data_6KYF
# 
_entry.id   6KYF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.387 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6KYF         pdb_00006kyf 10.2210/pdb6kyf/pdb 
WWPDB D_1300013856 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-23 
2 'Structure model' 1 1 2021-06-02 
3 'Structure model' 1 2 2024-03-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' chem_comp_atom  
4 3 'Structure model' chem_comp_bond  
5 3 'Structure model' database_2      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                   
2  2 'Structure model' '_citation.journal_abbrev'            
3  2 'Structure model' '_citation.journal_id_ASTM'           
4  2 'Structure model' '_citation.journal_id_CSD'            
5  2 'Structure model' '_citation.journal_id_ISSN'           
6  2 'Structure model' '_citation.journal_volume'            
7  2 'Structure model' '_citation.page_first'                
8  2 'Structure model' '_citation.page_last'                 
9  2 'Structure model' '_citation.pdbx_database_id_DOI'      
10 2 'Structure model' '_citation.pdbx_database_id_PubMed'   
11 2 'Structure model' '_citation.title'                     
12 2 'Structure model' '_citation.year'                      
13 3 'Structure model' '_database_2.pdbx_DOI'                
14 3 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KYF 
_pdbx_database_status.recvd_initial_deposition_date   2019-09-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Niu, Y.'   1 ? 
'Wang, H.'  2 ? 
'Zhang, Y.' 3 ? 
'Feng, Y.'  4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            80 
_citation.language                  ? 
_citation.page_first                512 
_citation.page_last                 524.e5 
_citation.title                     
'A Type I-F Anti-CRISPR Protein Inhibits the CRISPR-Cas Surveillance Complex by ADP-Ribosylation.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2020.09.015 
_citation.pdbx_database_id_PubMed   33049228 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Niu, Y.'        1  ? 
primary 'Yang, L.'       2  ? 
primary 'Gao, T.'        3  ? 
primary 'Dong, C.'       4  ? 
primary 'Zhang, B.'      5  ? 
primary 'Yin, P.'        6  ? 
primary 'Hopp, A.K.'     7  ? 
primary 'Li, D.'         8  ? 
primary 'Gan, R.'        9  ? 
primary 'Wang, H.'       10 ? 
primary 'Liu, X.'        11 ? 
primary 'Cao, X.'        12 ? 
primary 'Xie, Y.'        13 ? 
primary 'Meng, X.'       14 ? 
primary 'Deng, H.'       15 ? 
primary 'Zhang, X.'      16 ? 
primary 'Ren, J.'        17 ? 
primary 'Hottiger, M.O.' 18 ? 
primary 'Chen, Z.'       19 ? 
primary 'Zhang, Y.'      20 ? 
primary 'Liu, X.'        21 ? 
primary 'Feng, Y.'       22 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man AcrF11                            14943.606 1 ? ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425   1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMSMELFHGSYEEISEIRDSGVFGGLFGAHEKETALSHGETLHRIISPLPLTDYALNYEIESAWEVALDVAGGDEN
VAEAIMAKACESDSNDGWELQRLRGVLAVRLGYTSVEMEDEHGTTWLCLPGCTVEKI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMSMELFHGSYEEISEIRDSGVFGGLFGAHEKETALSHGETLHRIISPLPLTDYALNYEIESAWEVALDVAGGDEN
VAEAIMAKACESDSNDGWELQRLRGVLAVRLGYTSVEMEDEHGTTWLCLPGCTVEKI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        NICOTINAMIDE-ADENINE-DINUCLEOTIDE 
_pdbx_entity_nonpoly.comp_id     NAD 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   SER n 
1 8   MET n 
1 9   GLU n 
1 10  LEU n 
1 11  PHE n 
1 12  HIS n 
1 13  GLY n 
1 14  SER n 
1 15  TYR n 
1 16  GLU n 
1 17  GLU n 
1 18  ILE n 
1 19  SER n 
1 20  GLU n 
1 21  ILE n 
1 22  ARG n 
1 23  ASP n 
1 24  SER n 
1 25  GLY n 
1 26  VAL n 
1 27  PHE n 
1 28  GLY n 
1 29  GLY n 
1 30  LEU n 
1 31  PHE n 
1 32  GLY n 
1 33  ALA n 
1 34  HIS n 
1 35  GLU n 
