data_6JUE # _entry.id 6JUE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6JUE pdb_00006jue 10.2210/pdb6jue/pdb WWPDB D_1300011822 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6JUE _pdbx_database_status.recvd_initial_deposition_date 2019-04-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Liu, Z.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-9236-0382 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 2266 _citation.page_last 2266 _citation.title 'Par complex cluster formation mediated by phase separation.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-020-16135-6 _citation.pdbx_database_id_PubMed 32385244 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Z.' 1 ? primary 'Yang, Y.' 2 ? primary 'Gu, A.' 3 ? primary 'Xu, J.' 4 ? primary 'Mao, Y.' 5 ? primary 'Lu, H.' 6 ? primary 'Hu, W.' 7 0000-0002-7397-6800 primary 'Lei, Q.Y.' 8 0000-0002-8547-8518 primary 'Li, Z.' 9 0000-0002-7660-8579 primary 'Zhang, M.' 10 0000-0001-9404-0190 primary 'Cai, Y.' 11 0000-0003-2044-3290 primary 'Wen, W.' 12 0000-0002-0798-4730 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6JUE _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.454 _cell.length_a_esd ? _cell.length_b 57.454 _cell.length_b_esd ? _cell.length_c 52.313 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6JUE _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Partitioning defective 3 homolog' 11717.232 1 ? ? 'UNP residues 582-685' ? 2 polymer syn THR-ILE-ILE-THR-LEU 1103.221 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 29 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPGSEFGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKAN QEAMETLRRSMSTEGNKRGMIQLIVARRIS ; ;GPGSEFGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKAN QEAMETLRRSMSTEGNKRGMIQLIVARRIS ; L ? 2 'polypeptide(L)' no no LEEDGTIITL LEEDGTIITL A ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 GLU n 1 6 PHE n 1 7 GLY n 1 8 THR n 1 9 ARG n 1 10 GLU n 1 11 PHE n 1 12 LEU n 1 13 THR n 1 14 PHE n 1 15 GLU n 1 16 VAL n 1 17 PRO n 1 18 LEU n 1 19 ASN n 1 20 ASP n 1 21 SER n 1 22 GLY n 1 23 SER n 1 24 ALA n 1 25 GLY n 1 26 LEU n 1 27 GLY n 1 28 VAL n 1 29 SER n 1 30 VAL n 1 31 LYS n 1 32 GLY n 1 33 ASN n 1 34 ARG n 1 35 SER n 1 36 LYS n 1 37 GLU n 1 38 ASN n 1 39 HIS n 1 40 ALA n 1 41 ASP n 1 42 LEU n 1 43 GLY n 1 44 ILE n 1 45 PHE n 1 46 VAL n 1 47 LYS n 1 48 SER n 1 49 ILE n 1 50 ILE n 1 51 ASN n 1 52 GLY n 1 53 GLY n 1 54 ALA n 1 55 ALA n 1 56 SER n 1 57 LYS n 1 58 ASP n 1 59 GLY n 1 60 ARG n 1 61 LEU n 1 62 ARG n 1 63 VAL n 1 64 ASN n 1 65 ASP n 1 66 GLN n 1 67 LEU n 1 68 ILE n 1 69 ALA n 1 70 VAL n 1 71 ASN n 1 72 GLY n 1 73 GLU n 1 74 SER n 1 75 LEU n 1 76 LEU n 1 77 GLY n 1 78 LYS n 1 79 ALA n 1 80 ASN n 1 81 GLN n 1 82 GLU n 1 83 ALA n 1 84 MET n 1 85 GLU n 1 86 THR n 1 87 LEU n 1 88 ARG n 1 89 ARG n 1 90 SER n 1 91 MET n 1 92 SER n 1 93 THR n 1 94 GLU n 1 95 GLY n 1 96 ASN n 1 97 LYS n 1 98 ARG n 1 99 GLY n 1 100 MET n 1 101 ILE n 1 102 GLN n 1 103 LEU n 1 104 ILE n 1 105 VAL n 1 106 ALA n 1 107 ARG n 1 108 ARG n 1 109 ILE n 1 110 SER n 2 1 LEU n 2 2 GLU n 2 3 GLU n 2 4 ASP n 2 5 GLY n 2 6 THR n 2 7 ILE n 2 8 ILE n 2 9 THR n 2 10 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 110 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Mus musculus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 10090 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PARD3_RAT Q9Z340 ? 