data_6KQV # _entry.id 6KQV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6KQV pdb_00006kqv 10.2210/pdb6kqv/pdb WWPDB D_1300013485 ? ? BMRB 36283 ? 10.13018/BMR36283 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-08-19 2 'Structure model' 1 1 2020-12-23 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 16 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6KQV _pdbx_database_status.recvd_initial_deposition_date 2019-08-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution Structure of the UbL Domain of USP19' _pdbx_database_related.db_id 36283 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xue, W.' 1 ? 'Hu, H.Y.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.J. _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 1470-8728 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 477 _citation.language ? _citation.page_first 4295 _citation.page_last 4312 _citation.title ;Domain interactions reveal auto-inhibition of the deubiquitinating enzyme USP19 and its activation by HSP90 in the modulation of huntingtin aggregation. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BCJ20200536 _citation.pdbx_database_id_PubMed 33094816 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xue, W.' 1 ? primary 'Zhang, S.X.' 2 ? primary 'He, W.T.' 3 ? primary 'Hong, J.Y.' 4 ? primary 'Jiang, L.L.' 5 ? primary 'Hu, H.Y.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ubiquitin carboxyl-terminal hydrolase 19' _entity.formula_weight 9994.459 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.19.12 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Deubiquitinating enzyme 19,Ubiquitin thioesterase 19,Ubiquitin-specific-processing protease 19,Zinc finger MYND domain-containing protein 9 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KQKVLPVFYFAREPHSKPIKFLVSVSKENSTASEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLL CFELLSSE ; _entity_poly.pdbx_seq_one_letter_code_can ;KQKVLPVFYFAREPHSKPIKFLVSVSKENSTASEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLL CFELLSSE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLN n 1 3 LYS n 1 4 VAL n 1 5 LEU n 1 6 PRO n 1 7 VAL n 1 8 PHE n 1 9 TYR n 1 10 PHE n 1 11 ALA n 1 12 ARG n 1 13 GLU n 1 14 PRO n 1 15 HIS n 1 16 SER n 1 17 LYS n 1 18 PRO n 1 19 ILE n 1 20 LYS n 1 21 PHE n 1 22 LEU n 1 23 VAL n 1 24 SER n 1 25 VAL n 1 26 SER n 1 27 LYS n 1 28 GLU n 1 29 ASN n 1 30 SER n 1 31 THR n 1 32 ALA n 1 33 SER n 1 34 GLU n 1 35 VAL n 1 36 LEU n 1 37 ASP n 1 38 SER n 1 39 LEU n 1 40 SER n 1 41 GLN n 1 42 SER n 1 43 VAL n 1 44 HIS n 1 45 VAL n 1 46 LYS n 1 47 PRO n 1 48 GLU n 1 49 ASN n 1 50 LEU n 1 51 ARG n 1 52 LEU n 1 53 ALA n 1 54 GLU n 1 55 VAL n 1 56 ILE n 1 57 LYS n 1 58 ASN n 1 59 ARG n 1 60 PHE n 1 61 HIS n 1 62 ARG n 1 63 VAL n 1 64 PHE n 1 65 LEU n 1 66 PRO n 1 67 SER n 1 68 HIS n 1 69 SER n 1 70 LEU n 1 71 ASP n 1 72 THR n 1 73 VAL n 1 74 SER n 1 75 PRO n 1 76 SER n 1 77 ASP n 1 78 THR n 1 79 LEU n 1 80 LEU n 1 81 CYS n 1 82 PHE n 1 83 GLU n 1 84 LEU n 1 85 LEU n 1 86 SER n 1 87 SER n 1 88 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 88 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'USP19, KIAA0891, ZMYND9' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 679 679 LYS LYS A . n A 1 2 GLN 2 680 680 GLN GLN A . n A 1 3 LYS 3 681 681 LYS LYS A . n A 1 4 VAL 4 682 682 VAL VAL A . n A 1 5 LEU 5 683 683 LEU LEU A . n A 1 6 PRO 6 684 684 PRO PRO A . n A 1 7 VAL 7 685 685 VAL VAL A . n A 1 8 PHE 8 686 686 PHE PHE A . n A 1 9 TYR 9 687 687 TYR TYR A . n A 1 10 PHE 10 688 688 PHE PHE A . n A 1 11 ALA 11 689 689 ALA ALA A . n A 1 12 ARG 12 690 690 ARG ARG A . n A 1 13 GLU 13 691 691 GLU GLU A . n A 1 14 PRO 14 692 692 PRO PRO A . n A 1 15 HIS 15 693 693 HIS HIS A . n A 1 16 SER 16 694 694 SER SER A . n A 1 17 LYS 17 695 695 LYS LYS A . n A 1 18 PRO 18 696 696 PRO PRO A . n A 1 19 ILE 19 697 697 ILE ILE A . n A 1 20 LYS 20 698 698 LYS LYS A . n A 1 21 PHE 21 699 699 PHE PHE A . n A 1 22 LEU 22 700 700 LEU LEU A . n A 1 23 VAL 23 701 701 VAL VAL A . n A 1 24 SER 24 702 702 SER SER A . n A 1 25 VAL 25 703 703 VAL VAL A . n A 1 26 SER 26 704 704 SER SER A . n A 1 27 LYS 27 705 705 LYS LYS A . n A 1 28 GLU 28 706 706 GLU GLU A . n A 1 29 ASN 29 707 707 ASN ASN A . n A 1 30 SER 30 708 708 SER SER A . n A 1 31 THR 31 709 709 THR THR A . n A 1 32 ALA 32 710 710 ALA ALA A . n A 1 33 SER 33 711 711 SER SER A . n A 1 34 GLU 34 712 712 GLU GLU A . n A 1 35 VAL 35 713 713 VAL VAL A . n A 1 36 LEU 36 714 714 LEU LEU A . n A 1 37 ASP 37 715 715 ASP ASP A . n A 1 38 SER 38 716 716 SER SER A . n A 1 39 LEU 39 717 717 LEU LEU A . n A 1 40 SER 40 718 718 SER SER A . n A 1 41 GLN 41 719 719 GLN GLN A . n A 1 42 SER 42 720 720 SER SER A . n A 1 43 VAL 43 721 721 VAL VAL A . n A 1 44 HIS 44 722 722 HIS HIS A . n A 1 45 VAL 45 723 723 VAL VAL A . n A 1 46 LYS 46 724 724 LYS LYS A . n A 1 47 PRO 47 725 725 PRO PRO A . n A 1 48 GLU 48 726 726 GLU GLU A . n A 1 49 ASN 49 727 727 ASN ASN A . n A 1 50 LEU 50 728 728 LEU LEU A . n A 1 51 ARG 51 729 729 ARG ARG A . n A 1 52 LEU 52 730 730 LEU LEU A . n A 1 53 ALA 53 731 731 ALA ALA A . n A 1 54 GLU 54 732 732 GLU GLU A . n A 1 55 VAL 55 733 733 VAL VAL A . n A 1 56 ILE 56 734 734 ILE ILE A . n A 1 57 LYS 57 735 735 LYS LYS A . n A 1 58 ASN 58 736 736 ASN ASN A . n A 1 59 ARG 59 737 737 ARG ARG A . n A 1 60 PHE 60 738 738 PHE PHE A . n A 1 61 HIS 61 739 739 HIS HIS A . n A 1 62 ARG 62 740 740 ARG ARG A . n A 1 63 VAL 63 741 741 VAL VAL A . n A 1 64 PHE 64 742 742 PHE PHE A . n A 1 65 LEU 65 743 743 LEU LEU A . n A 1 66 PRO 66 744 744 PRO PRO A . n A 1 67 SER 67 745 745 SER SER A . n A 1 68 HIS 68 746 746 HIS HIS A . n A 1 69 SER 69 747 747 SER SER A . n A 1 70 LEU 70 748 748 LEU LEU A . n A 1 71 ASP 71 749 749 ASP ASP A . n A 1 72 THR 72 750 750 THR THR A . n A 1 73 VAL 73 751 751 VAL VAL A . n A 1 74 SER 74 752 752 SER SER A . n A 1 75 PRO 