1 36  LYS n 
1 37  GLU n 
1 38  THR n 
1 39  ALA n 
1 40  LEU n 
1 41  SER n 
1 42  HIS n 
1 43  GLY n 
1 44  GLU n 
1 45  THR n 
1 46  LEU n 
1 47  HIS n 
1 48  ARG n 
1 49  ILE n 
1 50  ILE n 
1 51  SER n 
1 52  PRO n 
1 53  LEU n 
1 54  PRO n 
1 55  LEU n 
1 56  THR n 
1 57  ASP n 
1 58  TYR n 
1 59  ALA n 
1 60  LEU n 
1 61  ASN n 
1 62  TYR n 
1 63  GLU n 
1 64  ILE n 
1 65  GLU n 
1 66  SER n 
1 67  ALA n 
1 68  TRP n 
1 69  GLU n 
1 70  VAL n 
1 71  ALA n 
1 72  LEU n 
1 73  ASP n 
1 74  VAL n 
1 75  ALA n 
1 76  GLY n 
1 77  GLY n 
1 78  ASP n 
1 79  GLU n 
1 80  ASN n 
1 81  VAL n 
1 82  ALA n 
1 83  GLU n 
1 84  ALA n 
1 85  ILE n 
1 86  MET n 
1 87  ALA n 
1 88  LYS n 
1 89  ALA n 
1 90  CYS n 
1 91  GLU n 
1 92  SER n 
1 93  ASP n 
1 94  SER n 
1 95  ASN n 
1 96  ASP n 
1 97  GLY n 
1 98  TRP n 
1 99  GLU n 
1 100 LEU n 
1 101 GLN n 
1 102 ARG n 
1 103 LEU n 
1 104 ARG n 
1 105 GLY n 
1 106 VAL n 
1 107 LEU n 
1 108 ALA n 
1 109 VAL n 
1 110 ARG n 
1 111 LEU n 
1 112 GLY n 
1 113 TYR n 
1 114 THR n 
1 115 SER n 
1 116 VAL n 
1 117 GLU n 
1 118 MET n 
1 119 GLU n 
1 120 ASP n 
1 121 GLU n 
1 122 HIS n 
1 123 GLY n 
1 124 THR n 
1 125 THR n 
1 126 TRP n 
1 127 LEU n 
1 128 CYS n 
1 129 LEU n 
1 130 PRO n 
1 131 GLY n 
1 132 CYS n 
1 133 THR n 
1 134 VAL n 
1 135 GLU n 
1 136 LYS n 
1 137 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   137 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 NCTC11440_04410 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  -4  GLY GLY A . n 
A 1 2   PRO 2   -3  -3  PRO PRO A . n 
A 1 3   LEU 3   -2  -2  LEU LEU A . n 
A 1 4   GLY 4   -1  -1  GLY GLY A . n 
A 1 5   SER 5   0   0   SER SER A . n 
A 1 6   MET 6   1   1   MET MET A . n 
A 1 7   SER 7   2   2   SER SER A . n 
A 1 8   MET 8   3   3   MET MET A . n 
A 1 9   GLU 9   4   4   GLU GLU A . n 
A 1 10  LEU 10  5   5   LEU LEU A . n 
A 1 11  PHE 11  6   6   PHE PHE A . n 
A 1 12  HIS 12  7   7   HIS HIS A . n 
A 1 13  GLY 13  8   8   GLY GLY A . n 
A 1 14  SER 14  9   9   SER SER A . n 
A 1 15  TYR 15  10  10  TYR TYR A . n 
A 1 16  GLU 16  11  11  GLU GLU A . n 
A 1 17  GLU 17  12  12  GLU GLU A . n 
A 1 18  ILE 18  13  13  ILE ILE A . n 
A 1 19  SER 19  14  14  SER SER A . n 
A 1 20  GLU 20  15  15  GLU GLU A . n 
A 1 21  ILE 21  16  16  ILE ILE A . n 
A 1 22  ARG 22  17  17  ARG ARG A . n 
A 1 23  ASP 23  18  18  ASP ASP A . n 
A 1 24  SER 24  19  19  SER SER A . n 
A 1 25  GLY 25  20  20  GLY GLY A . n 
A 1 26  VAL 26  21  21  VAL VAL A . n 
A 1 27  PHE 27  22  22  PHE PHE A . n 
A 1 28  GLY 28  23  23  GLY GLY A . n 
A 1 29  GLY 29  24  24  GLY GLY A . n 
A 1 30  LEU 30  25  25  LEU LEU A . n 
A 1 31  PHE 31  26  26  PHE PHE A . n 
A 1 32  GLY 32  27  27  GLY GLY A . n 
A 1 33  ALA 33  28  28  ALA ALA A . n 
A 1 34  HIS 34  29  29  HIS HIS A . n 
A 1 35  GLU 35  30  30  GLU GLU A . n 
A 1 36  LYS 36  31  31  LYS LYS A . n 
A 1 37  GLU 37  32  32  GLU GLU A . n 
A 1 38  THR 38  33  33  THR THR A . n 
A 1 39  ALA 39  34  34  ALA ALA A . n 
A 1 40  LEU 40  35  35  LEU LEU A . n 
A 1 41  SER 41  36  36  SER SER A . n 
A 1 42  HIS 42  37  37  HIS HIS A . n 
A 1 43  GLY 43  38  38  GLY GLY A . n 
A 1 44  GLU 44  39  39  GLU GLU A . n 
A 1 45  THR 45  40  40  THR THR A . n 
A 1 46  LEU 46  41  41  LEU LEU A . n 
A 1 47  HIS 47  42  42  HIS HIS A . n 
A 1 48  ARG 48  43  43  ARG ARG A . n 
A 1 49  ILE 49  44  44  ILE ILE A . n 
A 1 50  ILE 50  45  45  ILE ILE A . n 
A 1 51  SER 51  46  46  SER SER A . n 
A 1 52  PRO 52  47  47  PRO PRO A . n 
A 1 53  LEU 53  48  48  LEU LEU A . n 
A 1 54  PRO 54  49  49  PRO PRO A . n 
A 1 55  LEU 55  50  50  LEU LEU A . n 
A 1 56  THR 56  51  51  THR THR A . n 
A 1 57  ASP 57  52  52  ASP ASP A . n 
A 1 58  TYR 58  53  53  TYR TYR A . n 
A 1 59  ALA 59  54  54  ALA ALA A . n 