1 ;GTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAMET LRRSMSTEGNKRGMIQLIVARRIS ; 582 2 PDB 6JUE 6JUE ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6JUE L 7 ? 110 ? Q9Z340 582 ? 685 ? 7 110 2 2 6JUE A 1 ? 10 ? 6JUE 81 ? 90 ? 81 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6JUE GLY L 1 ? UNP Q9Z340 ? ? 'expression tag' 1 1 1 6JUE PRO L 2 ? UNP Q9Z340 ? ? 'expression tag' 2 2 1 6JUE GLY L 3 ? UNP Q9Z340 ? ? 'expression tag' 3 3 1 6JUE SER L 4 ? UNP Q9Z340 ? ? 'expression tag' 4 4 1 6JUE GLU L 5 ? UNP Q9Z340 ? ? 'expression tag' 5 5 1 6JUE PHE L 6 ? UNP Q9Z340 ? ? 'expression tag' 6 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6JUE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4M ammonium sulfate and 0.1M citrate (pH 4.0)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6JUE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.549 _reflns.d_resolution_low 49.757 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14300 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.0 _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.55 _reflns_shell.d_res_low 1.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2038 _reflns_shell.percent_possible_all 98.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.503 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.783 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6JUE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.549 _refine.ls_d_res_low 49.757 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14250 _refine.ls_number_reflns_R_free 648 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.18 _refine.ls_percent_reflns_R_free 4.55 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2115 _refine.ls_R_factor_R_free 0.2226 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2109 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2K1Z _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.74 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 708 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 752 _refine_hist.d_res_high 1.549 _refine_hist.d_res_low 49.757 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 730 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.729 ? 980 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.310 ? 430 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 120 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 123 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5486 1.6682 . . 133 2625 97.00 . . . 0.3014 . 0.2569 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6682 1.8361 . . 116 2742 100.00 . . . 0.2736 . 0.2215 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8361 2.1018 . . 126 2741 100.00 . . . 0.2567 . 0.2113 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1018 2.6480 . . 131 2735 100.00 . . . 0.2266 . 0.2151 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6480 49.7823 . . 142 2759 99.00 . . . 0.2000 . 0.2022 . . . . . . . . . . # _struct.entry_id 6JUE _struct.title 'The complex of PDZ and PBM' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6JUE _struct_keywords.text 'PDZ-binding motif peptide, complex, PEPTIDE BINDING PROTEIN' _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 53 ? GLY A 59 ? GLY L 53 GLY L 59 1 ? 7 HELX_P HELX_P2 AA2 ALA A 79 ? SER A 92 ? ALA L 79 SER L 92 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 10 ? LEU A 18 ? GLU L 10 LEU L 18 AA1 2 GLY A 99 ? ARG A 107 ? GLY L 99 ARG L 107 AA1 3 GLN A 66 ? VAL A 70 ? GLN L 66 VAL L 70 AA1 4 GLU A 73 ? SER A 74 ? GLU L 73 SER L 74 AA2 1 ALA A 40 ? ILE A 49 ? ALA L 40 ILE L 49 AA2 2 VAL A 28 ? SER A 35 ? VAL L 28 SER L 35 AA2 3 ILE B 7 ? THR B 9 ? ILE A 87 THR A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 16 ? N VAL L 16 O ILE A 101 ? O ILE L 101 AA1 2 3 O ILE A 104 ? O ILE L 104 N ILE A 68 ? N ILE L 68 AA1 3 4 N VAL A 70 ? N VAL L 70 O GLU A 73 ? O GLU L 73 AA2 1 2 O LEU A 42 ? O LEU L 42 N ASN A 33 ? N ASN L 33 AA2 2 3 N VAL A 30 ? N VAL L 30 O ILE B 8 ? O ILE A 88 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software L SO4 201 ? 7 'binding site for residue SO4 L 201' AC2 Software L SO4 202 ? 6 'binding site for residue SO4 L 202' AC3 Software L SO4 203 ? 3 'binding site for residue SO4 L 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLU A 5 ? GLU L 5 . ? 1_555 ? 2 AC1 7 PHE A 6 ? PHE L 6 . ? 1_555 ? 3 AC1 7 GLY A 7 ? GLY L 7 . ? 1_555 ? 4 AC1 7 ARG A 60 ? ARG L 60 . ? 3_665 ? 5 AC1 7 ARG A 89 ? ARG L 89 . ? 6_555 ? 6 AC1 7 HOH F . ? HOH L 301 . ? 3_665 ? 7 AC1 7 HOH F . ? HOH L 310 . ? 1_555 ? 8 AC2 6 GLY A 7 ? GLY L 7 . ? 2_655 ? 9 AC2 6 THR A 8 ? THR L 8 . ? 2_655 ? 10 AC2 6 ARG A 60 ? ARG L 60 . ? 1_555 ? 11 AC2 6 ARG A 88 ? ARG L 88 . ? 4_655 ? 12 AC2 6 ARG A 108 ? ARG L 108 . ? 2_655 ? 13 AC2 6 HOH F . ? HOH L 304 . ? 1_555 ? 14 AC3 3 SER A 35 ? SER L 35 . ? 1_555 ? 15 AC3 3 LYS A 36 ? LYS L 36 . ? 1_555 ? 16 AC3 3 GLU A 37 ? GLU L 37 . ? 1_555 ? # _atom_sites.entry_id 6JUE _atom_sites.fract_transf_matrix[1][1] 0.017405 _atom_sites.fract_transf_matrix[1][2] 0.010049 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020098 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019116 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? L . n A 1 2 PRO 2 2 ? ? ? L . n A 1 3 GLY 3 3 ? ? ? L . n A 1 4 SER 4 4 ? ? ? L . n A 1 5 GLU 5 5 5 GLU GLU L . n A 1 6 PHE 6 6 6 PHE PHE L . n A 1 7 GLY 7 7 7 GLY GLY L . n A 1 8 THR 8 8 8 THR THR L . n A 1 9 ARG 9 9 9 ARG ARG L . n A 1 10 GLU 10 10 10 GLU GLU L . n A 1 11 PHE 11 11 11 PHE PHE L . n A 1 12 LEU 12 12 12 LEU LEU L . n A 1 13 THR 13 13 13 THR THR L . n A 1 14 PHE 14 14 14 