data_6L01 # _entry.id 6L01 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L01 pdb_00006l01 10.2210/pdb6l01/pdb WWPDB D_1300013952 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6KZV unspecified PDB . 6KZX unspecified PDB . 6KZZ unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6L01 _pdbx_database_status.recvd_initial_deposition_date 2019-09-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mima, M.' 1 0000-0003-2336-9129 'Takeuchi, T.' 2 ? 'Ushiyama, F.' 3 0000-0003-3122-8625 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Omega' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2470-1343 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 10145 _citation.page_last 10159 _citation.title ;Lead Identification of 8-(Methylamino)-2-oxo-1,2-dihydroquinoline Derivatives as DNA Gyrase Inhibitors: Hit-to-Lead Generation Involving Thermodynamic Evaluation. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsomega.0c00865 _citation.pdbx_database_id_PubMed 32391502 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ushiyama, F.' 1 ? primary 'Amada, H.' 2 ? primary 'Takeuchi, T.' 3 ? primary 'Tanaka-Yamamoto, N.' 4 ? primary 'Kanazawa, H.' 5 ? primary 'Nakano, K.' 6 ? primary 'Mima, M.' 7 ? primary 'Masuko, A.' 8 ? primary 'Takata, I.' 9 ? primary 'Hitaka, K.' 10 ? primary 'Iwamoto, K.' 11 ? primary 'Sugiyama, H.' 12 ? primary 'Ohtake, N.' 13 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6L01 _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.582 _cell.length_a_esd ? _cell.length_b 67.066 _cell.length_b_esd ? _cell.length_c 68.252 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6L01 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA gyrase subunit B' 24191.182 1 5.6.2.2 ? ? ? 2 non-polymer syn '2-[3-[[8-(methylamino)-2-oxidanylidene-1~{H}-quinolin-3-yl]carbonylamino]phenyl]ethanoic acid' 351.356 1 ? ? ? ? 3 water nat water 18.015 19 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPT GIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGET EKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEG ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPT GIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGET EKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 SER n 1 5 TYR n 1 6 ASP n 1 7 SER n 1 8 SER n 1 9 SER n 1 10 ILE n 1 11 LYS n 1 12 VAL n 1 13 LEU n 1 14 LYS n 1 15 GLY n 1 16 LEU n 1 17 ASP n 1 18 ALA n 1 19 VAL n 1 20 ARG n 1 21 LYS n 1 22 ARG n 1 23 PRO n 1 24 GLY n 1 25 MET n 1 26 TYR n 1 27 ILE n 1 28 GLY n 1 29 ASP n 1 30 THR n 1 31 ASP n 1 32 ASP n 1 33 GLY n 1 34 THR n 1 35 GLY n 1 36 LEU n 1 37 HIS n 1 38 HIS n 1 39 MET n 1 40 VAL n 1 41 PHE n 1 42 GLU n 1 43 VAL n 1 44 VAL n 1 45 ASP n 1 46 ASN n 1 47 ALA n 1 48 ILE n 1 49 ASP n 1 50 GLU n 1 51 ALA n 1 52 LEU n 1 53 ALA n 1 54 GLY n 1 55 HIS n 1 56 CYS n 1 57 LYS n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 VAL n 1 62 THR n 1 63 ILE n 1 64 HIS n 1 65 ALA n 1 66 ASP n 1 67 ASN n 1 68 SER n 1 69 VAL n 1 70 SER n 1 71 VAL n 1 72 GLN n 1 73 ASP n 1 74 ASP n 1 75 GLY n 1 76 ARG n 1 77 GLY n 1 78 ILE n 1 79 PRO n 1 80 THR n 1 81 GLY n 1 82 ILE n 1 83 HIS n 1 84 PRO n 1 85 GLU n 1 86 GLU n 1 87 GLY n 1 88 VAL n 1 89 SER n 1 90 ALA n 1 91 ALA n 1 92 GLU n 1 93 VAL n 1 94 ILE n 1 95 MET n 1 96 THR n 1 97 VAL n 1 98 LEU n 1 99 HIS n 1 100 