A 1 60  LEU 60  55  55  LEU LEU A . n 
A 1 61  ASN 61  56  56  ASN ASN A . n 
A 1 62  TYR 62  57  57  TYR TYR A . n 
A 1 63  GLU 63  58  58  GLU GLU A . n 
A 1 64  ILE 64  59  59  ILE ILE A . n 
A 1 65  GLU 65  60  60  GLU GLU A . n 
A 1 66  SER 66  61  61  SER SER A . n 
A 1 67  ALA 67  62  62  ALA ALA A . n 
A 1 68  TRP 68  63  63  TRP TRP A . n 
A 1 69  GLU 69  64  64  GLU GLU A . n 
A 1 70  VAL 70  65  65  VAL VAL A . n 
A 1 71  ALA 71  66  66  ALA ALA A . n 
A 1 72  LEU 72  67  67  LEU LEU A . n 
A 1 73  ASP 73  68  68  ASP ASP A . n 
A 1 74  VAL 74  69  69  VAL VAL A . n 
A 1 75  ALA 75  70  70  ALA ALA A . n 
A 1 76  GLY 76  71  71  GLY GLY A . n 
A 1 77  GLY 77  72  72  GLY GLY A . n 
A 1 78  ASP 78  73  73  ASP ASP A . n 
A 1 79  GLU 79  74  74  GLU GLU A . n 
A 1 80  ASN 80  75  75  ASN ASN A . n 
A 1 81  VAL 81  76  76  VAL VAL A . n 
A 1 82  ALA 82  77  77  ALA ALA A . n 
A 1 83  GLU 83  78  78  GLU GLU A . n 
A 1 84  ALA 84  79  79  ALA ALA A . n 
A 1 85  ILE 85  80  80  ILE ILE A . n 
A 1 86  MET 86  81  81  MET MET A . n 
A 1 87  ALA 87  82  82  ALA ALA A . n 
A 1 88  LYS 88  83  83  LYS LYS A . n 
A 1 89  ALA 89  84  84  ALA ALA A . n 
A 1 90  CYS 90  85  85  CYS CYS A . n 
A 1 91  GLU 91  86  86  GLU GLU A . n 
A 1 92  SER 92  87  87  SER SER A . n 
A 1 93  ASP 93  88  88  ASP ASP A . n 
A 1 94  SER 94  89  89  SER SER A . n 
A 1 95  ASN 95  90  90  ASN ASN A . n 
A 1 96  ASP 96  91  91  ASP ASP A . n 
A 1 97  GLY 97  92  92  GLY GLY A . n 
A 1 98  TRP 98  93  93  TRP TRP A . n 
A 1 99  GLU 99  94  94  GLU GLU A . n 
A 1 100 LEU 100 95  95  LEU LEU A . n 
A 1 101 GLN 101 96  96  GLN GLN A . n 
A 1 102 ARG 102 97  97  ARG ARG A . n 
A 1 103 LEU 103 98  98  LEU LEU A . n 
A 1 104 ARG 104 99  99  ARG ARG A . n 
A 1 105 GLY 105 100 100 GLY GLY A . n 
A 1 106 VAL 106 101 101 VAL VAL A . n 
A 1 107 LEU 107 102 102 LEU LEU A . n 
A 1 108 ALA 108 103 103 ALA ALA A . n 
A 1 109 VAL 109 104 104 VAL VAL A . n 
A 1 110 ARG 110 105 105 ARG ARG A . n 
A 1 111 LEU 111 106 106 LEU LEU A . n 
A 1 112 GLY 112 107 107 GLY GLY A . n 
A 1 113 TYR 113 108 108 TYR TYR A . n 
A 1 114 THR 114 109 109 THR THR A . n 
A 1 115 SER 115 110 110 SER SER A . n 
A 1 116 VAL 116 111 111 VAL VAL A . n 
A 1 117 GLU 117 112 112 GLU GLU A . n 
A 1 118 MET 118 113 113 MET MET A . n 
A 1 119 GLU 119 114 114 GLU GLU A . n 
A 1 120 ASP 120 115 115 ASP ASP A . n 
A 1 121 GLU 121 116 116 GLU GLU A . n 
A 1 122 HIS 122 117 117 HIS HIS A . n 
A 1 123 GLY 123 118 118 GLY GLY A . n 
A 1 124 THR 124 119 119 THR THR A . n 
A 1 125 THR 125 120 120 THR THR A . n 
A 1 126 TRP 126 121 121 TRP TRP A . n 
A 1 127 LEU 127 122 122 LEU LEU A . n 
A 1 128 CYS 128 123 123 CYS CYS A . n 
A 1 129 LEU 129 124 124 LEU LEU A . n 
A 1 130 PRO 130 125 125 PRO PRO A . n 
A 1 131 GLY 131 126 126 GLY GLY A . n 
A 1 132 CYS 132 127 127 CYS CYS A . n 
A 1 133 THR 133 128 128 THR THR A . n 
A 1 134 VAL 134 129 129 VAL VAL A . n 
A 1 135 GLU 135 130 130 GLU GLU A . n 
A 1 136 LYS 136 131 131 LYS LYS A . n 
A 1 137 ILE 137 132 132 ILE ILE A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          NAD 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     201 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      NAD 
_pdbx_nonpoly_scheme.auth_mon_id     NAD 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot      ? ? ? .         1 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX    ? ? ? 1.15_3459 2 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .         3 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .         4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? AutoSol   ? ? ? .         5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KYF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     104.677 
_cell.length_a_esd                 ? 