75 753 753 PRO PRO A . n A 1 76 SER 76 754 754 SER SER A . n A 1 77 ASP 77 755 755 ASP ASP A . n A 1 78 THR 78 756 756 THR THR A . n A 1 79 LEU 79 757 757 LEU LEU A . n A 1 80 LEU 80 758 758 LEU LEU A . n A 1 81 CYS 81 759 759 CYS CYS A . n A 1 82 PHE 82 760 760 PHE PHE A . n A 1 83 GLU 83 761 761 GLU GLU A . n A 1 84 LEU 84 762 762 LEU LEU A . n A 1 85 LEU 85 763 763 LEU LEU A . n A 1 86 SER 86 764 764 SER SER A . n A 1 87 SER 87 765 765 SER SER A . n A 1 88 GLU 88 766 766 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6KQV _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6KQV _struct.title 'Solution Structure of the UbL Domain of USP19' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6KQV _struct_keywords.text 'UbL domain, Autoinhibitory Regulation, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBP19_HUMAN _struct_ref.pdbx_db_accession O94966 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KQKVLPVFYFAREPHSKPIKFLVSVSKENSTASEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLL CFELLSSE ; _struct_ref.pdbx_align_begin 679 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6KQV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O94966 _struct_ref_seq.db_align_beg 679 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 766 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 679 _struct_ref_seq.pdbx_auth_seq_align_end 766 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details SEC # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 32 ? VAL A 43 ? ALA A 710 VAL A 721 1 ? 12 HELX_P HELX_P2 AA2 LYS A 46 ? LEU A 50 ? LYS A 724 LEU A 728 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 4 ? TYR A 9 ? VAL A 682 TYR A 687 AA1 2 ILE A 19 ? SER A 24 ? ILE A 697 SER A 702 AA2 1 ALA A 53 ? GLU A 54 ? ALA A 731 GLU A 732 AA2 2 LEU A 79 ? LEU A 80 ? LEU A 757 LEU A 758 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 7 ? N VAL A 685 O PHE A 21 ? O PHE A 699 AA2 1 2 N GLU A 54 ? N GLU A 732 O LEU A 79 ? O LEU A 757 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB3 A SER 704 ? ? HB2 A ASP 749 ? ? 1.21 2 1 HH A TYR 687 ? ? HB2 A PHE 699 ? ? 1.35 3 1 O A LEU 730 ? ? HA A LEU 758 ? ? 1.60 4 2 HB3 A LEU 730 ? ? H A CYS 759 ? ? 1.25 5 2 HA A ASN 727 ? ? HB3 A LEU 762 ? ? 1.31 6 2 HG2 A ARG 690 ? ? HA A LEU 763 ? ? 1.34 7 3 HB2 A SER 704 ? ? HB3 A ASP 749 ? ? 1.32 8 3 HZ3 A LYS 681 ? ? OD2 A ASP 755 ? ? 1.57 9 4 HD2 A PHE 688 ? ? HB3 A PRO 696 ? ? 1.14 10 5 HA A ALA 689 ? ? HD22 A LEU 762 ? ? 1.16 11 5 HE2 A LYS 695 ? ? HD11 A ILE 697 ? ? 1.24 12 5 HB1 A ALA 710 ? ? HA A SER 745 ? ? 1.30 13 5 HE1 A TYR 687 ? ? H A PHE 699 ? ? 1.35 14 5 HZ3 A LYS 735 ? ? OD2 A ASP 755 ? ? 1.54 15 6 HH22 A ARG 690 ? ? HG23 A VAL 723 ? ? 1.21 16 6 HB2 A SER 704 ? ? HB2 A ASP 749 ? ? 1.33 17 6 HB3 A ARG 740 ? ? H A VAL 741 ? ? 1.33 18 6 HE2 A PHE 760 ? ? HD22 A LEU 762 ? ? 1.34 19 6 O A LEU 730 ? ? HA A LEU 758 ? ? 1.59 20 7 HD1 A HIS 746 ? ? HB2 A LEU 748 ? ? 1.24 21 7 HB3 A SER 704 ? ? HB2 A ASP 749 ? ? 1.34 22 7 O A GLU 732 ? ? HA A THR 756 ? ? 1.52 23 7 O A LEU 730 ? ? HA A LEU 758 ? ? 1.60 24 8 HE3 A LYS 679 ? ? HA A VAL 703 ? ? 1.23 25 8 HB2 A PHE 688 ? ? HB3 A GLU 761 ? ? 1.25 26 8 HB A VAL 733 ? ? HG3 A ARG 737 ? ? 1.26 27 8 HD22 A LEU 717 ? ? HD23 A LEU 758 ? ? 1.31 28 8 HB2 A SER 704 ? ? HB2 A ASP 749 ? ? 1.33 29 9 HG21 A VAL 721 ? ? HZ A PHE 760 ? ? 1.16 30 9 HG2 A LYS 681 ? ? HG A SER 704 ? ? 1.18 31 9 HB3 A LYS 705 ? ? HA A ALA 710 ? ? 1.19 32 9 HB3 A SER 704 ? ? HB2 A ASP 749 ? ? 1.34 33 9 HB1 A ALA 710 ? ? HA A SER 745 ? ? 1.34 34 9 HZ3 A LYS 681 ? ? OD2 A ASP 755 ? ? 1.56 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 3 CE1 A TYR 687 ? ? CZ A TYR 687 ? ? 1.277 1.381 -0.104 0.013 N 2 3 CZ A TYR 687 ? ? CE2 A TYR 687 ? ? 1.483 1.381 0.102 0.013 N 3 4 CE1 A TYR 687 ? ? CZ A TYR 687 ? ? 1.281 1.381 -0.100 0.013 N 4 4 CZ A TYR 687 ? ? CE2 A TYR 687 ? ? 1.469 1.381 0.088 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 692 ? ? -40.23 3.06 2 1 HIS A 693 ? ? 76.49 52.97 3 1 GLU A 706 ? ? -68.94 -177.69 4 1 ASN A 707 ? ? -60.22 1.51 5 1 SER A 708 ? ? -109.43 -63.96 6 1 LYS A 735 ? ? 156.86 -154.81 7 1 HIS A 739 ? ? 65.26 179.58 8 1 ARG A 740 ? ? 155.92 -162.46 9 1 SER A 745 ? ? -37.91 107.23 10 1 LEU A 748 ? ? -69.57 12.78 11 1 ASP A 749 ? ? -76.79 25.60 12 1 THR A 756 ? ? -30.70 115.18 13 2 PRO A 692 ? ? -42.80 4.53 14 2 HIS A 693 ? ? 77.07 51.20 15 2 ASN A 707 ? ? -63.89 4.90 16 2 SER A 708 ? ? -90.59 -61.42 17 2 LYS A 735 ? ? 156.62 -152.75 18 2 ARG A 737 ? ? -64.19 -75.10 19 2 PHE A 738 ? ? 61.34 82.69 20 2 ARG A 740 ? ? -142.26 -11.50 21 2 SER A 745 ? ? -39.07 123.23 22 2 LEU A 748 ? ? -68.05 13.41 23 2 THR A 756 ? ? -27.67 123.70 24 3 PRO A 692 ? ? -42.05 4.10 25 3 HIS A 693 ? ? 77.87 52.48 26 3 ASN A 707 ? ? -62.34 2.61 27 3 SER A 708 ? ? -90.05 -63.09 28 3 ILE A 734 ? ? -107.54 -149.83 29 3 LYS A 735 ? ? 11.21 -145.14 30 3 ARG A 740 ? ? -147.04 -6.25 31 3 SER A 745 ? ? -38.12 124.23 32 3 THR A 756 ? ? -27.78 128.41 33 4 PRO A 692 ? ? -41.15 4.31 34 4 HIS A 693 ? ? 78.36 52.97 35 4 GLU A 706 ? ? -66.76 -175.22 36 4 ASN A 707 ? ? -56.51 1.76 37 4 LYS A 735 ? ? 161.92 -151.12 38 4 SER A 745 ? ? -37.68 122.03 39 4 ASP A 749 ? ? -75.35 30.56 40 4 SER A 752 ? ? -12.49 -52.05 41 4 PRO A 753 ? ? -47.67 -9.25 42 4 ASP A 755 ? ? -19.41 108.15 43 5 PRO A 692 ? ? -40.10 6.84 44 5 HIS A 693 ? ? 79.56 47.93 45 5 ASN A 707 ? ? -63.97 4.23 46 5 SER A 708 ? ? -105.70 -61.32 47 5 LYS A 735 ? ? 159.54 -151.99 48 5 PHE A 738 ? ? 67.72 90.60 49 5 HIS A 739 ? ? 71.35 178.66 50 5 ARG A 740 ? ? 151.05 -162.30 51 5 PRO A 744 ? ? -48.83 168.80 52 5 SER A 745 ? ? -36.37 106.15 53 5 SER A 747 ? ? -57.52 -3.91 54 5 LEU A 748 ? ? -68.11 13.15 55 5 ASP A 749 ? ? -74.20 27.04 56 5 THR A 756 ? ? -33.15 109.00 57 5 SER A 764 ? ? -13.55 108.61 58 6 PRO A 692 ? ? -39.82 3.73 59 6 HIS A 693 ? ? 76.33 52.45 60 6 LYS A 705 ? ? -63.19 93.09 61 6 GLU A 706 ? ? -61.38 -180.00 62 6 ASN A 707 ? ? -60.04 3.81 63 6 LEU A 730 ? ? -160.35 108.02 64 6 ILE A 734 ? ? -101.30 -151.37 65 6 LYS A 735 ? ? 13.08 -143.73 66 6 HIS A 739 ? ? 59.41 -165.93 67 6 ARG A 740 ? ? 162.49 -155.48 68 6 PRO A 744 ? ? -49.05 169.31 69 6 SER A 745 ? ? -37.85 115.52 70 6 SER A 747 ? ? -56.98 0.74 71 6 LEU A 748 ? ? -67.18 12.62 72 6 ASP A 755 ? ? -57.38 174.56 73 6 THR A 756 ? ? -29.32 109.59 74 7 PRO A 692 ? ? -41.77 4.01 75 7 HIS A 693 ? ? 77.47 51.78 76 7 GLU A 706 ? ? -155.50 75.90 77 7 SER A 708 ? ? -135.24 -57.40 78 7 ILE A 734 ? ? -101.01 -153.49 79 7 LYS A 735 ? ? 9.65 -142.94 80 7 PHE A 738 ? ? 61.72 76.99 81 7 ARG A 740 ? ? -141.25 -8.58 82 7 SER A 745 ? ? -38.29 104.45 83 7 LEU A 748 ? ? -69.49 16.06 84 7 ASP A 755 ? ? -68.62 -176.47 85 7 THR A 756 ? ? -25.79 129.49 86 8 LYS A 681 ? ? -16.96 153.41 87 8 PRO A 692 ? ? -39.58 8.67 88 8 HIS A 693 ? ? 79.36 52.49 89 8 GLU A 706 ? ? -55.39 177.83 90 8 ASN A 707 ? ? -61.73 1.99 91 8 SER A 708 ? ? -109.15 -61.34 92 8 LYS A 735 ? ? 161.45 -153.24 93 8 HIS A 739 ? ? 66.55 167.29 94 8 ARG A 740 ? ? 168.59 -173.25 95 8 PRO A 744 ? ? -48.83 166.84 96 8 SER A 745 ? ? -37.17 107.31 97 8 LEU A 748 ? ? -68.13 9.95 98 8 VAL A 751 ? ? -65.11 96.58 99 8 SER A 752 ? ? -155.67 66.39 100 8 THR A 756 ? ? -178.74 105.35 101 9 ARG A 690 ? ? -100.08 78.56 102 9 PRO A 692 ? ? -42.35 5.70 103 9 HIS A 693 ? ? 77.94 52.78 104 9 ASN A 707 ? ? -65.33 3.56 105 9 SER A 708 ? ? -98.67 -61.08 106 9 LEU A 730 ? ? -161.06 109.33 107 9 ILE A 734 ? ? -105.82 -145.26 108 9 LYS A 735 ? ? 14.70 -140.66 109 9 HIS A 739 ? ? 62.33 164.24 110 9 ARG A 740 ? ? 161.47 -167.52 111 9 SER A 745 ? ? -39.75 105.23 112 9 SER A 747 ? ? -58.41 -1.47 113 9 LEU A 748 ? ? -67.34 11.32 114 10 PRO A 692 ? ? -39.67 5.15 115 10 HIS A 693 ? ? 78.10 52.84 116 10 ASN A 707 ? ? -60.22 2.76 117 10 SER A 708 ? ? -102.64 -62.69 118 10 ILE A 734 ? ? -105.70 -148.71 119 10 LYS A 735 ? ? 10.54 -145.30 120 10 PHE A 738 ? ? 64.90 85.88 121 10 HIS A 739 ? ? 48.60 -159.26 122 10 ARG A 740 ? ? 103.91 145.26 123 10 PRO A 744 ? ? -49.98 168.93 124 10 SER A 745 ? ? -39.92 121.15 125 10 LEU A 748 ? ? -69.72 10.41 126 10 ASP A 749 ? ? -78.32 22.41 127 10 THR A 756 ? ? -30.84 115.70 128 10 SER A 764 ? ? -179.00 128.06 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 7 _pdbx_validate_peptide_omega.auth_comp_id_1 GLU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 706 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASN _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 707 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 130.59 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 5 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 687 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.111 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 6KQV _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6KQV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;1 mM [U-99% 13C; U-99% 15N] UbL(679-766), 10 mM sodium acetate, 50 mM sodium chloride, 0.05 mM sodium azide, 1 mM DTT, 90 % v/v H2O, 10 % v/v [U-99% 2H] D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N_13C_sample solution ? 2 ;1 mM [U-99% 15N] UbL(679-766), 10 mM sodium acetate, 50 mM sodium chloride, 0.05 mM sodium azide, 1 mM DTT, 90 % v/v H2O, 10 % v/v [U-99% 2H] D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'UbL(679-766)' 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium acetate' 10 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 'sodium azide' 0.05 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' 1 H2O 90 ? '% v/v' 'natural abundance' 1 D2O 10 ? '% v/v' '[U-99% 2H]' 2 'UbL(679-766)' 1 ? mM '[U-99% 15N]' 2 'sodium acetate' 10 ? mM 'natural abundance' 2 'sodium chloride' 50 ? mM 'natural abundance' 2 'sodium azide' 0.05 ? mM 'natural abundance' 2 DTT 1 ? mM 'natural abundance' 2 H2O 90 ? '% v/v' 'natural abundance' 2 D2O 10 ? '% v/v' '[U-99% 2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.06 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '3D HNHA' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D H(CCO)NH' 1 isotropic 6 1 1 '3D HNCO' 1 isotropic 7 1 2 '3D 1H-15N NOESY' 1 isotropic 8 1 1 '3D 1H-13C NOESY' 2 isotropic # _pdbx_nmr_refine.entry_id 6KQV _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 HIS N N N N 127 HIS CA C N S 128 HIS C C N N 129 HIS O O N N 130 HIS CB C N N 131 HIS CG C Y N 132 HIS ND1 N Y N 133 HIS CD2 C Y N 134 HIS CE1 C Y N 135 HIS NE2 N Y N 136 HIS OXT O N N 137 HIS H H N N 138 HIS H2 H N N 139 HIS HA H N N 140 HIS HB2 H N N 141 HIS HB3 H N N 142 HIS HD1 H N N 143 HIS HD2 H N N 144 HIS HE1 H N N 145 HIS HE2 H N N 146 HIS HXT H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 PHE N N N N 217 PHE CA C N S 218 PHE C C N N 219 PHE O O N N 220 PHE CB C N N 221 PHE CG C Y N 222 PHE CD1 C Y N 223 PHE CD2 C Y N 224 PHE CE1 C Y N 225 PHE CE2 C Y N 226 PHE CZ C Y N 227 PHE OXT O N N 228 PHE H H N N 229 PHE H2 H N N 230 PHE HA H N N 231 PHE HB2 H N N 232 PHE HB3 H N N 233 PHE HD1 H N N 234 PHE HD2 H N N 235 PHE HE1 H N N 236 PHE HE2 H N N 237 PHE HZ H N N 238 PHE HXT H N N 239 PRO N N N N 240 PRO CA C N S 241 PRO C C N N 242 PRO O O N N 243 PRO CB C N N 244 PRO CG C N N 245 PRO CD C N N 246 PRO OXT O N N 247 PRO H H N N 248 PRO HA H N N 249 PRO HB2 H N N 250 PRO HB3 H N N 251 PRO HG2 H N N 252 PRO HG3 H N N 253 PRO HD2 H N N 254 PRO HD3 H N N 255 PRO HXT H N N 256 SER N N N N 257 SER CA C N S 258 SER C C N N 259 SER O O N N 260 SER CB C N N 261 SER OG O N N 262 SER OXT O N N 263 SER H H N N 264 SER H2 H N N 265 SER HA H N N 266 SER HB2 H N N 267 SER HB3 H N N 268 SER HG H N N 269 SER HXT H N N 270 THR N N N N 271 THR CA C N S 272 THR C C N N 273 THR O O N N 274 THR CB C N R 275 THR OG1 O N N 276 THR CG2 C N N 277 THR OXT O N N 278 THR H H N N 279 THR H2 H N N 280 THR HA H N N 281 THR HB H N N 282 THR HG1 H N N 283 THR HG21 H N N 284 THR HG22 H N N 285 THR HG23 H N N 286 THR HXT H N N 287 TYR N N N N 288 TYR CA C N S 289 TYR C C N N 290 TYR O O N N 291 TYR CB C N N 292 TYR CG C Y N 293 TYR CD1 C Y N 294 TYR CD2 C Y N 295 TYR CE1 C Y N 296 TYR CE2 C Y N 297 TYR CZ C Y N 298 TYR OH O N N 299 TYR OXT O N N 300 TYR H H N N 301 TYR H2 H N N 302 TYR HA H N N 303 TYR HB2 H N N 304 TYR HB3 H N N 305 TYR HD1 H N N 306 TYR HD2 H N N 307 TYR HE1 H N N 308 TYR HE2 H N N 309 TYR HH H N N 310 TYR HXT H N N 311 VAL N N N N 312 VAL CA C N S 313 VAL C C N N 314 VAL O O N N 315 VAL CB C N N 316 VAL CG1 C N N 317 VAL CG2 C N N 318 VAL OXT O N N 319 VAL H H N N 320 VAL H2 H N N 321 VAL HA H N N 322 VAL HB H N N 323 VAL HG11 H N N 324 VAL HG12 H N N 325 VAL HG13 H N N 326 VAL HG21 H N N 327 VAL HG22 H N N 328 VAL HG23 H N N 329 VAL HXT H N N 330 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 HIS N CA sing N N 120 HIS N H sing N N 121 HIS N H2 sing N N 122 HIS CA C sing N N 123 HIS CA CB sing N N 124 HIS CA HA sing N N 125 HIS C O doub N N 126 HIS C OXT sing N N 127 HIS CB CG sing N N 128 HIS CB HB2 sing N N 129 HIS CB HB3 sing N N 130 HIS CG ND1 sing Y N 131 HIS CG CD2 doub Y N 132 HIS ND1 CE1 doub Y N 133 HIS ND1 HD1 sing N N 134 HIS CD2 NE2 sing Y N 135 HIS CD2 HD2 sing N N 136 HIS CE1 NE2 sing Y N 137 HIS CE1 HE1 sing N N 138 HIS NE2 HE2 sing N N 139 HIS OXT HXT sing N N 140 ILE N CA sing N N 141 ILE N H sing N N 142 ILE N H2 sing N N 143 ILE CA C sing N N 144 ILE CA CB sing N N 145 ILE CA HA sing N N 146 ILE C O doub N N 147 ILE C OXT sing N N 148 ILE CB CG1 sing N N 149 ILE CB CG2 sing N N 150 ILE CB HB sing N N 151 ILE CG1 CD1 sing N N 152 ILE CG1 HG12 sing N N 153 ILE CG1 HG13 sing N N 154 ILE CG2 HG21 sing N N 155 ILE CG2 HG22 sing N N 156 ILE CG2 HG23 sing N N 157 ILE CD1 HD11 sing N N 158 ILE CD1 HD12 sing N N 159 ILE CD1 HD13 sing N N 160 ILE OXT HXT sing N N 161 LEU N CA sing N N 162 LEU N H sing N N 163 LEU N H2 sing N N 164 LEU CA C sing N N 165 LEU CA CB sing N N 166 LEU CA HA sing N N 167 LEU C O doub N N 168 LEU C OXT sing N N 169 LEU CB CG sing N N 170 LEU CB HB2 sing N N 171 LEU CB HB3 sing N N 172 LEU CG CD1 sing N N 173 LEU CG CD2 sing N N 174 LEU CG HG sing N N 175 LEU CD1 HD11 sing N N 176 LEU CD1 HD12 sing N N 177 LEU CD1 HD13 sing N N 178 LEU CD2 HD21 sing N N 179 LEU CD2 HD22 sing N N 180 LEU CD2 HD23 sing N N 181 LEU OXT HXT sing N N 182 LYS N CA sing N N 183 LYS N H sing N N 184 LYS N H2 sing N N 185 LYS CA C sing N N 186 LYS CA CB sing N N 187 LYS CA HA sing N N 188 LYS C O doub N N 189 LYS C OXT sing N N 190 LYS CB CG sing N N 191 LYS CB HB2 sing N N 192 LYS CB HB3 sing N N 193 LYS CG CD sing N N 194 LYS CG HG2 sing N N 195 LYS CG HG3 sing N N 196 LYS CD CE sing N N 197 LYS CD HD2 sing N N 198 LYS CD HD3 sing N N 199 LYS CE NZ sing N N 200 LYS CE HE2 sing N N 201 LYS CE HE3 sing N N 202 LYS NZ HZ1 sing N N 203 LYS NZ HZ2 sing N N 204 LYS NZ HZ3 sing N N 205 LYS OXT HXT sing N N 206 PHE N CA sing N N 207 PHE N H sing N N 208 PHE N H2 sing N N 209 PHE CA C sing N N 210 PHE CA CB sing N N 211 PHE CA HA sing N N 212 PHE C O doub N N 213 PHE C OXT sing N N 214 PHE CB CG sing N N 215 PHE CB HB2 sing N N 216 PHE CB HB3 sing N N 217 PHE CG CD1 doub Y N 218 PHE CG CD2 sing Y N 219 PHE CD1 CE1 sing Y N 220 PHE CD1 HD1 sing N N 221 PHE CD2 CE2 doub Y N 222 PHE CD2 HD2 sing N N 223 PHE CE1 CZ doub Y N 224 PHE CE1 HE1 sing N N 225 PHE CE2 CZ sing Y N 226 PHE CE2 HE2 sing N N 227 PHE CZ HZ sing N N 228 PHE OXT HXT sing N N 229 PRO N CA sing N N 230 PRO N CD sing N N 231 PRO N H sing N N 232 PRO CA C sing N N 233 PRO CA CB sing N N 234 PRO CA HA sing N N 235 PRO C O doub N N 236 PRO C OXT sing N N 237 PRO CB CG sing N N 238 PRO CB HB2 sing N N 239 PRO CB HB3 sing N N 240 PRO CG CD sing N N 241 PRO CG HG2 sing N N 242 PRO CG HG3 sing N N 243 PRO CD HD2 sing N N 244 PRO CD HD3 sing N N 245 PRO OXT HXT sing N N 246 SER N CA sing N N 247 SER N H sing N N 248 SER N H2 sing N N 249 SER CA C sing N N 250 SER CA CB sing N N 251 SER CA HA sing N N 252 SER C O doub N N 253 SER C OXT sing N N 254 SER CB OG sing N N 255 SER CB HB2 sing N N 256 SER CB HB3 sing N N 257 SER OG HG sing N N 258 SER OXT HXT sing N N 259 THR N CA sing N N 260 THR N H sing N N 261 THR N H2 sing N N 262 THR CA C sing N N 263 THR CA CB sing N N 264 THR CA HA sing N N 265 THR C O doub N N 266 THR C OXT sing N N 267 THR CB OG1 sing N N 268 THR CB CG2 sing N N 269 THR CB HB sing N N 270 THR OG1 HG1 sing N N 271 THR CG2 HG21 sing N N 272 THR CG2 HG22 sing N N 273 THR CG2 HG23 sing N N 274 THR OXT HXT sing N N 275 TYR N CA sing N N 276 TYR N H sing N N 277 TYR N H2 sing N N 278 TYR CA C sing N N 279 TYR CA CB sing N N 280 TYR CA HA sing N N 281 TYR C O doub N N 282 TYR C OXT sing N N 283 TYR CB CG sing N N 284 TYR CB HB2 sing N N 285 TYR CB HB3 sing N N 286 TYR CG CD1 doub Y N 287 TYR CG CD2 sing Y N 288 TYR CD1 CE1 sing Y N 289 TYR CD1 HD1 sing N N 290 TYR CD2 CE2 doub Y N 291 TYR CD2 HD2 sing N N 292 TYR CE1 CZ doub Y N 293 TYR CE1 HE1 sing N N 294 TYR CE2 CZ sing Y N 295 TYR CE2 HE2 sing N N 296 TYR CZ OH sing N N 297 TYR OH HH sing N N 298 TYR OXT HXT sing N N 299 VAL N CA sing N N 300 VAL N H sing N N 301 VAL N H2 sing N N 302 VAL CA C sing N N 303 VAL CA CB sing N N 304 VAL CA HA sing N N 305 VAL C O doub N N 306 VAL C OXT sing N N 307 VAL CB CG1 sing N N 308 VAL CB CG2 sing N N 309 VAL CB HB sing N N 310 VAL CG1 HG11 sing N N 311 VAL CG1 HG12 sing N N 312 VAL CG1 HG13 sing N N 313 VAL CG2 HG21 sing N N 314 VAL CG2 HG22 sing N N 315 VAL CG2 HG23 sing N N 316 VAL OXT HXT sing N N 317 # _pdbx_audit_support.funding_organization 'National Science Foundation (China)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31870764 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 ? 2 INOVA ? Agilent 800 ? # _atom_sites.entry_id 6KQV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_