PHE PHE L . n A 1 15 GLU 15 15 15 GLU GLU L . n A 1 16 VAL 16 16 16 VAL VAL L . n A 1 17 PRO 17 17 17 PRO PRO L . n A 1 18 LEU 18 18 18 LEU LEU L . n A 1 19 ASN 19 19 ? ? ? L . n A 1 20 ASP 20 20 ? ? ? L . n A 1 21 SER 21 21 ? ? ? L . n A 1 22 GLY 22 22 ? ? ? L . n A 1 23 SER 23 23 ? ? ? L . n A 1 24 ALA 24 24 24 ALA ALA L . n A 1 25 GLY 25 25 25 GLY GLY L . n A 1 26 LEU 26 26 26 LEU LEU L . n A 1 27 GLY 27 27 27 GLY GLY L . n A 1 28 VAL 28 28 28 VAL VAL L . n A 1 29 SER 29 29 29 SER SER L . n A 1 30 VAL 30 30 30 VAL VAL L . n A 1 31 LYS 31 31 31 LYS LYS L . n A 1 32 GLY 32 32 32 GLY GLY L . n A 1 33 ASN 33 33 33 ASN ASN L . n A 1 34 ARG 34 34 34 ARG ARG L . n A 1 35 SER 35 35 35 SER SER L . n A 1 36 LYS 36 36 36 LYS LYS L . n A 1 37 GLU 37 37 37 GLU GLU L . n A 1 38 ASN 38 38 38 ASN ASN L . n A 1 39 HIS 39 39 39 HIS HIS L . n A 1 40 ALA 40 40 40 ALA ALA L . n A 1 41 ASP 41 41 41 ASP ASP L . n A 1 42 LEU 42 42 42 LEU LEU L . n A 1 43 GLY 43 43 43 GLY GLY L . n A 1 44 ILE 44 44 44 ILE ILE L . n A 1 45 PHE 45 45 45 PHE PHE L . n A 1 46 VAL 46 46 46 VAL VAL L . n A 1 47 LYS 47 47 47 LYS LYS L . n A 1 48 SER 48 48 48 SER SER L . n A 1 49 ILE 49 49 49 ILE ILE L . n A 1 50 ILE 50 50 50 ILE ILE L . n A 1 51 ASN 51 51 51 ASN ASN L . n A 1 52 GLY 52 52 52 GLY GLY L . n A 1 53 GLY 53 53 53 GLY GLY L . n A 1 54 ALA 54 54 54 ALA ALA L . n A 1 55 ALA 55 55 55 ALA ALA L . n A 1 56 SER 56 56 56 SER SER L . n A 1 57 LYS 57 57 57 LYS LYS L . n A 1 58 ASP 58 58 58 ASP ASP L . n A 1 59 GLY 59 59 59 GLY GLY L . n A 1 60 ARG 60 60 60 ARG ARG L . n A 1 61 LEU 61 61 61 LEU LEU L . n A 1 62 ARG 62 62 62 ARG ARG L . n A 1 63 VAL 63 63 63 VAL VAL L . n A 1 64 ASN 64 64 64 ASN ASN L . n A 1 65 ASP 65 65 65 ASP ASP L . n A 1 66 GLN 66 66 66 GLN GLN L . n A 1 67 LEU 67 67 67 LEU LEU L . n A 1 68 ILE 68 68 68 ILE ILE L . n A 1 69 ALA 69 69 69 ALA ALA L . n A 1 70 VAL 70 70 70 VAL VAL L . n A 1 71 ASN 71 71 71 ASN ASN L . n A 1 72 GLY 72 72 72 GLY GLY L . n A 1 73 GLU 73 73 73 GLU GLU L . n A 1 74 SER 74 74 74 SER SER L . n A 1 75 LEU 75 75 75 LEU LEU L . n A 1 76 LEU 76 76 76 LEU LEU L . n A 1 77 GLY 77 77 77 GLY GLY L . n A 1 78 LYS 78 78 78 LYS LYS L . n A 1 79 ALA 79 79 79 ALA ALA L . n A 1 80 ASN 80 80 80 ASN ASN L . n A 1 81 GLN 81 81 81 GLN GLN L . n A 1 82 GLU 82 82 82 GLU GLU L . n A 1 83 ALA 83 83 83 ALA ALA L . n A 1 84 MET 84 84 84 MET MET L . n A 1 85 GLU 85 85 85 GLU GLU L . n A 1 86 THR 86 86 86 THR THR L . n A 1 87 LEU 87 87 87 LEU LEU L . n A 1 88 ARG 88 88 88 ARG ARG L . n A 1 89 ARG 89 89 89 ARG ARG L . n A 1 90 SER 90 90 90 SER SER L . n A 1 91 MET 91 91 91 MET MET L . n A 1 92 SER 92 92 92 SER SER L . n A 1 93 THR 93 93 93 THR THR L . n A 1 94 GLU 94 94 94 GLU GLU L . n A 1 95 GLY 95 95 ? ? ? L . n A 1 96 ASN 96 96 ? ? ? L . n A 1 97 LYS 97 97 ? ? ? L . n A 1 98 ARG 98 98 98 ARG ARG L . n A 1 99 GLY 99 99 99 GLY GLY L . n A 1 100 MET 100 100 100 MET MET L . n A 1 101 ILE 101 101 101 ILE ILE L . n A 1 102 GLN 102 102 102 GLN GLN L . n A 1 103 LEU 103 103 103 LEU LEU L . n A 1 104 ILE 104 104 104 ILE ILE L . n A 1 105 VAL 105 105 105 VAL VAL L . n A 1 106 ALA 106 106 106 ALA ALA L . n A 1 107 ARG 107 107 107 ARG ARG L . n A 1 108 ARG 108 108 108 ARG ARG L . n A 1 109 ILE 109 109 ? ? ? L . n A 1 110 SER 110 110 ? ? ? L . n B 2 1 LEU 1 81 ? ? ? A . n B 2 2 GLU 2 82 ? ? ? A . n B 2 3 GLU 3 83 ? ? ? A . n B 2 4 ASP 4 84 ? ? ? A . n B 2 5 GLY 5 85 ? ? ? A . n B 2 6 THR 6 86 86 THR THR A . n B 2 7 ILE 7 87 87 ILE ILE A . n B 2 8 ILE 8 88 88 ILE ILE A . n B 2 9 THR 9 89 89 THR THR A . n B 2 10 LEU 10 90 90 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 201 1 SO4 SO4 L . D 3 SO4 1 202 2 SO4 SO4 L . E 3 SO4 1 203 3 SO4 SO4 L . F 4 HOH 1 301 11 HOH HOH L . F 4 HOH 2 302 24 HOH HOH L . F 4 HOH 3 303 29 HOH HOH L . F 4 HOH 4 304 23 HOH HOH L . F 4 HOH 5 305 18 HOH HOH L . F 4 HOH 6 306 13 HOH HOH L . F 4 HOH 7 307 20 HOH HOH L . F 4 HOH 8 308 10 HOH HOH L . F 4 HOH 9 309 1 HOH HOH L . F 4 HOH 10 310 5 HOH HOH L . F 4 HOH 11 311 2 HOH HOH L . F 4 HOH 12 312 16 HOH HOH L . F 4 HOH 13 313 19 HOH HOH L . F 4 HOH 14 314 26 HOH HOH L . F 4 HOH 15 315 3 HOH HOH L . F 4 HOH 16 316 9 HOH HOH L . F 4 HOH 17 317 7 HOH HOH L . F 4 HOH 18 318 4 HOH HOH L . F 4 HOH 19 319 6 HOH HOH L . F 4 HOH 20 320 8 HOH HOH L . F 4 HOH 21 321 14 HOH HOH L . F 4 HOH 22 322 12 HOH HOH L . F 4 HOH 23 323 17 HOH HOH L . F 4 HOH 24 324 15 HOH HOH L . F 4 HOH 25 325 22 HOH HOH L . F 4 HOH 26 326 27 HOH HOH L . F 4 HOH 27 327 28 HOH HOH L . F 4 HOH 28 328 31 HOH HOH L . F 4 HOH 29 329 30 HOH HOH L . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1160 ? 1 MORE -33 ? 1 'SSA (A^2)' 6120 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id L _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 324 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-22 2 'Structure model' 1 1 2020-11-04 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Refinement description' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 2 'Structure model' software 5 2 'Structure model' struct 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 9 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation.country' 3 2 'Structure model' '_citation.journal_abbrev' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_software.name' 14 2 'Structure model' '_struct.title' 15 3 'Structure model' '_database_2.pdbx_DOI' 16 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 25.9726 8.5247 -6.5159 0.1490 0.1382 0.0534 0.0026 -0.0051 0.0099 7.0081 8.6100 3.1108 -3.1022 -0.4259 -0.2043 0.1862 -0.1684 0.0065 0.0187 0.0400 0.0609 0.0970 0.1331 0.2057 'X-RAY DIFFRACTION' 2 ? refined 19.529 -2.188 -11.945 0.1702 0.1764 0.3004 0.0060 -0.0496 -0.0014 8.2949 5.8285 5.9046 -5.8683 4.7276 -3.5631 -0.1124 0.0586 0.0904 0.0315 0.2747 -0.5282 0.2243 0.1954 0.4512 'X-RAY DIFFRACTION' 3 ? refined 16.3776 3.0320 -9.4811 0.1343 0.1181 0.1162 -0.0098 0.0268 -0.0358 8.7928 5.5514 3.5440 -3.9304 2.2359 -1.8842 0.1083 0.0711 -0.1701 -0.2100 -0.3463 0.2840 0.1084 0.1265 -0.1863 'X-RAY DIFFRACTION' 