ALA n 1 101 GLY n 1 102 GLY n 1 103 LYS n 1 104 PHE n 1 105 ASP n 1 106 ASP n 1 107 ASN n 1 108 SER n 1 109 TYR n 1 110 LYS n 1 111 VAL n 1 112 SER n 1 113 GLY n 1 114 GLY n 1 115 LEU n 1 116 HIS n 1 117 GLY n 1 118 VAL n 1 119 GLY n 1 120 VAL n 1 121 SER n 1 122 VAL n 1 123 VAL n 1 124 ASN n 1 125 ALA n 1 126 LEU n 1 127 SER n 1 128 GLN n 1 129 LYS n 1 130 LEU n 1 131 GLU n 1 132 LEU n 1 133 VAL n 1 134 ILE n 1 135 GLN n 1 136 ARG n 1 137 GLU n 1 138 GLY n 1 139 LYS n 1 140 ILE n 1 141 HIS n 1 142 ARG n 1 143 GLN n 1 144 ILE n 1 145 TYR n 1 146 GLU n 1 147 HIS n 1 148 GLY n 1 149 VAL n 1 150 PRO n 1 151 GLN n 1 152 ALA n 1 153 PRO n 1 154 LEU n 1 155 ALA n 1 156 VAL n 1 157 THR n 1 158 GLY n 1 159 GLU n 1 160 THR n 1 161 GLU n 1 162 LYS n 1 163 THR n 1 164 GLY n 1 165 THR n 1 166 MET n 1 167 VAL n 1 168 ARG n 1 169 PHE n 1 170 TRP n 1 171 PRO n 1 172 SER n 1 173 LEU n 1 174 GLU n 1 175 THR n 1 176 PHE n 1 177 THR n 1 178 ASN n 1 179 VAL n 1 180 THR n 1 181 GLU n 1 182 PHE n 1 183 GLU n 1 184 TYR n 1 185 GLU n 1 186 ILE n 1 187 LEU n 1 188 ALA n 1 189 LYS n 1 190 ARG n 1 191 LEU n 1 192 ARG n 1 193 GLU n 1 194 LEU n 1 195 SER n 1 196 PHE n 1 197 LEU n 1 198 ASN n 1 199 SER n 1 200 GLY n 1 201 VAL n 1 202 SER n 1 203 ILE n 1 204 ARG n 1 205 LEU n 1 206 ARG n 1 207 ASP n 1 208 LYS n 1 209 ARG n 1 210 ASP n 1 211 GLY n 1 212 LYS n 1 213 GLU n 1 214 ASP n 1 215 HIS n 1 216 PHE n 1 217 HIS n 1 218 TYR n 1 219 GLU n 1 220 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 220 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'gyrB, C9Z04_12785' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A4V5JMQ9_ECOLX _struct_ref.pdbx_db_accession A0A4V5JMQ9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPT GIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGET EKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6L01 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 220 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A4V5JMQ9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 220 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 220 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 E0U non-polymer . '2-[3-[[8-(methylamino)-2-oxidanylidene-1~{H}-quinolin-3-yl]carbonylamino]phenyl]ethanoic acid' '(3-{[8-(methylamino)-2-oxo-1,2-dihydroquinoline-3-carbonyl]amino}phenyl)acetic acid' 'C19 H17 N3 O4' 351.356 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L01 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MES, Ammonium acetate, PEG10000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS VII' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6L01 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 21.54 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6243 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.72 _reflns.pdbx_Rmerge_I_obs 0.149 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 598 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.325 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6L01 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 21.