Y N 293 TYR CE1 HE1 sing N N 294 TYR CE2 CZ sing Y N 295 TYR CE2 HE2 sing N N 296 TYR CZ OH sing N N 297 TYR OH HH sing N N 298 TYR OXT HXT sing N N 299 VAL N CA sing N N 300 VAL N H sing N N 301 VAL N H2 sing N N 302 VAL CA C sing N N 303 VAL CA CB sing N N 304 VAL CA HA sing N N 305 VAL C O doub N N 306 VAL C OXT sing N N 307 VAL CB CG1 sing N N 308 VAL CB CG2 sing N N 309 VAL CB HB sing N N 310 VAL CG1 HG11 sing N N 311 VAL CG1 HG12 sing N N 312 VAL CG1 HG13 sing N N 313 VAL CG2 HG21 sing N N 314 VAL CG2 HG22 sing N N 315 VAL CG2 HG23 sing N N 316 VAL OXT HXT sing N N 317 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1AIK _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6JQK _atom_sites.fract_transf_matrix[1][1] 0.021680 _atom_sites.fract_transf_matrix[1][2] 0.012517 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025034 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006976 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_