_cell.length_b                     104.677 
_cell.length_b_esd                 ? 
_cell.length_c                     119.673 
_cell.length_c_esd                 ? 
_cell.volume                       1135610.357 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KYF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                180 
_symmetry.space_group_name_Hall            'P 62 2 (x,y,z+1/3)' 
_symmetry.space_group_name_H-M             'P 62 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KYF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            6.33 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         80.58 
_exptl_crystal.description                 'The entry contains friedel pairs in F_plus/minus columns and I_plus/minus columns' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'HEPES, sodium citrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-03-21 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6KYF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.07 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       7640 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.54 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            29.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.976 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.07 
_reflns_shell.d_res_low                   3.21 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           716 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.89 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               79.43 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
'The entry contains friedel pairs in F_plus/minus columns and I_plus/minus columns' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6KYF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.07 
_refine.ls_d_res_low                             47.95 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     7639 
_refine.ls_number_reflns_R_free                  619 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.52 
_refine.ls_percent_reflns_R_free                 4.54 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2056 
_refine.ls_R_factor_R_free                       0.2238 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2047 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.98 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.0745 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2103 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.07 
_refine_hist.d_res_low                        47.95 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1090 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1046 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0035 ? 1115 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.7163 ? 1519 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0451 ? 167  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0034 ? 192  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 6.4905 ? 643  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.07 3.38  . . 146 3222 98.19  . . . 0.2744 . 0.2740 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.38 3.87  . . 146 3277 100.00 . . . 0.2256 . 0.2150 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.87 4.87  . . 164 3245 100.00 . . . 0.2073 . 0.1877 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.87 47.95 . . 163 3272 99.88  . . . 0.2242 . 0.1955 . . . . . . . . . . 
# 
_struct.entry_id                     6KYF 
_struct.title                        'Crystal structure of an anti-CRISPR protein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KYF 
_struct_keywords.text            'enzyme, NAD, viral protein' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    6KYF 
_struct_ref.pdbx_db_accession          6KYF 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6KYF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 137 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             6KYF 
_struct_ref_seq.db_align_beg                  -4 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  132 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       -4 
_struct_ref_seq.pdbx_auth_seq_align_end       132 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1020 ? 
1 MORE         -6   ? 
1 'SSA (A^2)'  7460 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLU A 35 ? SER A 41  ? GLU A 30 SER A 36  1 ? 7  
HELX_P HELX_P2 AA2 THR A 56 ? GLU A 63  ? THR A 51 GLU A 58  1 ? 8  
HELX_P HELX_P3 AA3 SER A 66 ? ALA A 75  ? SER A 61 ALA A 70  1 ? 10 
HELX_P HELX_P4 AA4 ASP A 78 ? MET A 86  ? ASP A 73 MET A 81  1 ? 9  
HELX_P HELX_P5 AA5 ASP A 96 ? GLY A 112 ? ASP A 91 GLY A 107 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 8   ? SER A 14  ? MET A 3   SER A 9   
AA1 2 THR A 45  ? SER A 51  ? THR A 40  SER A 46  
AA1 3 THR A 133 ? LYS A 136 ? THR A 128 LYS A 131 
AA2 1 LEU A 30  ? GLY A 32  ? LEU A 25  GLY A 27  
AA2 2 GLY A 123 ? CYS A 128 ? GLY A 118 CYS A 123 
AA2 3 SER A 115 ? ASP A 120 ? SER A 110 ASP A 115 
AA2 4 PRO A 54  ? LEU A 55  ? PRO A 49  LEU A 50  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 14  ? N SER A 9   O THR A 45  ? O THR A 40  
AA1 2 3 N ARG A 48  ? N ARG A 43  O GLU A 135 ? O GLU A 130 
AA2 1 2 N LEU A 30  ? N LEU A 25  O CYS A 128 ? O CYS A 123 
AA2 2 3 O THR A 125 ? O THR A 120 N MET A 118 ? N MET A 113 
AA2 3 4 O SER A 115 ? O SER A 110 N LEU A 55  ? N LEU A 50  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NAD 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    15 
_struct_site.details              'binding site for residue NAD A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 HIS A 12  ? HIS A 7   . ? 1_555 ? 