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5930 _refine.ls_number_reflns_R_free 287 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.63 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23304 _refine.ls_R_factor_R_free 0.28675 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23027 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1AJ6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1524 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1569 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 21.54 # _refine_ls_shell.R_factor_R_free 0.350 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.336 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.d_res_high 2.600 _refine_ls_shell.d_res_low 2.667 _refine_ls_shell.number_reflns_R_free 14 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 430 _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? # _struct.entry_id 6L01 _struct.title 'Crystal structure of E.coli DNA gyrase B in complex with 2-oxo-1,2-dihydroquinoline derivative' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L01 _struct_keywords.text 'Inhibitor, Complex, Topoisomerase, Escherichia coli, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? ARG A 22 ? SER A 7 ARG A 22 1 ? 16 HELX_P HELX_P2 AA2 PRO A 23 ? TYR A 26 ? PRO A 23 TYR A 26 5 ? 4 HELX_P HELX_P3 AA3 GLY A 33 ? ALA A 53 ? GLY A 33 ALA A 53 1 ? 21 HELX_P HELX_P4 AA4 SER A 89 ? VAL A 97 ? SER A 89 VAL A 97 1 ? 9 HELX_P HELX_P5 AA5 GLY A 119 ? LEU A 126 ? GLY A 119 LEU A 126 1 ? 8 HELX_P HELX_P6 AA6 GLU A 183 ? ASN A 198 ? GLU A 183 ASN A 198 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? parallel AA2 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 149 ? PRO A 150 ? VAL A 149 PRO A 150 AA1 2 LYS A 139 ? GLU A 146 ? LYS A 139 GLU A 146 AA1 3 ALA A 155 ? GLU A 159 ? ALA A 155 GLU A 159 AA2 1 VAL A 149 ? PRO A 150 ? VAL A 149 PRO A 150 AA2 2 LYS A 139 ? GLU A 146 ? LYS A 139 GLU A 146 AA2 3 SER A 127 ? ARG A 136 ? SER A 127 ARG A 136 AA2 4 GLY A 164 ? PRO A 171 ? GLY A 164 PRO A 171 AA2 5 VAL A 69 ? ASP A 73 ? VAL A 69 ASP A 73 AA2 6 GLU A 58 ? ILE A 63 ? GLU A 58 ILE A 63 AA2 7 SER A 202 ? ASP A 207 ? SER A 202 ASP A 207 AA2 8 GLU A 213 ? PHE A 216 ? GLU A 213 PHE A 216 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 149 ? O VAL A 149 N GLU A 146 ? N GLU A 146 AA1 2 3 N ILE A 140 ? N ILE A 140 O THR A 157 ? O THR A 157 AA2 1 2 O VAL A 149 ? O VAL A 149 N GLU A 146 ? N GLU A 146 AA2 2 3 O HIS A 141 ? O HIS A 141 N ILE A 134 ? N ILE A 134 AA2 3 4 N GLU A 131 ? N GLU A 131 O ARG A 168 ? O ARG A 168 AA2 4 5 O THR A 165 ? O THR A 165 N ASP A 73 ? N ASP A 73 AA2 5 6 O GLN A 72 ? O GLN A 72 N ILE A 60 ? N ILE A 60 AA2 6 7 N VAL A 61 ? N VAL A 61 O ARG A 204 ? O ARG A 204 AA2 7 8 N ILE A 203 ? N ILE A 203 O PHE A 216 ? O PHE A 216 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id E0U _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'binding site for residue E0U A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 ASN A 46 ? ASN A 46 . ? 1_555 ? 2 AC1 12 GLU A 50 ? GLU A 50 . ? 1_555 ? 3 AC1 12 VAL A 71 ? VAL A 71 . ? 1_555 ? 4 AC1 12 ASP A 73 ? ASP A 73 . ? 1_555 ? 5 AC1 12 ARG A 76 ? ARG A 76 . ? 1_555 ? 6 AC1 12 GLY A 77 ? GLY A 77 . ? 1_555 ? 7 AC1 12 ILE A 78 ? ILE A 78 . ? 1_555 ? 8 AC1 12 PRO A 79 ? PRO A 79 . ? 1_555 ? 9 AC1 12 VAL A 120 ? VAL A 120 . ? 1_555 ? 10 AC1 12 THR A 165 ? THR A 165 . ? 1_555 ? 11 AC1 12 VAL A 167 ? VAL A 167 . ? 1_555 ? 12 AC1 12 HOH C . ? HOH A 403 . ? 