4 ? refined 23.6818 6.6290 -11.6000 0.1386 0.0838 0.1290 -0.0127 -0.0174 -0.0307 4.8095 4.4493 7.8267 -1.5985 3.1381 -2.5384 0.0515 -0.1382 0.0948 0.1569 -0.2046 0.0837 -0.1061 -0.1529 0.0839 'X-RAY DIFFRACTION' 5 ? refined 20.5199 2.4348 -21.4477 0.1750 0.2186 0.1754 -0.0185 0.0117 -0.0607 9.9958 7.3223 6.1824 -6.2359 -5.8423 4.7039 -0.0622 -0.1748 0.2157 0.0732 -0.5489 0.0795 -0.1266 -0.1497 -0.0335 'X-RAY DIFFRACTION' 6 ? refined 29.9720 2.6003 -11.9655 0.1680 0.1768 0.1626 0.0557 0.0210 0.0198 2.3431 0.8741 1.6182 0.0212 1.9491 -0.0563 -0.0845 0.2513 -0.1234 -0.0396 -0.2986 -0.1110 0.0799 0.4025 0.6215 'X-RAY DIFFRACTION' 7 ? refined 16.5463 -3.7926 -15.1606 0.2155 0.2369 0.2707 0.0255 -0.0508 -0.0193 3.4582 2.7855 4.2066 -1.0800 -3.5076 -0.1644 0.0571 -0.1769 0.1437 0.1716 0.1344 0.2787 -0.5814 0.0645 -0.1153 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 L 5 L 18 '( CHAIN L AND RESID 5:18 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 L 24 L 33 '( CHAIN L AND RESID 24:33 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 L 34 L 58 '( CHAIN L AND RESID 34:58 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 L 59 L 79 '( CHAIN L AND RESID 59:79 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 L 80 L 91 '( CHAIN L AND RESID 80:91 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 L 92 L 108 '( CHAIN L AND RESID 92:108 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 86 A 90 '( CHAIN A AND RESID 86:90 )' ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 L GLU 5 ? CG ? A GLU 5 CG 2 1 Y 1 L GLU 5 ? CD ? A GLU 5 CD 3 1 Y 1 L GLU 5 ? OE1 ? A GLU 5 OE1 4 1 Y 1 L GLU 5 ? OE2 ? A GLU 5 OE2 5 1 Y 1 L GLU 10 ? CG ? A GLU 10 CG 6 1 Y 1 L GLU 10 ? CD ? A GLU 10 CD 7 1 Y 1 L GLU 10 ? OE1 ? A GLU 10 OE1 8 1 Y 1 L GLU 10 ? OE2 ? A GLU 10 OE2 9 1 Y 1 L LEU 18 ? CG ? A LEU 18 CG 10 1 Y 1 L LEU 18 ? CD1 ? A LEU 18 CD1 11 1 Y 1 L LEU 18 ? CD2 ? A LEU 18 CD2 12 1 Y 1 L LYS 31 ? CE ? A LYS 31 CE 13 1 Y 1 L LYS 31 ? NZ ? A LYS 31 NZ 14 1 Y 1 L ASN 33 ? OD1 ? A ASN 33 OD1 15 1 Y 1 L ARG 34 ? CG ? A ARG 34 CG 16 1 Y 1 L ARG 34 ? CD ? A ARG 34 CD 17 1 Y 1 L ARG 34 ? NE ? A ARG 34 NE 18 1 Y 1 L ARG 34 ? CZ ? A ARG 34 CZ 19 1 Y 1 L ARG 34 ? NH1 ? A ARG 34 NH1 20 1 Y 1 L ARG 34 ? NH2 ? A ARG 34 NH2 21 1 Y 1 L LYS 36 ? CD ? A LYS 36 CD 22 1 Y 1 L LYS 36 ? CE ? A LYS 36 CE 23 1 Y 1 L LYS 36 ? NZ ? A LYS 36 NZ 24 1 Y 1 L GLU 37 ? CG ? A GLU 37 CG 25 1 Y 1 L GLU 37 ? CD ? A GLU 37 CD 26 1 Y 1 L GLU 37 ? OE1 ? A GLU 37 OE1 27 1 Y 1 L GLU 37 ? OE2 ? A GLU 37 OE2 28 1 Y 1 L LYS 47 ? CG ? A LYS 47 CG 29 1 Y 1 L LYS 47 ? CD ? A LYS 47 CD 30 1 Y 1 L LYS 47 ? CE ? A LYS 47 CE 31 1 Y 1 L LYS 47 ? NZ ? A LYS 47 NZ 32 1 Y 1 L ILE 50 ? CG2 ? A ILE 50 CG2 33 1 Y 1 L LYS 57 ? CG ? A LYS 57 CG 34 1 Y 1 L LYS 57 ? CD ? A LYS 57 CD 35 1 Y 1 L LYS 57 ? CE ? A LYS 57 CE 36 1 Y 1 L LYS 57 ? NZ ? A LYS 57 NZ 37 1 Y 1 L GLU 73 ? CG ? A GLU 73 CG 38 1 Y 1 L GLU 73 ? CD ? A GLU 73 CD 39 1 Y 1 L GLU 73 ? OE1 ? A GLU 73 OE1 40 1 Y 1 L GLU 73 ? OE2 ? A GLU 73 OE2 41 1 Y 1 L LEU 76 ? CD1 ? A LEU 76 CD1 42 1 Y 1 L GLN 81 ? CG ? A GLN 81 CG 43 1 Y 1 L GLN 81 ? CD ? A GLN 81 CD 44 1 Y 1 L GLN 81 ? OE1 ? A GLN 81 OE1 45 1 Y 1 L GLN 81 ? NE2 ? A GLN 81 NE2 46 1 Y 1 L GLU 82 ? OE1 ? A GLU 82 OE1 47 1 Y 1 L GLU 85 ? CD ? A GLU 85 CD 48 1 Y 1 L GLU 85 ? OE1 ? A GLU 85 OE1 49 1 Y 1 L GLU 85 ? OE2 ? A GLU 85 OE2 50 1 Y 1 L ARG 88 ? NH1 ? A ARG 88 NH1 51 1 Y 1 L GLU 94 ? CG ? A GLU 94 CG 52 1 Y 1 L GLU 94 ? CD ? A GLU 94 CD 53 1 Y 1 L GLU 94 ? OE1 ? A GLU 94 OE1 54 1 Y 1 L GLU 94 ? OE2 ? A GLU 94 OE2 55 1 Y 1 L ARG 98 ? NH1 ? A ARG 98 NH1 56 1 Y 1 L ARG 98 ? NH2 ? A ARG 98 NH2 57 1 Y 1 L ILE 101 ? CD1 ? A ILE 101 CD1 58 1 Y 1 L ARG 108 ? NE ? A ARG 108 NE 59 1 Y 1 L ARG 108 ? CZ ? A ARG 108 CZ 60 1 Y 1 L ARG 108 ? NH1 ? A ARG 108 NH1 61 1 Y 1 L ARG 108 ? NH2 ? A ARG 108 NH2 62 1 Y 1 A ILE 88 ? CD1 ? B ILE 8 CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 L GLY 1 ? A GLY 1 2 1 Y 1 L PRO 2 ? A PRO 2 3 1 Y 1 L GLY 3 ? A GLY 3 4 1 Y 1 L SER 4 ? A SER 4 5 1 Y 1 L ASN 19 ? A ASN 19 6 1 Y 1 L ASP 20 ? A ASP 20 7 1 Y 1 L SER 21 ? A SER 21 8 1 Y 1 L GLY 22 ? A GLY 22 9 1 Y 1 L SER 23 ? A SER 23 10 1 Y 1 L GLY 95 ? A GLY 95 11 1 Y 1 L ASN 96 ? A ASN 96 12 1 Y 1 L LYS 97 ? A LYS 97 13 1 Y 1 L ILE 109 ? A ILE 109 14 1 Y 1 L SER 110 ? A SER 110 15 1 Y 1 A LEU 81 ? B LEU 1 16 1 Y 1 A GLU 82 ? B GLU 2 17 1 Y 1 A GLU 83 ? B GLU 3 18 1 Y 1 A ASP 84 ? B ASP 4 19 1 Y 1 A GLY 85 ? B GLY 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SO4 S S N N 290 SO4 O1 O N N 291 SO4 O2 O N N 292 SO4 O3 O N N 293 SO4 O4 O N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 VAL N N N N 312 VAL CA C N S 313 VAL C C N N 314 VAL O O N N 315 VAL CB C N N 316 VAL CG1 C N N 317 VAL CG2 C N N 318 VAL OXT O N N 319 VAL H H N N 320 VAL H2 H N N 321 VAL HA H N N 322 VAL HB H N N 323 VAL HG11 H N N 324 VAL HG12 H N N 325 VAL HG13 H N N 326 VAL HG21 H N N 327 VAL HG22 H N N 328 VAL HG23 H N N 329 VAL HXT H N N 330 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SO4 S O1 doub N N 277 SO4 S O2 doub N N 278 SO4 S O3 sing N N 279 SO4 S O4 sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 VAL N CA sing N N 297 VAL N H sing N N 298 VAL N H2 sing N N 299 VAL CA C sing N N 300 VAL CA CB sing N N 301 VAL CA HA sing N N 302 VAL C O doub N N 303 VAL C OXT sing N N 304 VAL CB CG1 sing N N 305 VAL CB CG2 sing N N 306 VAL CB HB sing N N 307 VAL CG1 HG11 sing N N 308 VAL CG1 HG12 sing N N 309 VAL CG1 HG13 sing N N 310 VAL CG2 HG21 sing N N 311 VAL CG2 HG22 sing N N 312 VAL CG2 HG23 sing N N 313 VAL OXT HXT sing N N 314 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China' China 31871394 1 'National Natural Science Foundation of China' China 31670730 2 'National Natural Science Foundation of China' China 31422015 3 'Ministry of Science and Technology (China)' China 2014CB910201 4 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2K1Z _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support immunoprecipitation _pdbx_struct_assembly_auth_evidence.details ? #