2  AC1 15 GLY A 13  ? GLY A 8   . ? 1_555 ? 
3  AC1 15 SER A 14  ? SER A 9   . ? 1_555 ? 
4  AC1 15 GLU A 16  ? GLU A 11  . ? 1_555 ? 
5  AC1 15 ILE A 18  ? ILE A 13  . ? 1_555 ? 
6  AC1 15 ILE A 21  ? ILE A 16  . ? 1_555 ? 
7  AC1 15 ARG A 22  ? ARG A 17  . ? 1_555 ? 
8  AC1 15 SER A 24  ? SER A 19  . ? 1_555 ? 
9  AC1 15 GLY A 29  ? GLY A 24  . ? 1_555 ? 
10 AC1 15 LEU A 30  ? LEU A 25  . ? 1_555 ? 
11 AC1 15 PHE A 31  ? PHE A 26  . ? 1_555 ? 
12 AC1 15 HIS A 42  ? HIS A 37  . ? 1_555 ? 
13 AC1 15 GLN A 101 ? GLN A 96  . ? 1_555 ? 
14 AC1 15 ASP A 120 ? ASP A 115 . ? 1_555 ? 
15 AC1 15 THR A 125 ? THR A 120 . ? 1_555 ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    99 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   GLU 
_pdbx_validate_close_contact.auth_seq_id_2    112 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1  x,y,z          
2  x-y,x,z+1/3    
3  y,-x+y,z+2/3   
4  -y,x-y,z+2/3   
5  -x+y,-x,z+1/3  
6  x-y,-y,-z      
7  -x,-x+y,-z+1/3 
8  -x,-y,z        
9  y,x,-z+2/3     
10 -y,-x,-z+2/3   
11 -x+y,y,-z      
12 x,x-y,-z+1/3   
# 
_pdbx_entry_details.entry_id                 6KYF 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
NAD PA   P N S 247 
NAD O1A  O N N 248 
NAD O2A  O N N 249 
NAD O5B  O N N 250 
NAD C5B  C N N 251 
NAD C4B  C N R 252 
NAD O4B  O N N 253 
NAD C3B  C N S 254 
NAD O3B  O N N 255 
NAD C2B  C N R 256 
NAD O2B  O N N 257 
NAD C1B  C N R 258 
NAD N9A  N Y N 259 
NAD C8A  C Y N 260 
NAD N7A  N Y N 261 
NAD C5A  C Y N 262 
NAD C6A  C Y N 263 
NAD N6A  N N N 264 
NAD N1A  N Y N 265 
NAD C2A  C Y N 266 
NAD N3A  N Y N 267 
NAD C4A  C Y N 268 
NAD O3   O N N 269 
NAD PN   P N N 270 
NAD O1N  O N N 271 
NAD O2N  O N N 272 
NAD O5D  O N N 273 
NAD C5D  C N N 274 
NAD C4D  C N R 275 
NAD O4D  O N N 276 
NAD C3D  C N S 277 
NAD O3D  O N N 278 
NAD C2D  C N R 279 
NAD O2D  O N N 280 
NAD C1D  C N R 281 
NAD N1N  N Y N 282 
NAD C2N  C Y N 283 
NAD C3N  C Y N 284 
NAD C7N  C N N 285 
NAD O7N  O N N 286 
NAD N7N  N N N 287 
NAD C4N  C Y N 288 
NAD C5N  C Y N 289 
NAD C6N  C Y N 290 
NAD HOA2 H N N 291 
NAD H51A H N N 292 
NAD H52A H N N 293 
NAD H4B  H N N 294 
NAD H3B  H N N 295 
NAD HO3A H N N 296 
NAD H2B  H N N 297 
NAD HO2A H N N 298 
NAD H1B  H N N 299 
NAD H8A  H N N 300 
NAD H61A H N N 301 
NAD H62A H N N 302 
NAD H2A  H N N 303 
NAD H51N H N N 304 
NAD H52N H N N 305 
NAD H4D  H N N 306 
NAD H3D  H N N 307 
NAD HO3N H N N 308 
NAD H2D  H N N 309 
NAD HO2N H N N 310 
NAD H1D  H N N 311 
NAD H2N  H N N 312 
NAD H71N H N N 313 
NAD H72N H N N 314 
NAD H4N  H N N 315 
NAD H5N  H N N 316 
NAD H6N  H N N 317 
PHE N    N N N 318 
PHE CA   C N S 319 
PHE C    C N N 320 
PHE O    O N N 321 
PHE CB   C N N 322 
PHE CG   C Y N 323 
PHE CD1  C Y N 324 
PHE CD2  C Y N 325 
PHE CE1  C Y N 326 
PHE CE2  C Y N 327 
PHE CZ   C Y N 328 
PHE OXT  O N N 329 
PHE H    H N N 330 
PHE H2   H N N 331 
PHE HA   H N N 332 
PHE HB2  H N N 333 
PHE HB3  H N N 334 
PHE HD1  H N N 335 
PHE HD2  H N N 336 
PHE HE1  H N N 337 
PHE HE2  H N N 338 
PHE HZ   H N N 339 
PHE HXT  H N N 340 
PRO N    N N N 341 
PRO CA   C N S 342 