1_555 ? # _database_PDB_matrix.entry_id 6L01 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6L01 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.024049 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014911 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014651 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 TYR 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 ALA 100 100 ? ? ? A . n A 1 101 GLY 101 101 ? ? ? A . n A 1 102 GLY 102 102 ? ? ? A . n A 1 103 LYS 103 103 ? ? ? A . n A 1 104 PHE 104 104 ? ? ? A . n A 1 105 ASP 105 105 ? ? ? A . n A 1 106 ASP 106 106 ? ? ? A . n A 1 107 ASN 107 107 ? ? ? A . n A 1 108 SER 108 108 ? ? ? A . n A 1 109 TYR 109 109 ? ? ? A . n A 1 110 LYS 110 110 ? ? ? A . n A 1 111 VAL 111 111 ? ? ? A . n A 1 112 SER 112 112 ? ? ? A . n A 1 113 GLY 113 113 ? ? ? A . n A 1 114 GLY 114 114 ? ? ? A . n A 1 115 LEU 115 115 ? ? ? A . n A 1 116 HIS 116 116 ? ? ? A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 ARG 209 209 209 ARG ARG A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 LYS 212 212 212 LYS LYS A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 HIS 215 215 215 HIS HIS A . n A 1 216 PHE 216 216 216 PHE PHE A . n A 1 217 HIS 217 217 217 HIS HIS A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLY 220 220 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 E0U 1 301 1219 E0U G94 A . C 3 HOH 1 401 5 HOH HOH A . C 3 HOH 2 402 7 HOH HOH A . C 3 HOH 3 403 12 HOH HOH A . C 3 HOH 4 404 14 HOH HOH A . C 3 HOH 5 405 10 HOH HOH A . C 3 HOH 6 406 13 HOH HOH A . C 3 HOH 7 407 19 HOH HOH A . C 3 HOH 8 408 15 HOH HOH A . C 3 HOH 9 409 8 HOH HOH A . C 3 HOH 10 410 4 HOH HOH A . C 3 HOH 11 411 9 HOH HOH A . C 3 HOH 12 412 16 HOH HOH A . C 3 HOH 13 413 3 HOH HOH A . C 3 HOH 14 414 1 HOH HOH A . C 3 HOH 15 415 6 HOH HOH A . C 3 HOH 16 416 2 HOH HOH A . C 3 HOH 17 417 11 HOH HOH A . C 3 HOH 18 418 18 HOH HOH A . C 3 HOH 19 419 17 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-05-06 2 'Structure model' 1 1 2020-05-27 3 'Structure model' 1 2 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 6L01 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 THR _pdbx_validate_symm_contact.auth_seq_id_1 177 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 204 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_455 _pdbx_validate_symm_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 84 ? ? -68.61 37.71 2 1 GLU A 85 ? ? -99.70 -62.05 3 1 SER A 89 ? ? -37.45 138.84 4 1 ASN A 178 ? ? 78.94 -83.11 5 1 HIS A 217 ? ? -169.35 117.25 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 HIS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 83 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PRO _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 84 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -149.14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A TYR 5 ? A TYR 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A ALA 100 ? A ALA 100 8 1 Y 1 A GLY 101 ? A GLY 101 9 1 Y 1 A GLY 102 ? A GLY 102 10 1 Y 1 A LYS 103 ? A LYS 103 11 1 Y 1 A PHE 104 ? A PHE 104 12 1 Y 1 A ASP 105 ? A ASP 105 13 1 Y 1 A ASP 106 ? A ASP 106 14 1 Y 1 A ASN 107 ? A ASN 107 15 1 Y 1 A SER 108 ? A SER 108 16 1 Y 1 A TYR 109 ? A TYR 109 17 1 Y 1 A LYS 110 ? A LYS 110 18 1 Y 1 A VAL 111 ? A VAL 111 19 1 Y 1 A SER 112 ? A SER 112 20 1 Y 1 A GLY 113 ? A GLY 113 21 1 Y 1 A GLY 114 ? A