data_6KH5 # _entry.id 6KH5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KH5 pdb_00006kh5 10.2210/pdb6kh5/pdb WWPDB D_1300012981 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6KH5 _pdbx_database_status.recvd_initial_deposition_date 2019-07-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gu, C.' 1 ? 'Chen, H.' 2 ? 'Wang, Y.' 3 ? 'Zhang, T.' 4 ? 'Wang, H.' 5 ? 'Zhao, G.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chemistry _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 0947-6539 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first 3016 _citation.page_last 3021 _citation.title 'Structural Insight into Binary Protein Metal-Organic Frameworks with Ferritin Nanocages as Linkers and Nickel Clusters as Nodes.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/chem.201905315 _citation.pdbx_database_id_PubMed 31820500 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gu, C.' 1 0000-0002-8564-3827 primary 'Chen, H.' 2 ? primary 'Wang, Y.' 3 ? primary 'Zhang, T.' 4 0000-0002-0900-9285 primary 'Wang, H.' 5 ? primary 'Zhao, G.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6KH5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 118.533 _cell.length_a_esd ? _cell.length_b 118.533 _cell.length_b_esd ? _cell.length_c 118.533 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6KH5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 207 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Ferritin 19534.824 1 1.16.3.1 T161H ? ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 non-polymer syn 'NICKEL (II) ION' 58.693 3 ? ? ? ? 4 water nat water 18.015 54 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ASQVRQNYHEDCEASINKQINMELYASYVYLSMAYYFERDDVALPGFAKFFKESSDEEREHAQTFMKYQNKRGGRIVLQQ IAAPSMQEWGTGLEALQAALDLEKQVNQSLLELHSTASGNNDPHLTKLLEDEYLEEQVDSIKKIGDMITKLKRAGPHHGL GEYMFDKELN ; _entity_poly.pdbx_seq_one_letter_code_can ;ASQVRQNYHEDCEASINKQINMELYASYVYLSMAYYFERDDVALPGFAKFFKESSDEEREHAQTFMKYQNKRGGRIVLQQ IAAPSMQEWGTGLEALQAALDLEKQVNQSLLELHSTASGNNDPHLTKLLEDEYLEEQVDSIKKIGDMITKLKRAGPHHGL GEYMFDKELN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 GLN n 1 4 VAL n 1 5 ARG n 1 6 GLN n 1 7 ASN n 1 8 TYR n 1 9 HIS n 1 10 GLU n 1 11 ASP n 1 12 CYS n 1 13 GLU n 1 14 ALA n 1 15 SER n 1 16 ILE n 1 17 ASN n 1 18 LYS n 1 19 GLN n 1 20 ILE n 1 21 ASN n 1 22 MET n 1 23 GLU n 1 24 LEU n 1 25 TYR n 1 26 ALA n 1 27 SER n 1 28 TYR n 1 29 VAL n 1 30 TYR n 1 31 LEU n 1 32 SER n 1 33 MET n 1 34 ALA n 1 35 TYR n 1 36 TYR n 1 37 PHE n 1 38 GLU n 1 39 ARG n 1 40 ASP n 1 41 ASP n 1 42 VAL n 1 43 ALA n 1 44 LEU n 1 45 PRO n 1 46 GLY n 1 47 PHE n 1 48 ALA n 1 49 LYS n 1 50 PHE n 1 51 PHE n 1 52 LYS n 1 53 GLU n 1 54 SER n 1 55 SER n 1 56 ASP n 1 57 GLU n 1 58 GLU n 1 59 ARG n 1 60 GLU n 1 61 HIS n 1 62 ALA n 1 63 GLN n 1 64 THR n 1 65 PHE n 1 66 MET n 1 67 LYS n 1 68 TYR n 1 69 GLN n 1 70 ASN n 1 71 LYS n 1 72 ARG n 1 73 GLY n 1 74 GLY n 1 75 ARG n 1 76 ILE n 1 77 VAL n 1 78 LEU n 1 79 GLN n 1 80 GLN n 1 81 ILE n 1 82 ALA n 1 83 ALA n 1 84 PRO n 1 85 SER n 1 86 MET n 1 87 GLN n 1 88 GLU n 1 89 TRP n 1 90 GLY n 1 91 THR n 1 92 GLY n 1 93 LEU n 1 94 GLU n 1 95 ALA n 1 96 LEU n 1 97 GLN n 1 98 ALA n 1 99 ALA n 1 100 LEU n 1 101 ASP n 1 102 LEU n 1 103 GLU n 1 104 LYS n 1 105 GLN n 1 106 VAL n 1 107 ASN n 1 108 GLN n 1 109 SER n 1 110 LEU n 1 111 LEU n 1 112 GLU n 1 113 LEU n 1 114 HIS n 1 115 SER n 1 116 THR n 1 117 ALA n 1 118 SER n 1 119 GLY n 1 120 ASN n 1 121 ASN n 1 122 ASP n 1 123 PRO n 1 124 HIS n 1 125 LEU n 1 126 THR n 1 127 LYS n 1 128 LEU n 1 129 LEU n 1 130 GLU n 1 131 ASP n 1 132 GLU n 1 133 TYR n 1 134 LEU n 1 135 GLU n 1 136 GLU n 1 137 GLN n 1 138 VAL n 1 139 ASP n 1 140 SER n 1 141 ILE n 1 142 LYS n 1 143 LYS n 1 144 ILE n 1 145 GLY n 1 146 ASP n 1 147 MET n 1 148 ILE n 1 149 THR n 1 150 LYS n 1 151 LEU n 1 152 LYS n 1 153 ARG n 1 154 ALA n 1 155 GLY n 1 156 PRO n 1 157 HIS n 1 158 HIS n 1 159 GLY n 1 160 LEU n 1 161 GLY n 1 162 GLU n 1 163 TYR n 1 164 MET n 1 165 PHE n 1 166 ASP n 1 167 LYS n 1 168 GLU n 1 169 LEU n 1 170 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 170 _entity_src_gen.gene_src_common_name 'Kuruma prawn' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Penaeus japonicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 27405 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K-12 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code T2B7E1_PENJP _struct_ref.pdbx_db_accession T2B7E1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASQVRQNYHEDCEASINKQINMELYASYVYLSMAYYFERDDVALPGFAKFFKESSDEEREHAQTFMKYQNKRGGRIVLQQ IAAPSMQEWGTGLEALQAALDLEKQVNQSLLELHSTASGNNDPHLTKLLEDEYLEEQVDSIKKIGDMITKLKRAGPTGLG EYMFDKELN ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6KH5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 170 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession T2B7E1 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 170 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 173 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6KH5 HIS A 157 ? UNP T2B7E1 ? ? insertion 160 1 1 6KH5 HIS A 158 ? UNP T2B7E1 THR 158 'engineered mutation' 161 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KH5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1 M NH4H2PO4, 100 mM Tris ( pH = 8.5 )' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.4938 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.4938 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6KH5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.294 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24172 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 22.000 _reflns.pdbx_Rmerge_I_obs 0.190 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.892 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.194 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.300 2.380 ? ? ? ? ? ? 1287 100.000 ? ? ? ? 1.083 ? ? ? ? ? ? ? ? 19.000 ? 0.650 ? ? 1.112 0.251 ? 1 1 0.968 ? ? 2.380 2.480 ? ? ? ? ? ? 1308 100.000 ? ? ? ? 0.996 ? ? ? ? ? ? ? ? 21.600 ? 0.673 ? ? 1.020 0.217 ? 2 1 0.971 ? ? 2.480 2.590 ? ? ? ? ? ? 1288 100.000 ? ? ? ? 0.761 ? ? ? ? ? ? ? ? 21.800 ? 0.722 ? ? 0.780 0.166 ? 3 1 0.977 ? ? 2.590 2.730 ? ? ? ? ? ? 1299 100.000 ? ? ? ? 0.549 ? ? ? ? ? ? ? ? 23.600 ? 0.763 ? ? 0.561 0.115 ? 4 1 0.987 ? ? 2.730 2.900 ? ? ? ? ? ? 1328 100.000 ? ? ? ? 0.395 ? ? ? ? ? ? ? ? 22.800 ? 0.871 ? ? 0.404 0.084 ? 5 1 0.991 ? ? 2.900 3.120 ? ? ? ? ? ? 1314 100.000 ? ? ? ? 0.245 ? ? ? ? ? ? ? ? 23.500 ? 1.053 ? ? 0.250 0.051 ? 6 1 0.994 ? ? 3.120 3.440 ? ? ? ? ? ? 1321 100.000 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 22.900 ? 1.031 ? ? 0.180 0.038 ? 7 1 0.995 ? ? 3.440 3.930 ? ? ? ? ? ? 1341 100.000 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 23.000 ? 1.053 ? ? 0.130 0.027 ? 8 1 0.995 ? ? 3.930 4.950 ? ? ? ? ? ? 1380 100.000 ? ? ? ? 0.108 ? ? ? ? ? ? ? ? 21.800 ? 0.998 ? ? 0.110 0.023 ? 9 1 0.997 ? ? 4.950 50.000 ? ? ? ? ? ? 1481 99.600 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 20.400 ? 1.023 ? ? 0.094 0.021 ? 10 1 0.998 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 192.360 _refine.B_iso_mean 31.7986 _refine.B_iso_min 14.650 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6KH5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2940 _refine.ls_d_res_low 39.5110 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24172 _refine.ls_number_reflns_R_free 2425 _refine.ls_number_reflns_R_work 21747 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_percent_reflns_R_free 10.0300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1631 _refine.ls_R_factor_R_free 0.2029 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1587 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6A4U _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.1100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2940 _refine_hist.d_res_low 39.5110 _refine_hist.number_atoms_solvent 54 _refine_hist.number_atoms_total 1430 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 170 _refine_hist.pdbx_B_iso_mean_ligand 107.88 _refine_hist.pdbx_B_iso_mean_solvent 35.35 _refine_hist.pdbx_number_atoms_protein 1372 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2940 2.3408 . . 141 1304 100.0000 . . . 0.2698 0.0000 0.2000 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3408 2.3917 . . 139 1272 100.0000 . . . 0.2437 0.0000 0.1914 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3917 2.4473 . . 144 1272 100.0000 . . . 0.2173 0.0000 0.1806 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4473 2.5085 . . 142 1285 100.0000 . . . 0.2456 0.0000 0.1842 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5085 2.5763 . . 143 1290 100.0000 . . . 0.2900 0.0000 0.1716 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5763 2.6521 . . 140 1263 100.0000 . . . 0.2190 0.0000 0.1732 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6521 2.7377 . . 142 1281 100.0000 . . . 0.2215 0.0000 0.1619 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7377 2.8355 . . 147 1259 100.0000 . . . 0.1994 0.0000 0.1717 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8355 2.9490 . . 139 1288 100.0000 . . . 0.2316 0.0000 0.1643 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9490 3.0831 . . 141 1264 100.0000 . . . 0.2340 0.0000 0.1688 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0831 3.2456 . . 144 1281 100.0000 . . . 0.2071 0.0000 0.1696 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2456 3.4489 . . 142 1272 100.0000 . . . 0.1921 0.0000 0.1659 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4489 3.7150 . . 146 1285 100.0000 . . . 0.2230 0.0000 0.1533 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7150 4.0885 . . 143 1292 100.0000 . . . 0.1760 0.0000 0.1349 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0885 4.6793 . . 144 1266 100.0000 . . . 0.1416 0.0000 0.1242 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6793 5.8922 . . 141 1283 100.0000 . . . 0.2038 0.0000 0.1516 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.8922 39.5110 . . 147 1290 100.0000 . . . 0.1725 0.0000 0.1626 . . . . . . . . . . . # _struct.entry_id 6KH5 _struct.title 'Design and crystal structure of protein MOFs with ferritin nanocages as linkers and nickel clusters as nodes' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KH5 _struct_keywords.text 'protein MOF, ferritin, nickel, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 9 ? PHE A 37 ? HIS A 10 PHE A 38 1 ? 29 HELX_P HELX_P2 AA2 LEU A 44 ? GLY A 73 ? LEU A 45 GLY A 75 1 ? 30 HELX_P HELX_P3 AA3 THR A 91 ? ASN A 120 ? THR A 93 ASN A 123 1 ? 30 HELX_P HELX_P4 AA4 ASP A 122 ? TYR A 133 ? ASP A 125 TYR A 136 1 ? 12 HELX_P HELX_P5 AA5 TYR A 133 ? GLY A 155 ? TYR A 136 GLY A 158 1 ? 23 HELX_P HELX_P6 AA6 GLY A 159 ? ASN A 170 ? GLY A 162 ASN A 173 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 23 OE1 ? ? ? 1_555 B FE . FE ? ? A GLU 24 A FE 201 1_555 ? ? ? ? ? ? ? 2.174 ? ? metalc2 metalc ? ? A GLU 58 OE1 ? ? ? 1_555 B FE . FE ? ? A GLU 60 A FE 201 1_555 ? ? ? ? ? ? ? 2.202 ? ? metalc3 metalc ? ? A GLU 58 OE2 ? ? ? 1_555 B FE . FE ? ? A GLU 60 A FE 201 1_555 ? ? ? ? ? ? ? 2.228 ? ? metalc4 metalc ? ? A GLU 136 OE2 ? ? ? 1_555 D NI . NI ? ? A GLU 139 A NI 203 1_555 ? ? ? ? ? ? ? 2.566 ? ? metalc5 metalc ? ? A SER 140 OG B ? ? 1_555 D NI . NI ? ? A SER 143 A NI 203 1_555 ? ? ? ? ? ? ? 2.573 ? ? metalc6 metalc ? ? A HIS 157 ND1 ? ? ? 1_555 C NI . NI ? ? A HIS 160 A NI 202 1_555 ? ? ? ? ? ? ? 2.615 ? ? metalc7 metalc ? ? A HIS 157 NE2 ? ? ? 1_555 E NI . NI ? ? A HIS 160 A NI 204 4_565 ? ? ? ? ? ? ? 2.190 ? ? metalc8 metalc ? ? A HIS 158 O ? ? ? 1_555 E NI . NI ? ? A HIS 161 A NI 204 1_555 ? ? ? ? ? ? ? 2.319 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FE 201 ? 5 'binding site for residue FE A 201' AC2 Software A NI 202 ? 1 'binding site for residue NI A 202' AC3 Software A NI 203 ? 3 'binding site for residue NI A 203' AC4 Software A NI 204 ? 4 'binding site for residue NI A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLU A 23 ? GLU A 24 . ? 1_555 ? 2 AC1 5 GLU A 58 ? GLU A 60 . ? 1_555 ? 3 AC1 5 HIS A 61 ? HIS A 63 . ? 1_555 ? 4 AC1 5 HOH F . ? HOH A 305 . ? 1_555 ? 5 AC1 5 HOH F . ? HOH A 317 . ? 1_555 ? 6 AC2 1 HIS A 157 ? HIS A 160 . ? 1_555 ? 7 AC3 3 GLU A 103 ? GLU A 106 . ? 1_555 ? 8 AC3 3 GLU A 136 ? GLU A 139 . ? 1_555 ? 9 AC3 3 SER A 140 ? SER A 143 . ? 1_555 ? 10 AC4 4 HIS A 157 ? HIS A 160 . ? 4_565 ? 11 AC4 4 HIS A 158 ? HIS A 161 . ? 1_555 ? 12 AC4 4 HOH F . ? HOH A 349 . ? 1_555 ? 13 AC4 4 HOH F . ? HOH A 350 . ? 1_555 ? # _atom_sites.entry_id 6KH5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008436 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008436 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008436 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 SER 2 3 3 SER SER A . n A 1 3 GLN 3 4 4 GLN GLN A . n A 1 4 VAL 4 5 5 VAL VAL A . n A 1 5 ARG 5 6 6 ARG ARG A . n A 1 6 GLN 6 7 7 GLN GLN A . n A 1 7 ASN 7 8 8 ASN ASN A . n A 1 8 TYR 8 9 9 TYR TYR A . n A 1 9 HIS 9 10 10 HIS HIS A . n A 1 10 GLU 10 11 11 GLU GLU A . n A 1 11 ASP 11 12 12 ASP ASP A . n A 1 12 CYS 12 13 13 CYS CYS A . n A 1 13 GLU 13 14 14 GLU GLU A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 SER 15 16 16 SER SER A . n A 1 16 ILE 16 17 17 ILE ILE A . n A 1 17 ASN 17 18 18 ASN ASN A . n A 1 18 LYS 18 19 19 LYS LYS A . n A 1 19 GLN 19 20 20 GLN GLN A . n A 1 20 ILE 20 21 21 ILE ILE A . n A 1 21 ASN 21 22 22 ASN ASN A . n A 1 22 MET 22 23 23 MET MET A . n A 1 23 GLU 23 24 24 GLU GLU A . n A 1 24 LEU 24 25 25 LEU LEU A . n A 1 25 TYR 25 26 26 TYR TYR A . n A 1 26 ALA 26 27 27 ALA ALA A . n A 1 27 SER 27 28 28 SER SER A . n A 1 28 TYR 28 29 29 TYR TYR A . n A 1 29 VAL 29 30 30 VAL VAL A . n A 1 30 TYR 30 31 31 TYR TYR A . n A 1 31 LEU 31 32 32 LEU LEU A . n A 1 32 SER 32 33 33 SER SER A . n A 1 33 MET 33 34 34 MET MET A . n A 1 34 ALA 34 35 35 ALA ALA A . n A 1 35 TYR 35 36 36 TYR TYR A . n A 1 36 TYR 36 37 37 TYR TYR A . n A 1 37 PHE 37 38 38 PHE PHE A . n A 1 38 GLU 38 39 39 GLU GLU A . n A 1 39 ARG 39 40 40 ARG ARG A . n A 1 40 ASP 40 41 41 ASP ASP A . n A 1 41 ASP 41 42 42 ASP ASP A . n A 1 42 VAL 42 43 43 VAL VAL A . n A 1 43 ALA 43 44 44 ALA ALA A . n A 1 44 LEU 44 45 45 LEU LEU A . n A 1 45 PRO 45 46 46 PRO PRO A . n A 1 46 GLY 46 47 47 GLY GLY A . n A 1 47 PHE 47 48 48 PHE PHE A . n A 1 48 ALA 48 49 49 ALA ALA A . n A 1 49 LYS 49 50 50 LYS LYS A . n A 1 50 PHE 50 51 51 PHE PHE A . n A 1 51 PHE 51 52 52 PHE PHE A . n A 1 52 LYS 52 53 53 LYS LYS A . n A 1 53 GLU 53 54 54 GLU GLU A . n A 1 54 SER 54 55 55 SER SER A . n A 1 55 SER 55 56 56 SER SER A . n A 1 56 ASP 56 58 58 ASP ASP A . n A 1 57 GLU 57 59 59 GLU GLU A . n A 1 58 GLU 58 60 60 GLU GLU A . n A 1 59 ARG 59 61 61 ARG ARG A . n A 1 60 GLU 60 62 62 GLU GLU A . n A 1 61 HIS 61 63 63 HIS HIS A . n A 1 62 ALA 62 64 64 ALA ALA A . n A 1 63 GLN 63 65 65 GLN GLN A . n A 1 64 THR 64 66 66 THR THR A . n A 1 65 PHE 65 67 67 PHE PHE A . n A 1 66 MET 66 68 68 MET MET A . n A 1 67 LYS 67 69 69 LYS LYS A . n A 1 68 TYR 68 70 70 TYR TYR A . n A 1 69 GLN 69 71 71 GLN GLN A . n A 1 70 ASN 70 72 72 ASN ASN A . n A 1 71 LYS 71 73 73 LYS LYS A . n A 1 72 ARG 72 74 74 ARG ARG A . n A 1 73 GLY 73 75 75 GLY GLY A . n A 1 74 GLY 74 76 76 GLY GLY A . n A 1 75 ARG 75 77 77 ARG ARG A . n A 1 76 ILE 76 78 78 ILE ILE A . n A 1 77 VAL 77 79 79 VAL VAL A . n A 1 78 LEU 78 80 80 LEU LEU A . n A 1 79 GLN 79 81 81 GLN GLN A . n A 1 80 GLN 80 82 82 GLN GLN A . n A 1 81 ILE 81 83 83 ILE ILE A . n A 1 82 ALA 82 84 84 ALA ALA A . n A 1 83 ALA 83 85 85 ALA ALA A . n A 1 84 PRO 84 86 86 PRO PRO A . n A 1 85 SER 85 87 87 SER SER A . n A 1 86 MET 86 88 88 MET MET A . n A 1 87 GLN 87 89 89 GLN GLN A . n A 1 88 GLU 88 90 90 GLU GLU A . n A 1 89 TRP 89 91 91 TRP TRP A . n A 1 90 GLY 90 92 92 GLY GLY A . n A 1 91 THR 91 93 93 THR THR A . n A 1 92 GLY 92 94 94 GLY GLY A . n A 1 93 LEU 93 95 95 LEU LEU A . n A 1 94 GLU 94 96 96 GLU GLU A . n A 1 95 ALA 95 97 97 ALA ALA A . n A 1 96 LEU 96 98 98 LEU LEU A . n A 1 97 GLN 97 99 99 GLN GLN A . n A 1 98 ALA 98 101 101 ALA ALA A . n A 1 99 ALA 99 102 102 ALA ALA A . n A 1 100 LEU 100 103 103 LEU LEU A . n A 1 101 ASP 101 104 104 ASP ASP A . n A 1 102 LEU 102 105 105 LEU LEU A . n A 1 103 GLU 103 106 106 GLU GLU A . n A 1 104 LYS 104 107 107 LYS LYS A . n A 1 105 GLN 105 108 108 GLN GLN A . n A 1 106 VAL 106 109 109 VAL VAL A . n A 1 107 ASN 107 110 110 ASN ASN A . n A 1 108 GLN 108 111 111 GLN GLN A . n A 1 109 SER 109 112 112 SER SER A . n A 1 110 LEU 110 113 113 LEU LEU A . n A 1 111 LEU 111 114 114 LEU LEU A . n A 1 112 GLU 112 115 115 GLU GLU A . n A 1 113 LEU 113 116 116 LEU LEU A . n A 1 114 HIS 114 117 117 HIS HIS A . n A 1 115 SER 115 118 118 SER SER A . n A 1 116 THR 116 119 119 THR THR A . n A 1 117 ALA 117 120 120 ALA ALA A . n A 1 118 SER 118 121 121 SER SER A . n A 1 119 GLY 119 122 122 GLY GLY A . n A 1 120 ASN 120 123 123 ASN ASN A . n A 1 121 ASN 121 124 124 ASN ASN A . n A 1 122 ASP 122 125 125 ASP ASP A . n A 1 123 PRO 123 126 126 PRO PRO A . n A 1 124 HIS 124 127 127 HIS HIS A . n A 1 125 LEU 125 128 128 LEU LEU A . n A 1 126 THR 126 129 129 THR THR A . n A 1 127 LYS 127 130 130 LYS LYS A . n A 1 128 LEU 128 131 131 LEU LEU A . n A 1 129 LEU 129 132 132 LEU LEU A . n A 1 130 GLU 130 133 133 GLU GLU A . n A 1 131 ASP 131 134 134 ASP ASP A . n A 1 132 GLU 132 135 135 GLU GLU A . n A 1 133 TYR 133 136 136 TYR TYR A . n A 1 134 LEU 134 137 137 LEU LEU A . n A 1 135 GLU 135 138 138 GLU GLU A . n A 1 136 GLU 136 139 139 GLU GLU A . n A 1 137 GLN 137 140 140 GLN GLN A . n A 1 138 VAL 138 141 141 VAL VAL A . n A 1 139 ASP 139 142 142 ASP ASP A . n A 1 140 SER 140 143 143 SER SER A . n A 1 141 ILE 141 144 144 ILE ILE A . n A 1 142 LYS 142 145 145 LYS LYS A . n A 1 143 LYS 143 146 146 LYS LYS A . n A 1 144 ILE 144 147 147 ILE ILE A . n A 1 145 GLY 145 148 148 GLY GLY A . n A 1 146 ASP 146 149 149 ASP ASP A . n A 1 147 MET 147 150 150 MET MET A . n A 1 148 ILE 148 151 151 ILE ILE A . n A 1 149 THR 149 152 152 THR THR A . n A 1 150 LYS 150 153 153 LYS LYS A . n A 1 151 LEU 151 154 154 LEU LEU A . n A 1 152 LYS 152 155 155 LYS LYS A . n A 1 153 ARG 153 156 156 ARG ARG A . n A 1 154 ALA 154 157 157 ALA ALA A . n A 1 155 GLY 155 158 158 GLY GLY A . n A 1 156 PRO 156 159 159 PRO PRO A . n A 1 157 HIS 157 160 160 HIS HIS A . n A 1 158 HIS 158 161 161 HIS HIS A . n A 1 159 GLY 159 162 162 GLY GLY A . n A 1 160 LEU 160 163 163 LEU LEU A . n A 1 161 GLY 161 164 164 GLY GLY A . n A 1 162 GLU 162 165 165 GLU GLU A . n A 1 163 TYR 163 166 166 TYR TYR A . n A 1 164 MET 164 167 167 MET MET A . n A 1 165 PHE 165 168 168 PHE PHE A . n A 1 166 ASP 166 169 169 ASP ASP A . n A 1 167 LYS 167 170 170 LYS LYS A . n A 1 168 GLU 168 171 171 GLU GLU A . n A 1 169 LEU 169 172 172 LEU LEU A . n A 1 170 ASN 170 173 173 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 201 1 FE FE A . C 3 NI 1 202 1 NI NI A . D 3 NI 1 203 2 NI NI A . E 3 NI 1 204 3 NI NI A . F 4 HOH 1 301 47 HOH HOH A . F 4 HOH 2 302 11 HOH HOH A . F 4 HOH 3 303 15 HOH HOH A . F 4 HOH 4 304 18 HOH HOH A . F 4 HOH 5 305 17 HOH HOH A . F 4 HOH 6 306 23 HOH HOH A . F 4 HOH 7 307 29 HOH HOH A . F 4 HOH 8 308 52 HOH HOH A . F 4 HOH 9 309 12 HOH HOH A . F 4 HOH 10 310 54 HOH HOH A . F 4 HOH 11 311 44 HOH HOH A . F 4 HOH 12 312 2 HOH HOH A . F 4 HOH 13 313 16 HOH HOH A . F 4 HOH 14 314 1 HOH HOH A . F 4 HOH 15 315 48 HOH HOH A . F 4 HOH 16 316 9 HOH HOH A . F 4 HOH 17 317 13 HOH HOH A . F 4 HOH 18 318 19 HOH HOH A . F 4 HOH 19 319 22 HOH HOH A . F 4 HOH 20 320 21 HOH HOH A . F 4 HOH 21 321 7 HOH HOH A . F 4 HOH 22 322 53 HOH HOH A . F 4 HOH 23 323 24 HOH HOH A . F 4 HOH 24 324 31 HOH HOH A . F 4 HOH 25 325 3 HOH HOH A . F 4 HOH 26 326 27 HOH HOH A . F 4 HOH 27 327 6 HOH HOH A . F 4 HOH 28 328 43 HOH HOH A . F 4 HOH 29 329 10 HOH HOH A . F 4 HOH 30 330 20 HOH HOH A . F 4 HOH 31 331 42 HOH HOH A . F 4 HOH 32 332 40 HOH HOH A . F 4 HOH 33 333 28 HOH HOH A . F 4 HOH 34 334 8 HOH HOH A . F 4 HOH 35 335 14 HOH HOH A . F 4 HOH 36 336 46 HOH HOH A . F 4 HOH 37 337 26 HOH HOH A . F 4 HOH 38 338 33 HOH HOH A . F 4 HOH 39 339 37 HOH HOH A . F 4 HOH 40 340 39 HOH HOH A . F 4 HOH 41 341 5 HOH HOH A . F 4 HOH 42 342 49 HOH HOH A . F 4 HOH 43 343 36 HOH HOH A . F 4 HOH 44 344 50 HOH HOH A . F 4 HOH 45 345 25 HOH HOH A . F 4 HOH 46 346 41 HOH HOH A . F 4 HOH 47 347 51 HOH HOH A . F 4 HOH 48 348 45 HOH HOH A . F 4 HOH 49 349 57 HOH HOH A . F 4 HOH 50 350 58 HOH HOH A . F 4 HOH 51 351 34 HOH HOH A . F 4 HOH 52 352 35 HOH HOH A . F 4 HOH 53 353 56 HOH HOH A . F 4 HOH 54 354 38 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 105490 ? 1 MORE -1197 ? 1 'SSA (A^2)' 130730 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 118.5330000000 0.0000000000 -1.0000000000 0.0000000000 118.5330000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_654 -x+1,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 118.5330000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -118.5330000000 4 'crystal symmetry operation' 4_564 x,-y+1,-z-1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 118.5330000000 0.0000000000 0.0000000000 -1.0000000000 -118.5330000000 5 'crystal symmetry operation' 5_654 z+1,x,y-1 0.0000000000 0.0000000000 1.0000000000 118.5330000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -118.5330000000 6 'crystal symmetry operation' 6_665 z+1,-x+1,-y 0.0000000000 0.0000000000 1.0000000000 118.5330000000 -1.0000000000 0.0000000000 0.0000000000 118.5330000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_564 -z,-x+1,y-1 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 118.5330000000 0.0000000000 1.0000000000 0.0000000000 -118.5330000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_564 y,z+1,x-1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 118.5330000000 1.0000000000 0.0000000000 0.0000000000 -118.5330000000 10 'crystal symmetry operation' 10_665 -y+1,z+1,-x 0.0000000000 -1.0000000000 0.0000000000 118.5330000000 0.0000000000 0.0000000000 1.0000000000 118.5330000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_654 -y+1,-z,x-1 0.0000000000 -1.0000000000 0.0000000000 118.5330000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -118.5330000000 13 'crystal symmetry operation' 13_554 y,x,-z-1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -118.5330000000 14 'crystal symmetry operation' 14_664 -y+1,-x+1,-z-1 0.0000000000 -1.0000000000 0.0000000000 118.5330000000 -1.0000000000 0.0000000000 0.0000000000 118.5330000000 0.0000000000 0.0000000000 -1.0000000000 -118.5330000000 15 'crystal symmetry operation' 15_565 y,-x+1,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 118.5330000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_655 -y+1,x,z 0.0000000000 -1.0000000000 0.0000000000 118.5330000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_565 x,z+1,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 118.5330000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_664 -x+1,z+1,y-1 -1.0000000000 0.0000000000 0.0000000000 118.5330000000 0.0000000000 0.0000000000 1.0000000000 118.5330000000 0.0000000000 1.0000000000 0.0000000000 -118.5330000000 19 'crystal symmetry operation' 19_655 -x+1,-z,-y -1.0000000000 0.0000000000 0.0000000000 118.5330000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_554 x,-z,y-1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -118.5330000000 21 'crystal symmetry operation' 21_655 z+1,y,-x 0.0000000000 0.0000000000 1.0000000000 118.5330000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_664 z+1,-y+1,x-1 0.0000000000 0.0000000000 1.0000000000 118.5330000000 0.0000000000 -1.0000000000 0.0000000000 118.5330000000 1.0000000000 0.0000000000 0.0000000000 -118.5330000000 23 'crystal symmetry operation' 23_554 -z,y,x-1 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -118.5330000000 24 'crystal symmetry operation' 24_565 -z,-y+1,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 118.5330000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 347 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 23 ? A GLU 24 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 OE1 ? A GLU 58 ? A GLU 60 ? 1_555 77.0 ? 2 OE1 ? A GLU 23 ? A GLU 24 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 OE2 ? A GLU 58 ? A GLU 60 ? 1_555 107.8 ? 3 OE1 ? A GLU 58 ? A GLU 60 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 OE2 ? A GLU 58 ? A GLU 60 ? 1_555 58.9 ? 4 OE2 ? A GLU 136 ? A GLU 139 ? 1_555 NI ? D NI . ? A NI 203 ? 1_555 OG B A SER 140 ? A SER 143 ? 1_555 65.4 ? 5 NE2 ? A HIS 157 ? A HIS 160 ? 1_555 NI ? E NI . ? A NI 204 ? 4_565 O ? A HIS 158 ? A HIS 161 ? 1_555 64.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-29 2 'Structure model' 1 1 2020-03-04 3 'Structure model' 1 2 2020-03-18 4 'Structure model' 1 3 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' pdbx_struct_conn_angle 9 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation.year' 6 3 'Structure model' '_citation_author.identifier_ORCID' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6KH5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 43 ? ? -120.65 -60.05 2 1 TYR A 136 ? ? -126.39 -56.27 3 1 HIS A 161 ? ? -25.26 64.92 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 NI NI NI N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 31730069 1 'National Natural Science Foundation of China (NSFC)' China 31671805 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NI _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NI _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 'NICKEL (II) ION' NI 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6A4U _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? #