PRO C    C N N 343 
PRO O    O N N 344 
PRO CB   C N N 345 
PRO CG   C N N 346 
PRO CD   C N N 347 
PRO OXT  O N N 348 
PRO H    H N N 349 
PRO HA   H N N 350 
PRO HB2  H N N 351 
PRO HB3  H N N 352 
PRO HG2  H N N 353 
PRO HG3  H N N 354 
PRO HD2  H N N 355 
PRO HD3  H N N 356 
PRO HXT  H N N 357 
SER N    N N N 358 
SER CA   C N S 359 
SER C    C N N 360 
SER O    O N N 361 
SER CB   C N N 362 
SER OG   O N N 363 
SER OXT  O N N 364 
SER H    H N N 365 
SER H2   H N N 366 
SER HA   H N N 367 
SER HB2  H N N 368 
SER HB3  H N N 369 
SER HG   H N N 370 
SER HXT  H N N 371 
THR N    N N N 372 
THR CA   C N S 373 
THR C    C N N 374 
THR O    O N N 375 
THR CB   C N R 376 
THR OG1  O N N 377 
THR CG2  C N N 378 
THR OXT  O N N 379 
THR H    H N N 380 
THR H2   H N N 381 
THR HA   H N N 382 
THR HB   H N N 383 
THR HG1  H N N 384 
THR HG21 H N N 385 
THR HG22 H N N 386 
THR HG23 H N N 387 
THR HXT  H N N 388 
TRP N    N N N 389 
TRP CA   C N S 390 
TRP C    C N N 391 
TRP O    O N N 392 
TRP CB   C N N 393 
TRP CG   C Y N 394 
TRP CD1  C Y N 395 
TRP CD2  C Y N 396 
TRP NE1  N Y N 397 
TRP CE2  C Y N 398 
TRP CE3  C Y N 399 
TRP CZ2  C Y N 400 
TRP CZ3  C Y N 401 
TRP CH2  C Y N 402 
TRP OXT  O N N 403 
TRP H    H N N 404 
TRP H2   H N N 405 
TRP HA   H N N 406 
TRP HB2  H N N 407 
TRP HB3  H N N 408 
TRP HD1  H N N 409 
TRP HE1  H N N 410 
TRP HE3  H N N 411 
TRP HZ2  H N N 412 
TRP HZ3  H N N 413 
TRP HH2  H N N 414 
TRP HXT  H N N 415 
TYR N    N N N 416 
TYR CA   C N S 417 
TYR C    C N N 418 
TYR O    O N N 419 
TYR CB   C N N 420 
TYR CG   C Y N 421 
TYR CD1  C Y N 422 
TYR CD2  C Y N 423 
TYR CE1  C Y N 424 
TYR CE2  C Y N 425 
TYR CZ   C Y N 426 
TYR OH   O N N 427 
TYR OXT  O N N 428 
TYR H    H N N 429 
TYR H2   H N N 430 
TYR HA   H N N 431 
TYR HB2  H N N 432 
TYR HB3  H N N 433 
TYR HD1  H N N 434 
TYR HD2  H N N 435 
TYR HE1  H N N 436 
TYR HE2  H N N 437 
TYR HH   H N N 438 
TYR HXT  H N N 439 
VAL N    N N N 440 
VAL CA   C N S 441 
VAL C    C N N 442 
VAL O    O N N 443 
VAL CB   C N N 444 
VAL CG1  C N N 445 
VAL CG2  C N N 446 
VAL OXT  O N N 447 
VAL H    H N N 448 
VAL H2   H N N 449 
VAL HA   H N N 450 
VAL HB   H N N 451 
VAL HG11 H N N 452 
VAL HG12 H N N 453 
VAL HG13 H N N 454 
VAL HG21 H N N 455 
VAL HG22 H N N 456 
VAL HG23 H N N 457 
VAL HXT  H N N 458 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
NAD PA  O1A  doub N N 235 
NAD PA  O2A  sing N N 236 
NAD PA  O5B  sing N N 237 
NAD PA  O3   sing N N 238 
NAD O2A HOA2 sing N N 239 
NAD O5B C5B  sing N N 240 
NAD C5B C4B  sing N N 241 
NAD C5B H51A sing N N 242 
NAD C5B H52A sing N N 243 
NAD C4B O4B  sing N N 244 
NAD C4B C3B  sing N N 245 
NAD C4B H4B  sing N N 246 
NAD O4B C1B  sing N N 247 
NAD C3B O3B  sing N N 248 
NAD C3B C2B  sing N N 249 
NAD C3B H3B  sing N N 250 
NAD O3B HO3A sing N N 251 
NAD C2B O2B  sing N N 252 
NAD C2B C1B  sing N N 253 
NAD C2B H2B  sing N N 254 
NAD O2B HO2A sing N N 255 
NAD C1B N9A  sing N N 256 
NAD C1B H1B  sing N N 257 
NAD N9A C8A  sing Y N 258 
NAD N9A C4A  sing Y N 259 
NAD C8A N7A  doub Y N 260 
NAD C8A H8A  sing N N 261 
NAD N7A C5A  sing Y N 262 
NAD C5A C6A  sing Y N 263 
NAD C5A C4A  doub Y N 264 
NAD C6A N6A  sing N N 265 
NAD C6A N1A  doub Y N 266 
NAD N6A H61A sing N N 267 
NAD N6A H62A sing N N 268 
NAD N1A C2A  sing Y N 269 
NAD C2A N3A  doub Y N 270 
NAD C2A H2A  sing N N 271 
NAD N3A C4A  sing Y N 272 
NAD O3  PN   sing N N 273 
NAD PN  O1N  doub N N 274 
NAD PN  O2N  sing N N 275 
NAD PN  O5D  sing N N 276 
NAD O5D C5D  sing N N 277 
NAD C5D C4D  sing N N 278 
NAD C5D H51N sing N N 279 
NAD C5D H52N sing N N 280 
NAD C4D O4D  sing N N 281 
NAD C4D C3D  sing N N 282 
NAD C4D H4D  sing N N 283 
NAD O4D C1D  sing N N 284 
NAD C3D O3D  sing N N 285 
NAD C3D C2D  sing N N 286 
NAD C3D H3D  sing N N 287 
NAD O3D HO3N sing N N 288 
NAD C2D O2D  sing N N 289 
NAD C2D C1D  sing N N 290 
NAD C2D H2D  sing N N 291 
NAD O2D HO2N sing N N 292 
NAD C1D N1N  sing N N 293 
NAD C1D H1D  sing N N 294 
NAD N1N C2N  sing Y N 295 
NAD N1N C6N  doub Y N 296 
NAD C2N C3N  doub Y N 297 
NAD C2N H2N  sing N N 298 
NAD C3N C7N  sing N N 299 
NAD C3N C4N  sing Y N 300 
NAD C7N O7N  doub N N 301 
NAD C7N N7N  sing N N 302 
NAD N7N H71N sing N N 303 
NAD N7N H72N sing N N 304 
NAD C4N C5N  doub Y N 305 
NAD C4N H4N  sing N N 306 
NAD C5N C6N  sing Y N 307 
NAD C5N H5N  sing N N 308 
NAD C6N H6N  sing N N 309 
PHE N   CA   sing N N 310 
PHE N   H    sing N N 311 
PHE N   H2   sing N N 312 
PHE CA  C    sing N N 313 
PHE CA  CB   sing N N 314 
PHE CA  HA   sing N N 315 
PHE C   O    doub N N 316 
PHE C   OXT  sing N N 317 
PHE CB  CG   sing N N 318 
PHE CB  HB2  sing N N 319 
PHE CB  HB3  sing N N 320 
PHE CG  CD1  doub Y N 321 
PHE CG  CD2  sing Y N 322 
PHE CD1 CE1  sing Y N 323 
PHE CD1 HD1  sing N N 324 
PHE CD2 CE2  doub Y N 325 
PHE CD2 HD2  sing N N 326 
PHE CE1 CZ   doub Y N 327 
PHE CE1 HE1  sing N N 328 
PHE CE2 CZ   sing Y N 329 
PHE CE2 HE2  sing N N 330 
PHE CZ  HZ   sing N N 331 
PHE OXT HXT  sing N N 332 
PRO N   CA   sing N N 333 
PRO N   CD   sing N N 334 
PRO N   H    sing N N 335 
PRO CA  C    sing N N 336 
PRO CA  CB   sing N N 337 
PRO CA  HA   sing N N 338 
PRO C   O    doub N N 339 
PRO C   OXT  sing N N 340 
PRO CB  CG   sing N N 341 
PRO CB  HB2  sing N N 342 
PRO CB  HB3  sing N N 343 
PRO CG  CD   sing N N 344 
PRO CG  HG2  sing N N 345 
PRO CG  HG3  sing N N 346 
PRO CD  HD2  sing N N 347 
PRO CD  HD3  sing N N 348 
PRO OXT HXT  sing N N 349 
SER N   CA   sing N N 350 
SER N   H    sing N N 351 
SER N   H2   sing N N 352 
SER CA  C    sing N N 353 
SER CA  CB   sing N N 354 
SER CA  HA   sing N N 355 
SER C   O    doub N N 356 
SER C   OXT  sing N N 357 
SER CB  OG   sing N N 358 
SER CB  HB2  sing N N 359 
SER CB  HB3  sing N N 360 
SER OG  HG   sing N N 361 
SER OXT HXT  sing N N 362 
THR N   CA   sing N N 363 
THR N   H    sing N N 364 
THR N   H2   sing N N 365 
THR CA  C    sing N N 366 
THR CA  CB   sing N N 367 
THR CA  HA   sing N N 368 
THR C   O    doub N N 369 
THR C   OXT  sing N N 370 
THR CB  OG1  sing N N 371 
THR CB  CG2  sing N N 372 
THR CB  HB   sing N N 373 
THR OG1 HG1  sing N N 374 
THR CG2 HG21 sing N N 375 
THR CG2 HG22 sing N N 376 
THR CG2 HG23 sing N N 377 
THR OXT HXT  sing N N 378 
TRP N   CA   sing N N 379 
TRP N   H    sing N N 380 
TRP N   H2   sing N N 381 
TRP CA  C    sing N N 382 
TRP CA  CB   sing N N 383 
TRP CA  HA   sing N N 384 
TRP C   O    doub N N 385 
TRP C   OXT  sing N N 386 
TRP CB  CG   sing N N 387 
TRP CB  HB2  sing N N 388 
TRP CB  HB3  sing N N 389 
TRP CG  CD1  doub Y N 390 
TRP CG  CD2  sing Y N 391 
TRP CD1 NE1  sing Y N 392 
TRP CD1 HD1  sing N N 393 
TRP CD2 CE2  doub Y N 394 
TRP CD2 CE3  sing Y N 395 
TRP NE1 CE2  sing Y N 396 
TRP NE1 HE1  sing N N 397 
TRP CE2 CZ2  sing Y N 398 
TRP CE3 CZ3  doub Y N 399 
TRP CE3 HE3  sing N N 400 
TRP CZ2 CH2  doub Y N 401 
TRP CZ2 HZ2  sing N N 402 
TRP CZ3 CH2  sing Y N 403 
TRP CZ3 HZ3  sing N N 404 
TRP CH2 HH2  sing N N 405 
TRP OXT HXT  sing N N 406 
TYR N   CA   sing N N 407 
TYR N   H    sing N N 408 
TYR N   H2   sing N N 409 
TYR CA  C    sing N N 410 
TYR CA  CB   sing N N 411 
TYR CA  HA   sing N N 412 
TYR C   O    doub N N 413 
TYR C   OXT  sing N N 414 
TYR CB  CG   sing N N 415 
TYR CB  HB2  sing N N 416 
TYR CB  HB3  sing N N 417 
TYR CG  CD1  doub Y N 418 
TYR CG  CD2  sing Y N 419 
TYR CD1 CE1  sing Y N 420 
TYR CD1 HD1  sing N N 421 
TYR CD2 CE2  doub Y N 422 
TYR CD2 HD2  sing N N 423 
TYR CE1 CZ   doub Y N 424 
TYR CE1 HE1  sing N N 425 
TYR CE2 CZ   sing Y N 426 
TYR CE2 HE2  sing N N 427 
TYR CZ  OH   sing N N 428 
TYR OH  HH   sing N N 429 
TYR OXT HXT  sing N N 430 
VAL N   CA   sing N N 431 
VAL N   H    sing N N 432 
VAL N   H2   sing N N 433 
VAL CA  C    sing N N 434 
VAL CA  CB   sing N N 435 
VAL CA  HA   sing N N 436 
VAL C   O    doub N N 437 
VAL C   OXT  sing N N 438 
VAL CB  CG1  sing N N 439 
VAL CB  CG2  sing N N 440 
VAL CB  HB   sing N N 441 
VAL CG1 HG11 sing N N 442 
VAL CG1 HG12 sing N N 443 
VAL CG1 HG13 sing N N 444 
VAL CG2 HG21 sing N N 445 
VAL CG2 HG22 sing N N 446 
VAL CG2 HG23 sing N N 447 
VAL OXT HXT  sing N N 448 
# 
_pdbx_audit_support.funding_organization   'National Science Foundation (China)' 
_pdbx_audit_support.country                China 
_pdbx_audit_support.grant_number           31822012 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        NAD 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   NAD 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_space_group.name_H-M_alt     'P 62 2 2' 
_space_group.name_Hall        'P 62 2 (x,y,z+1/3)' 
_space_group.IT_number        180 
_space_group.crystal_system   hexagonal 
_space_group.id               1 
# 
_atom_sites.entry_id                    6KYF 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.009553 
_atom_sites.fract_transf_matrix[1][2]   0.005516 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011031 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008356 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 6.96715 ?       ? ? 11.43723 ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 7.96527 ?       ? ? 9.05267  ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P ? ? 9.51135 5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_