GLY 114 22 1 Y 1 A LEU 115 ? A LEU 115 23 1 Y 1 A HIS 116 ? A HIS 116 24 1 Y 1 A GLY 220 ? A GLY 220 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 E0U C2 C Y N 88 E0U C4 C Y N 89 E0U C6 C Y N 90 E0U C7 C N N 91 E0U C8 C N N 92 E0U C9 C N N 93 E0U N11 N N N 94 E0U C14 C N N 95 E0U C17 C Y N 96 E0U C20 C Y N 97 E0U C21 C Y N 98 E0U C22 C Y N 99 E0U C23 C N N 100 E0U O25 O N N 101 E0U O26 O N N 102 E0U C24 C N N 103 E0U C19 C Y N 104 E0U C18 C Y N 105 E0U N15 N N N 106 E0U O16 O N N 107 E0U C3 C Y N 108 E0U O13 O N N 109 E0U N10 N N N 110 E0U C5 C Y N 111 E0U C1 C Y N 112 E0U C12 C N N 113 E0U H1 H N N 114 E0U H2 H N N 115 E0U H3 H N N 116 E0U H4 H N N 117 E0U H5 H N N 118 E0U H6 H N N 119 E0U H7 H N N 120 E0U H8 H N N 121 E0U H9 H N N 122 E0U H10 H N N 123 E0U H11 H N N 124 E0U H12 H N N 125 E0U H13 H N N 126 E0U H14 H N N 127 E0U H15 H N N 128 E0U H16 H N N 129 E0U H17 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TRP N N N N 364 TRP CA C N S 365 TRP C C N N 366 TRP O O N N 367 TRP CB C N N 368 TRP CG C Y N 369 TRP CD1 C Y N 370 TRP CD2 C Y N 371 TRP NE1 N Y N 372 TRP CE2 C Y N 373 TRP CE3 C Y N 374 TRP CZ2 C Y N 375 TRP CZ3 C Y N 376 TRP CH2 C Y N 377 TRP OXT O N N 378 TRP H H N N 379 TRP H2 H N N 380 TRP HA H N N 381 TRP HB2 H N N 382 TRP HB3 H N N 383 TRP HD1 H N N 384 TRP HE1 H N N 385 TRP HE3 H N N 386 TRP HZ2 H N N 387 TRP HZ3 H N N 388 TRP HH2 H N N 389 TRP HXT H N N 390 TYR N N N N 391 TYR CA C N S 392 TYR C C N N 393 TYR O O N N 394 TYR CB C N N 395 TYR CG C Y N 396 TYR CD1 C Y N 397 TYR CD2 C Y N 398 TYR CE1 C Y N 399 TYR CE2 C Y N 400 TYR CZ C Y N 401 TYR OH O N N 402 TYR OXT O N N 403 TYR H H N N 404 TYR H2 H N N 405 TYR HA H N N 406 TYR HB2 H N N 407 TYR HB3 H N N 408 TYR HD1 H N N 409 TYR HD2 H N N 410 TYR HE1 H N N 411 TYR HE2 H N N 412 TYR HH H N N 413 TYR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 E0U C19 C18 doub Y N 83 E0U C19 C20 sing Y N 84 E0U C18 C17 sing Y N 85 E0U C20 C21 doub Y N 86 E0U O13 C9 doub N N 87 E0U C17 N15 sing N N 88 E0U C17 C22 doub Y N 89 E0U O26 C24 doub N N 90 E0U N15 C14 sing N N 91 E0U C9 N10 sing N N 92 E0U C9 C8 sing N N 93 E0U N10 C5 sing N N 94 E0U C21 C22 sing Y N 95 E0U C21 C23 sing N N 96 E0U C12 N11 sing N N 97 E0U N11 C6 sing N N 98 E0U C24 C23 sing N N 99 E0U C24 O25 sing N N 100 E0U C14 C8 sing N N 101 E0U C14 O16 doub N N 102 E0U C5 C6 doub Y N 103 E0U C5 C4 sing Y N 104 E0U C8 C7 doub N N 105 E0U C6 C1 sing Y N 106 E0U C7 C4 sing N N 107 E0U C4 C3 doub Y N 108 E0U C1 C2 doub Y N 109 E0U C3 C2 sing Y N 110 E0U C2 H1 sing N N 111 E0U C7 H2 sing N N 112 E0U N11 H3 sing N N 113 E0U C20 H4 sing N N 114 E0U C22 H5 sing N N 115 E0U C23 H6 sing N N 116 E0U C23 H7 sing N N 117 E0U O25 H8 sing N N 118 E0U C19 H9 sing N N 119 E0U C18 H10 sing N N 120 E0U N15 H11 sing N N 121 E0U C3 H12 sing N N 122 E0U N10 H13 sing N N 123 E0U C1 H14 sing N N 124 E0U C12 H15 sing N N 125 E0U C12 H16 sing N N 126 E0U C12 H17 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id E0U _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id E0U _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-[3-[[8-(methylamino)-2-oxidanylidene-1~{H}-quinolin-3-yl]carbonylamino]phenyl]ethanoic acid' E0U 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1AJ6 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #