data_6L4Z # _entry.id 6L4Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6L4Z pdb_00006l4z 10.2210/pdb6l4z/pdb WWPDB D_1300014094 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6L4Z _pdbx_database_status.recvd_initial_deposition_date 2019-10-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Quek, J.P.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-3827-8580 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Antiviral Res.' _citation.journal_id_ASTM ARSRDR _citation.journal_id_CSD 1136 _citation.journal_id_ISSN 0166-3542 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 175 _citation.language ? _citation.page_first 104707 _citation.page_last 104707 _citation.title 'Identification and structural characterization of small molecule fragments targeting Zika virus NS2B-NS3 protease.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.antiviral.2020.104707 _citation.pdbx_database_id_PubMed 31953156 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Quek, J.P.' 1 ? primary 'Liu, S.' 2 ? primary 'Zhang, Z.' 3 ? primary 'Li, Y.' 4 ? primary 'Ng, E.Y.' 5 ? primary 'Loh, Y.R.' 6 ? primary 'Hung, A.W.' 7 ? primary 'Luo, D.' 8 ? primary 'Kang, C.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6L4Z _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.549 _cell.length_a_esd ? _cell.length_b 59.525 _cell.length_b_esd ? _cell.length_c 214.556 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6L4Z _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Genome polyprotein' 4218.545 2 3.4.21.91,3.6.1.15,3.6.4.13,2.1.1.56,2.1.1.57,2.7.7.48 ? ? ? 2 polymer man 'Genome polyprotein' 16556.846 1 ? ? ? ? 3 polymer man 'Genome polyprotein' 4103.458 1 3.4.21.91,3.6.1.15,3.6.4.13,2.1.1.56,2.1.1.57,2.7.7.48 ? ? ? 4 polymer man 'Genome polyprotein' 16370.678 1 ? ? ? ? 5 polymer man 'Genome polyprotein' 16269.574 1 ? ? ? ? 6 polymer man 'Genome polyprotein' 4476.773 1 3.4.21.91,3.6.1.15,3.6.4.13,2.1.1.56,2.1.1.57,2.7.7.48 ? ? ? 7 polymer man 'Genome polyprotein' 17043.447 1 ? ? ? ? 8 non-polymer syn '4-(hydroxymethyl)benzoic acid' 152.147 1 ? ? ? ? 9 water nat water 18.015 174 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 2 'NS3 Protease' 3 'NS2B Cofactor' 4 'NS3 Protease' 6 'NS2B Cofactor' 7 'NS3 Protease' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV A,E ? 2 'polypeptide(L)' no no ;GETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEV QLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; ;GETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEV QLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; B ? 3 'polypeptide(L)' no no MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV C ? 4 'polypeptide(L)' no no ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; D ? 5 'polypeptide(L)' no no ;TDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLL AVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; ;TDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLL AVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; F ? 6 'polypeptide(L)' no no DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE G ? 7 'polypeptide(L)' no no ;EVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDG LSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; ;EVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDG LSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; H ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 MET n 1 3 TYR n 1 4 ILE n 1 5 GLU n 1 6 ARG n 1 7 ALA n 1 8 GLY n 1 9 ASP n 1 10 ILE n 1 11 THR n 1 12 TRP n 1 13 GLU n 1 14 LYS n 1 15 ASP n 1 16 ALA n 1 17 GLU n 1 18 VAL n 1 19 THR n 1 20 GLY n 1 21 ASN n 1 22 SER n 1 23 PRO n 1 24 ARG n 1 25 LEU n 1 26 ASP n 1 27 VAL n 1 28 ALA n 1 29 LEU n 1 30 ASP n 1 31 GLU n 1 32 SER n 1 33 GLY n 1 34 ASP n 1 35 PHE n 1 36 SER n 1 37 LEU n 1 38 VAL n 2 1 GLY n 2 2 GLU n 2 3 THR n 2 4 THR n 2 5 ASP n 2 6 GLY n 2 7 VAL n 2 8 TYR n 2 9 ARG n 2 10 VAL n 2 11 MET n 2 12 THR n 2 13 ARG n 2 14 ARG n 2 15 LEU n 2 16 LEU n 2 17 GLY n 2 18 SER n 2 19 THR n 2 20 GLN n 2 21 VAL n 2 22 GLY n 2 23 VAL n 2 24 GLY n 2 25 VAL n 2 26 MET n 2 27 GLN n 2 28 GLU n 2 29 GLY n 2 30 VAL n 2 31 PHE n 2 32 HIS n 2 33 THR n 2 34 MET n 2 35 TRP n 2 36 HIS n 2 37 VAL n 2 38 THR n 2 39 LYS n 2 40 GLY n 2 41 ALA n 2 42 ALA n 2 43 LEU n 2 44 ARG n 2 45 SER n 2 46 GLY n 2 47 GLU n 2 48 GLY n 2 49 ARG n 2 50 LEU n 2 51 ASP n 2 52 PRO n 2 53 TYR n 2 54 TRP n 2 55 GLY n 2 56 ASP n 2 57 VAL n 2 58 LYS n 2 59 GLN n 2 60 ASP n 2 61 LEU n 2 62 VAL n 2 63 SER n 2 64 TYR n 2 65 CYS n 2 66 GLY n 2 67 PRO n 2 68 TRP n 2 69 LYS n 2 70 LEU n 2 71 ASP n 2 72 ALA n 2 73 ALA n 2 74 TRP n 2 75 ASP n 2 76 GLY n 2 77 LEU n 2 78 SER n 2 79 GLU n 2 80 VAL n 2 81 GLN n 2 82 LEU n 2 83 LEU n 2 84 ALA n 2 85 VAL n 2 86 PRO n 2 87 PRO n 2 88 GLY n 2 89 GLU n 2 90 ARG n 2 91 ALA n 2 92 LYS n 2 93 ASN n 2 94 ILE n 2 95 GLN n 2 96 THR n 2 97 LEU n 2 98 PRO n 2 99 GLY n 2 100 ILE n 2 101 PHE n 2 102 LYS n 2 103 THR n 2 104 LYS n 2 105 ASP n 2 106 GLY n 2 107 ASP n 2 108 ILE n 2 109 GLY n 2 110 ALA n 2 111 VAL n 2 112 ALA n 2 113 LEU n 2 114 ASP n 2 115 TYR n 2 116 PRO n 2 117 ALA n 2 118 GLY n 2 119 THR n 2 120 SER n 2 121 GLY n 2 122 SER n 2 123 PRO n 2 124 ILE n 2 125 LEU n 2 126 ASP n 2 127 LYS n 2 128 CYS n 2 129 GLY n 2 130 ARG n 2 131 VAL n 2 132 ILE n 2 133 GLY n 2 134 LEU n 2 135 TYR n 2 136 GLY n 2 137 ASN n 2 138 GLY n 2 139 VAL n 2 140 VAL n 2 141 ILE n 2 142 LYS n 2 143 ASN n 2 144 GLY n 2 145 SER n 2 146 TYR n 2 147 VAL n 2 148 SER n 2 149 ALA n 2 150 ILE n 2 151 THR n 2 152 GLN n 2 153 GLY n 2 154 LYS n 2 155 ARG n 3 1 MET n 3 2 TYR n 3 3 ILE n 3 4 GLU n 3 5 ARG n 3 6 ALA n 3 7 GLY n 3 8 ASP n 3 9 ILE n 3 10 THR n 3 11 TRP n 3 12 GLU n 3 13 LYS n 3 14 ASP n 3 15 ALA n 3 16 GLU n 3 17 VAL n 3 18 THR n 3 19 GLY n 3 20 ASN n 3 21 SER n 3 22 PRO n 3 23 ARG n 3 24 LEU n 3 25 ASP n 3 26 VAL n 3 27 ALA n 3 28 LEU n 3 29 ASP n 3 30 GLU n 3 31 SER n 3 32 GLY n 3 33 ASP n 3 34 PHE n 3 35 SER n 3 36 LEU n 3 37 VAL n 4 1 THR n 4 2 THR n 4 3 ASP n 4 4 GLY n 4 5 VAL n 4 6 TYR n 4 7 ARG n 4 8 VAL n 4 9 MET n 4 10 THR n 4 11 ARG n 4 12 ARG n 4 13 LEU n 4 14 LEU n 4 15 GLY n 4 16 SER n 4 17 THR n 4 18 GLN n 4 19 VAL n 4 20 GLY n 4 21 VAL n 4 22 GLY n 4 23 VAL n 4 24 MET n 4 25 GLN n 4 26 GLU n 4 27 GLY n 4 28 VAL n 4 29 PHE n 4 30 HIS n 4 31 THR n 4 32 MET n 4 33 TRP n 4 34 HIS n 4 35 VAL n 4 36 THR n 4 37 LYS n 4 38 GLY n 4 39 ALA n 4 40 ALA n 4 41 LEU n 4 42 ARG n 4 43 SER n 4 44 GLY n 4 45 GLU n 4 46 GLY n 4 47 ARG n 4 48 LEU n 4 49 ASP n 4 50 PRO n 4 51 TYR n 4 52 TRP n 4 53 GLY n 4 54 ASP n 4 55 VAL n 4 56 LYS n 4 57 GLN n 4 58 ASP n 4 59 LEU n 4 60 VAL n 4 61 SER n 4 62 TYR n 4 63 CYS n 4 64 GLY n 4 65 PRO n 4 66 TRP n 4 67 LYS n 4 68 LEU n 4 69 ASP n 4 70 ALA n 4 71 ALA n 4 72 TRP n 4 73 ASP n 4 74 GLY n 4 75 LEU n 4 76 SER n 4 77 GLU n 4 78 VAL n 4 79 GLN n 4 80 LEU n 4 81 LEU n 4 82 ALA n 4 83 VAL n 4 84 PRO n 4 85 PRO n 4 86 GLY n 4 87 GLU n 4 88 ARG n 4 89 ALA n 4 90 LYS n 4 91 ASN n 4 92 ILE n 4 93 GLN n 4 94 THR n 4 95 LEU n 4 96 PRO n 4 97 GLY n 4 98 ILE n 4 99 PHE n 4 100 LYS n 4 101 THR n 4 102 LYS n 4 103 ASP n 4 104 GLY n 4 105 ASP n 4 106 ILE n 4 107 GLY n 4 108 ALA n 4 109 VAL n 4 110 ALA n 4 111 LEU n 4 112 ASP n 4 113 TYR n 4 114 PRO n 4 115 ALA n 4 116 GLY n 4 117 THR n 4 118 SER n 4 119 GLY n 4 120 SER n 4 121 PRO n 4 122 ILE n 4 123 LEU n 4 124 ASP n 4 125 LYS n 4 126 CYS n 4 127 GLY n 4 128 ARG n 4 129 VAL n 4 130 ILE n 4 131 GLY n 4 132 LEU n 4 133 TYR n 4 134 GLY n 4 135 ASN n 4 136 GLY n 4 137 VAL n 4 138 VAL n 4 139 ILE n 4 140 LYS n 4 141 ASN n 4 142 GLY n 4 143 SER n 4 144 TYR n 4 145 VAL n 4 146 SER n 4 147 ALA n 4 148 ILE n 4 149 THR n 4 150 GLN n 4 151 GLY n 4 152 LYS n 4 153 ARG n 5 1 THR n 5 2 ASP n 5 3 GLY n 5 4 VAL n 5 5 TYR n 5 6 ARG n 5 7 VAL n 5 8 MET n 5 9 THR n 5 10 ARG n 5 11 ARG n 5 12 LEU n 5 13 LEU n 5 14 GLY n 5 15 SER n 5 16 THR n 5 17 GLN n 5 18 VAL n 5 19 GLY n 5 20 VAL n 5 21 GLY n 5 22 VAL n 5 23 MET n 5 24 GLN n 5 25 GLU n 5 26 GLY n 5 27 VAL n 5 28 PHE n 5 29 HIS n 5 30 THR n 5 31 MET n 5 32 TRP n 5 33 HIS n 5 34 VAL n 5 35 THR n 5 36 LYS n 5 37 GLY n 5 38 ALA n 5 39 ALA n 5 40 LEU n 5 41 ARG n 5 42 SER n 5 43 GLY n 5 44 GLU n 5 45 GLY n 5 46 ARG n 5 47 LEU n 5 48 ASP n 5 49 PRO n 5 50 TYR n 5 51 TRP n 5 52 GLY n 5 53 ASP n 5 54 VAL n 5 55 LYS n 5 56 GLN n 5 57 ASP n 5 58 LEU n 5 59 VAL n 5 60 SER n 5 61 TYR n 5 62 CYS n 5 63 GLY n 5 64 PRO n 5 65 TRP n 5 66 LYS n 5 67 LEU n 5 68 ASP n 5 69 ALA n 5 70 ALA n 5 71 TRP n 5 72 ASP n 5 73 GLY n 5 74 LEU n 5 75 SER n 5 76 GLU n 5 77 VAL n 5 78 GLN n 5 79 LEU n 5 80 LEU n 5 81 ALA n 5 82 VAL n 5 83 PRO n 5 84 PRO n 5 85 GLY n 5 86 GLU n 5 87 ARG n 5 88 ALA n 5 89 LYS n 5 90 ASN n 5 91 ILE n 5 92 GLN n 5 93 THR n 5 94 LEU n 5 95 PRO n 5 96 GLY n 5 97 ILE n 5 98 PHE n 5 99 LYS n 5 100 THR n 5 101 LYS n 5 102 ASP n 5 103 GLY n 5 104 ASP n 5 105 ILE n 5 106 GLY n 5 107 ALA n 5 108 VAL n 5 109 ALA n 5 110 LEU n 5 111 ASP n 5 112 TYR n 5 113 PRO n 5 114 ALA n 5 115 GLY n 5 116 THR n 5 117 SER n 5 118 GLY n 5 119 SER n 5 120 PRO n 5 121 ILE n 5 122 LEU n 5 123 ASP n 5 124 LYS n 5 125 CYS n 5 126 GLY n 5 127 ARG n 5 128 VAL n 5 129 ILE n 5 130 GLY n 5 131 LEU n 5 132 TYR n 5 133 GLY n 5 134 ASN n 5 135 GLY n 5 136 VAL n 5 137 VAL n 5 138 ILE n 5 139 LYS n 5 140 ASN n 5 141 GLY n 5 142 SER n 5 143 TYR n 5 144 VAL n 5 145 SER n 5 146 ALA n 5 147 ILE n 5 148 THR n 5 149 GLN n 5 150 GLY n 5 151 LYS n 5 152 ARG n 6 1 ASP n 6 2 MET n 6 3 TYR n 6 4 ILE n 6 5 GLU n 6 6 ARG n 6 7 ALA n 6 8 GLY n 6 9 ASP n 6 10 ILE n 6 11 THR n 6 12 TRP n 6 13 GLU n 6 14 LYS n 6 15 ASP n 6 16 ALA n 6 17 GLU n 6 18 VAL n 6 19 THR n 6 20 GLY n 6 21 ASN n 6 22 SER n 6 23 PRO n 6 24 ARG n 6 25 LEU n 6 26 ASP n 6 27 VAL n 6 28 ALA n 6 29 LEU n 6 30 ASP n 6 31 GLU n 6 32 SER n 6 33 GLY n 6 34 ASP n 6 35 PHE n 6 36 SER n 6 37 LEU n 6 38 VAL n 6 39 GLU n 6 40 GLU n 7 1 GLU n 7 2 VAL n 7 3 LYS n 7 4 LYS n 7 5 GLY n 7 6 GLU n 7 7 THR n 7 8 THR n 7 9 ASP n 7 10 GLY n 7 11 VAL n 7 12 TYR n 7 13 ARG n 7 14 VAL n 7 15 MET n 7 16 THR n 7 17 ARG n 7 18 ARG n 7 19 LEU n 7 20 LEU n 7 21 GLY n 7 22 SER n 7 23 THR n 7 24 GLN n 7 25 VAL n 7 26 GLY n 7 27 VAL n 7 28 GLY n 7 29 VAL n 7 30 MET n 7 31 GLN n 7 32 GLU n 7 33 GLY n 7 34 VAL n 7 35 PHE n 7 36 HIS n 7 37 THR n 7 38 MET n 7 39 TRP n 7 40 HIS n 7 41 VAL n 7 42 THR n 7 43 LYS n 7 44 GLY n 7 45 ALA n 7 46 ALA n 7 47 LEU n 7 48 ARG n 7 49 SER n 7 50 GLY n 7 51 GLU n 7 52 GLY n 7 53 ARG n 7 54 LEU n 7 55 ASP n 7 56 PRO n 7 57 TYR n 7 58 TRP n 7 59 GLY n 7 60 ASP n 7 61 VAL n 7 62 LYS n 7 63 GLN n 7 64 ASP n 7 65 LEU n 7 66 VAL n 7 67 SER n 7 68 TYR n 7 69 CYS n 7 70 GLY n 7 71 PRO n 7 72 TRP n 7 73 LYS n 7 74 LEU n 7 75 ASP n 7 76 ALA n 7 77 ALA n 7 78 TRP n 7 79 ASP n 7 80 GLY n 7 81 LEU n 7 82 SER n 7 83 GLU n 7 84 VAL n 7 85 GLN n 7 86 LEU n 7 87 LEU n 7 88 ALA n 7 89 VAL n 7 90 PRO n 7 91 PRO n 7 92 GLY n 7 93 GLU n 7 94 ARG n 7 95 ALA n 7 96 LYS n 7 97 ASN n 7 98 ILE n 7 99 GLN n 7 100 THR n 7 101 LEU n 7 102 PRO n 7 103 GLY n 7 104 ILE n 7 105 PHE n 7 106 LYS n 7 107 THR n 7 108 LYS n 7 109 ASP n 7 110 GLY n 7 111 ASP n 7 112 ILE n 7 113 GLY n 7 114 ALA n 7 115 VAL n 7 116 ALA n 7 117 LEU n 7 118 ASP n 7 119 TYR n 7 120 PRO n 7 121 ALA n 7 122 GLY n 7 123 THR n 7 124 SER n 7 125 GLY n 7 126 SER n 7 127 PRO n 7 128 ILE n 7 129 LEU n 7 130 ASP n 7 131 LYS n 7 132 CYS n 7 133 GLY n 7 134 ARG n 7 135 VAL n 7 136 ILE n 7 137 GLY n 7 138 LEU n 7 139 TYR n 7 140 GLY n 7 141 ASN n 7 142 GLY n 7 143 VAL n 7 144 VAL n 7 145 ILE n 7 146 LYS n 7 147 ASN n 7 148 GLY n 7 149 SER n 7 150 TYR n 7 151 VAL n 7 152 SER n 7 153 ALA n 7 154 ILE n 7 155 THR n 7 156 GLN n 7 157 GLY n 7 158 LYS n 7 159 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 38 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 155 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 sample 'Biological sequence' 1 37 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 sample 'Biological sequence' 1 153 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 sample 'Biological sequence' 1 152 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 sample 'Biological sequence' 1 40 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 sample 'Biological sequence' 1 159 ZIKV ? ? ? ? ? ? ? ? 'Zika virus' 64320 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP POLG_ZIKV Q32ZE1 ? 1 DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV 1418 2 UNP H8XX12_ZIKV H8XX12 ? 2 ;GETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEV QLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; 1512 3 UNP POLG_ZIKV Q32ZE1 ? 3 MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLV 1419 4 UNP H8XX12_ZIKV H8XX12 ? 4 ;TTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQL LAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; 1514 5 UNP H8XX12_ZIKV H8XX12 ? 5 ;TDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLL AVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; 1515 6 UNP POLG_ZIKV Q32ZE1 ? 6 DMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE 1418 7 UNP H8XX12_ZIKV H8XX12 ? 7 ;EVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDG LSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR ; 1508 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6L4Z A 1 ? 38 ? Q32ZE1 1418 ? 1455 ? 50 87 2 2 6L4Z B 1 ? 155 ? H8XX12 1512 ? 1666 ? 16 170 3 3 6L4Z C 1 ? 37 ? Q32ZE1 1419 ? 1455 ? 51 87 4 4 6L4Z D 1 ? 153 ? H8XX12 1514 ? 1666 ? 18 170 5 1 6L4Z E 1 ? 38 ? Q32ZE1 1418 ? 1455 ? 50 87 6 5 6L4Z F 1 ? 152 ? H8XX12 1515 ? 1666 ? 19 170 7 6 6L4Z G 1 ? 40 ? Q32ZE1 1418 ? 1457 ? 50 89 8 7 6L4Z H 1 ? 159 ? H8XX12 1508 ? 1666 ? 12 170 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 E5X non-polymer . '4-(hydroxymethyl)benzoic acid' ? 'C8 H8 O3' 152.147 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6L4Z _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% PEG2000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95370 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95370 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6L4Z _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 45.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 61183 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.35 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.09 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.812 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 1.968 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.69 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 6015 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.27 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 90.310 _refine.B_iso_mean 32.1917 _refine.B_iso_min 13.620 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6L4Z _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9000 _refine.ls_d_res_low 45.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 61146 _refine.ls_number_reflns_R_free 3015 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9400 _refine.ls_percent_reflns_R_free 4.9300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1912 _refine.ls_R_factor_R_free 0.2261 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1798 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 16.740 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5gpi _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.8000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9000 _refine_hist.d_res_low 45.76 _refine_hist.number_atoms_solvent 174 _refine_hist.number_atoms_total 5796 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 761 _refine_hist.pdbx_B_iso_mean_ligand 32.38 _refine_hist.pdbx_B_iso_mean_solvent 31.40 _refine_hist.pdbx_number_atoms_protein 5611 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 440 6.603 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? C 440 6.603 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? E 440 6.603 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? G 440 6.603 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 5 TORSIONAL ? B 1696 6.603 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 6 TORSIONAL ? D 1696 6.603 ? 2 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 7 TORSIONAL ? F 1696 6.603 ? 2 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 8 TORSIONAL ? H 1696 6.603 ? 2 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9004 1.9332 3038 . 156 2882 95.0000 . . . 0.3175 0.0000 0.2845 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 1.9332 1.9683 2980 . 137 2843 95.0000 . . . 0.2928 0.0000 0.2645 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 1.9683 2.0061 3039 . 153 2886 95.0000 . . . 0.2500 0.0000 0.2581 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.0061 2.0470 2982 . 155 2827 95.0000 . . . 0.2743 0.0000 0.2602 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.0470 2.0915 2964 . 143 2821 95.0000 . . . 0.2727 0.0000 0.2607 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.0915 2.1401 3065 . 157 2908 95.0000 . . . 0.2898 0.0000 0.2450 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.1401 2.1935 3021 . 173 2848 94.0000 . . . 0.2893 0.0000 0.2358 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.1935 2.2528 3007 . 140 2867 95.0000 . . . 0.2696 0.0000 0.2314 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.2528 2.3190 3021 . 148 2873 95.0000 . . . 0.2487 0.0000 0.2220 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.3190 2.3937 3035 . 137 2898 95.0000 . . . 0.2546 0.0000 0.2216 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.3937 2.4791 3096 . 154 2942 95.0000 . . . 0.2348 0.0000 0.2270 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.4791 2.5782 2973 . 164 2809 94.0000 . . . 0.2287 0.0000 0.2105 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.5782 2.6952 3078 . 132 2946 96.0000 . . . 0.2620 0.0000 0.2098 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.6952 2.8370 3052 . 149 2903 95.0000 . . . 0.2593 0.0000 0.1952 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 2.8370 3.0142 3013 . 145 2868 95.0000 . . . 0.2215 0.0000 0.1896 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 3.0142 3.2460 3090 . 142 2948 95.0000 . . . 0.1994 0.0000 0.1856 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 3.2460 3.5710 3065 . 156 2909 95.0000 . . . 0.2355 0.0000 0.1778 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 3.5710 4.0840 3114 . 170 2944 95.0000 . . . 0.2322 0.0000 0.1643 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 4.0840 5.1312 3134 . 152 2982 95.0000 . . . 0.1964 0.0000 0.1318 . . . . . . . 20 . . . 'X-RAY DIFFRACTION' 5.1312 20.1033 3285 . 149 3136 95.0000 . . . 0.2144 0.0000 0.1479 . . . . . . . 20 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 '(chain A and (resid 51 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87))' 1 2 ;(chain C and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 3 ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87)) ; 1 4 ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 2 1 ;(chain B and (resid 19 through 27 or resid 34 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 170)) ; 2 2 ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 3 ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 4 ;(chain H and (resid 19 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A MET 2 . A LEU 25 . A MET 51 A LEU 74 ? '(chain A and (resid 51 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87))' 1 1 2 A ASP 26 . A ASP 26 . A ASP 75 A ASP 75 ? '(chain A and (resid 51 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87))' 1 1 3 A ASP 1 . A VAL 38 . A ASP 50 A VAL 87 ? '(chain A and (resid 51 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87))' 1 1 4 A ASP 1 . A VAL 38 . A ASP 50 A VAL 87 ? '(chain A and (resid 51 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87))' 1 1 5 A ASP 1 . A VAL 38 . A ASP 50 A VAL 87 ? '(chain A and (resid 51 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87))' 1 1 6 A ASP 1 . A VAL 38 . A ASP 50 A VAL 87 ? '(chain A and (resid 51 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87))' 1 2 1 C MET 1 . C TRP 11 . C MET 51 C TRP 61 ? ;(chain C and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 2 2 C GLU 12 . C GLU 16 . C GLU 62 C GLU 66 ? ;(chain C and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 2 3 C MET 1 . C VAL 37 . C MET 51 C VAL 87 ? ;(chain C and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 2 4 C MET 1 . C VAL 37 . C MET 51 C VAL 87 ? ;(chain C and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 2 5 C MET 1 . C VAL 37 . C MET 51 C VAL 87 ? ;(chain C and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 2 6 C MET 1 . C VAL 37 . C MET 51 C VAL 87 ? ;(chain C and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 3 1 E MET 2 . E TRP 12 . E MET 51 E TRP 61 ? ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87)) ; 1 3 2 E GLU 13 . E GLU 17 . E GLU 62 E GLU 66 ? ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87)) ; 1 3 3 E ASP 1 . E VAL 38 . E ASP 50 E VAL 87 ? ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87)) ; 1 3 4 E ASP 1 . E VAL 38 . E ASP 50 E VAL 87 ? ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87)) ; 1 3 5 E ASP 1 . E VAL 38 . E ASP 50 E VAL 87 ? ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87)) ; 1 3 6 E ASP 1 . E VAL 38 . E ASP 50 E VAL 87 ? ;(chain E and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 87)) ; 1 4 1 G MET 2 . G TRP 12 . G MET 51 G TRP 61 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 2 G GLU 13 . G GLU 17 . G GLU 62 G GLU 66 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 3 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 4 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 5 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 6 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 7 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 8 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 9 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 10 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 1 4 11 G ASP 1 . G GLU 40 . G ASP 50 G GLU 89 ? ;(chain G and (resid 51 through 61 or (resid 62 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 74 or (resid 75 and (name N or name CA or name C or name O or name CB )) or resid 76 through 87)) ; 2 1 1 B THR 4 . B THR 12 . B THR 19 B THR 27 ? ;(chain B and (resid 19 through 27 or resid 34 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 170)) ; 2 1 2 B THR 19 . B LEU 43 . B THR 34 B LEU 58 ? ;(chain B and (resid 19 through 27 or resid 34 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 170)) ; 2 1 3 B ARG 44 . B ARG 44 . B ARG 59 B ARG 59 ? ;(chain B and (resid 19 through 27 or resid 34 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 170)) ; 2 1 4 B GLY 1 . B ARG 155 . B GLY 16 B ARG 170 ? ;(chain B and (resid 19 through 27 or resid 34 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 170)) ; 2 1 5 B GLY 1 . B ARG 155 . B GLY 16 B ARG 170 ? ;(chain B and (resid 19 through 27 or resid 34 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 170)) ; 2 1 6 B GLY 1 . B ARG 155 . B GLY 16 B ARG 170 ? ;(chain B and (resid 19 through 27 or resid 34 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 170)) ; 2 1 7 B GLY 1 . B ARG 155 . B GLY 16 B ARG 170 ? ;(chain B and (resid 19 through 27 or resid 34 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 170)) ; 2 2 1 D THR 2 . D THR 10 . D THR 19 D THR 27 ? ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 2 2 D THR 17 . D GLY 86 . D THR 34 D GLY 103 ? ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 2 3 D GLU 87 . D ALA 89 . D GLU 104 D ALA 106 ? ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 2 4 D THR 1 . D ARG 153 . D THR 18 D ARG 170 ? ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 2 5 D THR 1 . D ARG 153 . D THR 18 D ARG 170 ? ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 2 6 D THR 1 . D ARG 153 . D THR 18 D ARG 170 ? ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 2 7 D THR 1 . D ARG 153 . D THR 18 D ARG 170 ? ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 2 8 D THR 1 . D ARG 153 . D THR 18 D ARG 170 ? ;(chain D and (resid 19 through 27 or resid 34 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 170)) ; 2 3 1 F THR 1 . F THR 9 . F THR 19 F THR 27 ? ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 3 2 F THR 16 . F GLU 86 . F THR 34 F GLU 104 ? ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 3 3 F ARG 87 . F ALA 88 . F ARG 105 F ALA 106 ? ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 3 4 F THR 1 . F ARG 152 . F THR 19 F ARG 170 ? ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 3 5 F THR 1 . F ARG 152 . F THR 19 F ARG 170 ? ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 3 6 F THR 1 . F ARG 152 . F THR 19 F ARG 170 ? ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 3 7 F THR 1 . F ARG 152 . F THR 19 F ARG 170 ? ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 3 8 F THR 1 . F ARG 152 . F THR 19 F ARG 170 ? ;(chain F and (resid 19 through 27 or resid 34 through 104 or (resid 105 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 4 1 H THR 8 . H LEU 47 . H THR 19 H LEU 58 ? ;(chain H and (resid 19 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 4 2 H ARG 48 . H ARG 48 . H ARG 59 H ARG 59 ? ;(chain H and (resid 19 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 4 3 H GLU 1 . H ARG 159 . H GLU 12 H ARG 170 ? ;(chain H and (resid 19 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 4 4 H GLU 1 . H ARG 159 . H GLU 12 H ARG 170 ? ;(chain H and (resid 19 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 4 5 H GLU 1 . H ARG 159 . H GLU 12 H ARG 170 ? ;(chain H and (resid 19 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; 2 4 6 H GLU 1 . H ARG 159 . H GLU 12 H ARG 170 ? ;(chain H and (resid 19 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 103 or (resid 104 through 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 108 or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 134 or resid 136 through 156 or (resid 157 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 168 or (resid 169 and (name N or name CA or name C or name O or name CB )) or resid 170)) ; # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 6L4Z _struct.title 'Crystal structure of Zika NS2B-NS3 protease with compound 6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6L4Z _struct_keywords.text 'Viral protease, Protease inhibitor complex, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 1 ? F N N 5 ? G N N 6 ? H N N 7 ? I N N 8 ? J N N 9 ? K N N 9 ? L N N 9 ? M N N 9 ? N N N 9 ? O N N 9 ? P N N 9 ? Q N N 9 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET B 34 ? LYS B 39 ? MET B 49 LYS B 54 1 ? 6 HELX_P HELX_P2 AA2 MET D 32 ? LYS D 37 ? MET D 49 LYS D 54 1 ? 6 HELX_P HELX_P3 AA3 MET F 31 ? LYS F 36 ? MET F 49 LYS F 54 1 ? 6 HELX_P HELX_P4 AA4 MET H 38 ? LYS H 43 ? MET H 49 LYS H 54 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 14 ? AA2 ? 5 ? AA3 ? 6 ? AA4 ? 5 ? AA5 ? 6 ? AA6 ? 2 ? AA7 ? 8 ? AA8 ? 6 ? AA9 ? 4 ? AB1 ? 8 ? AB2 ? 5 ? AB3 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel AA1 13 14 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel AA5 5 6 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? parallel AA7 3 4 ? anti-parallel AA7 4 5 ? anti-parallel AA7 5 6 ? anti-parallel AA7 6 7 ? anti-parallel AA7 7 8 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? parallel AA8 3 4 ? anti-parallel AA8 4 5 ? anti-parallel AA8 5 6 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AA9 3 4 ? anti-parallel AB1 1 2 ? anti-parallel AB1 2 3 ? parallel AB1 3 4 ? anti-parallel AB1 4 5 ? anti-parallel AB1 5 6 ? anti-parallel AB1 6 7 ? anti-parallel AB1 7 8 ? anti-parallel AB2 1 2 ? parallel AB2 2 3 ? anti-parallel AB2 3 4 ? anti-parallel AB2 4 5 ? anti-parallel AB3 1 2 ? anti-parallel AB3 2 3 ? parallel AB3 3 4 ? anti-parallel AB3 4 5 ? anti-parallel AB3 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY B 48 ? LEU B 50 ? GLY B 63 LEU B 65 AA1 2 LEU B 43 ? SER B 45 ? LEU B 58 SER B 60 AA1 3 MET A 2 ? GLY A 8 ? MET A 51 GLY A 57 AA1 4 GLY B 6 ? ARG B 13 ? GLY B 21 ARG B 28 AA1 5 SER B 18 ? GLN B 27 ? SER B 33 GLN B 42 AA1 6 VAL B 30 ? THR B 33 ? VAL B 45 THR B 48 AA1 7 LEU B 61 ? TYR B 64 ? LEU B 76 TYR B 79 AA1 8 PRO B 52 ? ASP B 56 ? PRO B 67 ASP B 71 AA1 9 PRO D 50 ? ASP D 54 ? PRO D 67 ASP D 71 AA1 10 LEU D 59 ? TYR D 62 ? LEU D 76 TYR D 79 AA1 11 VAL D 28 ? THR D 31 ? VAL D 45 THR D 48 AA1 12 GLN D 18 ? GLN D 25 ? GLN D 35 GLN D 42 AA1 13 GLY D 4 ? MET D 9 ? GLY D 21 MET D 26 AA1 14 TYR C 2 ? GLY C 7 ? TYR C 52 GLY C 57 AA2 1 GLU A 17 ? VAL A 18 ? GLU A 66 VAL A 67 AA2 2 LYS B 92 ? THR B 96 ? LYS B 107 THR B 111 AA2 3 VAL B 80 ? ALA B 84 ? VAL B 95 ALA B 99 AA2 4 SER B 122 ? LEU B 125 ? SER B 137 LEU B 140 AA2 5 VAL B 131 ? TYR B 135 ? VAL B 146 TYR B 150 AA3 1 PHE A 35 ? LEU A 37 ? PHE A 84 LEU A 86 AA3 2 ARG A 24 ? LEU A 29 ? ARG A 73 LEU A 78 AA3 3 GLY B 99 ? THR B 103 ? GLY B 114 THR B 118 AA3 4 GLY B 106 ? VAL B 111 ? GLY B 121 VAL B 126 AA3 5 TYR B 146 ? ALA B 149 ? TYR B 161 ALA B 164 AA3 6 GLY B 138 ? VAL B 140 ? GLY B 153 VAL B 155 AA4 1 GLU C 16 ? VAL C 17 ? GLU C 66 VAL C 67 AA4 2 LYS D 90 ? THR D 94 ? LYS D 107 THR D 111 AA4 3 VAL D 78 ? ALA D 82 ? VAL D 95 ALA D 99 AA4 4 SER D 120 ? LEU D 123 ? SER D 137 LEU D 140 AA4 5 VAL D 129 ? TYR D 133 ? VAL D 146 TYR D 150 AA5 1 PHE C 34 ? LEU C 36 ? PHE C 84 LEU C 86 AA5 2 ARG C 23 ? LEU C 28 ? ARG C 73 LEU C 78 AA5 3 GLY D 97 ? THR D 101 ? GLY D 114 THR D 118 AA5 4 GLY D 104 ? VAL D 109 ? GLY D 121 VAL D 126 AA5 5 TYR D 144 ? ALA D 147 ? TYR D 161 ALA D 164 AA5 6 GLY D 136 ? VAL D 138 ? GLY D 153 VAL D 155 AA6 1 LEU D 41 ? SER D 43 ? LEU D 58 SER D 60 AA6 2 GLY D 46 ? LEU D 48 ? GLY D 63 LEU D 65 AA7 1 GLY F 45 ? LEU F 47 ? GLY F 63 LEU F 65 AA7 2 LEU F 40 ? SER F 42 ? LEU F 58 SER F 60 AA7 3 MET E 2 ? GLY E 8 ? MET E 51 GLY E 57 AA7 4 GLY F 3 ? THR F 9 ? GLY F 21 THR F 27 AA7 5 THR F 16 ? GLN F 24 ? THR F 34 GLN F 42 AA7 6 VAL F 27 ? THR F 30 ? VAL F 45 THR F 48 AA7 7 LEU F 58 ? TYR F 61 ? LEU F 76 TYR F 79 AA7 8 PRO F 49 ? ASP F 53 ? PRO F 67 ASP F 71 AA8 1 PHE E 35 ? LEU E 37 ? PHE E 84 LEU E 86 AA8 2 ARG E 24 ? LEU E 29 ? ARG E 73 LEU E 78 AA8 3 GLY F 96 ? THR F 100 ? GLY F 114 THR F 118 AA8 4 GLY F 103 ? VAL F 108 ? GLY F 121 VAL F 126 AA8 5 TYR F 143 ? ALA F 146 ? TYR F 161 ALA F 164 AA8 6 GLY F 135 ? VAL F 137 ? GLY F 153 VAL F 155 AA9 1 LYS F 89 ? THR F 93 ? LYS F 107 THR F 111 AA9 2 VAL F 77 ? ALA F 81 ? VAL F 95 ALA F 99 AA9 3 SER F 119 ? LEU F 122 ? SER F 137 LEU F 140 AA9 4 VAL F 128 ? TYR F 132 ? VAL F 146 TYR F 150 AB1 1 GLY H 52 ? LEU H 54 ? GLY H 63 LEU H 65 AB1 2 LEU H 47 ? SER H 49 ? LEU H 58 SER H 60 AB1 3 MET G 2 ? GLY G 8 ? MET G 51 GLY G 57 AB1 4 GLY H 10 ? MET H 15 ? GLY H 21 MET H 26 AB1 5 GLY H 26 ? GLN H 31 ? GLY H 37 GLN H 42 AB1 6 VAL H 34 ? THR H 37 ? VAL H 45 THR H 48 AB1 7 LEU H 65 ? TYR H 68 ? LEU H 76 TYR H 79 AB1 8 PRO H 56 ? ASP H 60 ? PRO H 67 ASP H 71 AB2 1 GLU G 17 ? VAL G 18 ? GLU G 66 VAL G 67 AB2 2 LYS H 96 ? THR H 100 ? LYS H 107 THR H 111 AB2 3 VAL H 84 ? ALA H 88 ? VAL H 95 ALA H 99 AB2 4 SER H 126 ? LEU H 129 ? SER H 137 LEU H 140 AB2 5 VAL H 135 ? TYR H 139 ? VAL H 146 TYR H 150 AB3 1 PHE G 35 ? LEU G 37 ? PHE G 84 LEU G 86 AB3 2 ARG G 24 ? LEU G 29 ? ARG G 73 LEU G 78 AB3 3 GLY H 103 ? THR H 107 ? GLY H 114 THR H 118 AB3 4 GLY H 110 ? VAL H 115 ? GLY H 121 VAL H 126 AB3 5 TYR H 150 ? ALA H 153 ? TYR H 161 ALA H 164 AB3 6 GLY H 142 ? VAL H 144 ? GLY H 153 VAL H 155 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU B 50 ? O LEU B 65 N LEU B 43 ? N LEU B 58 AA1 2 3 O ARG B 44 ? O ARG B 59 N ILE A 4 ? N ILE A 53 AA1 3 4 N ALA A 7 ? N ALA A 56 O VAL B 7 ? O VAL B 22 AA1 4 5 N VAL B 10 ? N VAL B 25 O GLY B 22 ? O GLY B 37 AA1 5 6 N VAL B 25 ? N VAL B 40 O HIS B 32 ? O HIS B 47 AA1 6 7 N PHE B 31 ? N PHE B 46 O TYR B 64 ? O TYR B 79 AA1 7 8 O SER B 63 ? O SER B 78 N TYR B 53 ? N TYR B 68 AA1 8 9 N GLY B 55 ? N GLY B 70 O GLY D 53 ? O GLY D 70 AA1 9 10 N TRP D 52 ? N TRP D 69 O SER D 61 ? O SER D 78 AA1 10 11 O TYR D 62 ? O TYR D 79 N PHE D 29 ? N PHE D 46 AA1 11 12 O HIS D 30 ? O HIS D 47 N VAL D 23 ? N VAL D 40 AA1 12 13 O GLY D 20 ? O GLY D 37 N VAL D 8 ? N VAL D 25 AA1 13 14 O VAL D 5 ? O VAL D 22 N ALA C 6 ? N ALA C 56 AA2 1 2 N GLU A 17 ? N GLU A 66 O GLN B 95 ? O GLN B 110 AA2 2 3 O THR B 96 ? O THR B 111 N VAL B 80 ? N VAL B 95 AA2 3 4 N GLN B 81 ? N GLN B 96 O LEU B 125 ? O LEU B 140 AA2 4 5 N ILE B 124 ? N ILE B 139 O ILE B 132 ? O ILE B 147 AA3 1 2 O SER A 36 ? O SER A 85 N ALA A 28 ? N ALA A 77 AA3 2 3 N LEU A 25 ? N LEU A 74 O LYS B 102 ? O LYS B 117 AA3 3 4 N PHE B 101 ? N PHE B 116 O ILE B 108 ? O ILE B 123 AA3 4 5 N VAL B 111 ? N VAL B 126 O SER B 148 ? O SER B 163 AA3 5 6 O VAL B 147 ? O VAL B 162 N VAL B 139 ? N VAL B 154 AA4 1 2 N GLU C 16 ? N GLU C 66 O GLN D 93 ? O GLN D 110 AA4 2 3 O THR D 94 ? O THR D 111 N VAL D 78 ? N VAL D 95 AA4 3 4 N GLN D 79 ? N GLN D 96 O LEU D 123 ? O LEU D 140 AA4 4 5 N ILE D 122 ? N ILE D 139 O ILE D 130 ? O ILE D 147 AA5 1 2 O SER C 35 ? O SER C 85 N ALA C 27 ? N ALA C 77 AA5 2 3 N LEU C 24 ? N LEU C 74 O ILE D 98 ? O ILE D 115 AA5 3 4 N GLY D 97 ? N GLY D 114 O ALA D 108 ? O ALA D 125 AA5 4 5 N VAL D 109 ? N VAL D 126 O SER D 146 ? O SER D 163 AA5 5 6 O VAL D 145 ? O VAL D 162 N VAL D 137 ? N VAL D 154 AA6 1 2 N LEU D 41 ? N LEU D 58 O LEU D 48 ? O LEU D 65 AA7 1 2 O GLY F 45 ? O GLY F 63 N SER F 42 ? N SER F 60 AA7 2 3 O ARG F 41 ? O ARG F 59 N ILE E 4 ? N ILE E 53 AA7 3 4 N TYR E 3 ? N TYR E 52 O MET F 8 ? O MET F 26 AA7 4 5 N VAL F 7 ? N VAL F 25 O GLY F 19 ? O GLY F 37 AA7 5 6 N VAL F 22 ? N VAL F 40 O HIS F 29 ? O HIS F 47 AA7 6 7 N PHE F 28 ? N PHE F 46 O TYR F 61 ? O TYR F 79 AA7 7 8 O SER F 60 ? O SER F 78 N TRP F 51 ? N TRP F 69 AA8 1 2 O SER E 36 ? O SER E 85 N ALA E 28 ? N ALA E 77 AA8 2 3 N LEU E 25 ? N LEU E 74 O ILE F 97 ? O ILE F 115 AA8 3 4 N GLY F 96 ? N GLY F 114 O ALA F 107 ? O ALA F 125 AA8 4 5 N VAL F 108 ? N VAL F 126 O SER F 145 ? O SER F 163 AA8 5 6 O VAL F 144 ? O VAL F 162 N VAL F 136 ? N VAL F 154 AA9 1 2 O ILE F 91 ? O ILE F 109 N LEU F 79 ? N LEU F 97 AA9 2 3 N GLN F 78 ? N GLN F 96 O LEU F 122 ? O LEU F 140 AA9 3 4 N ILE F 121 ? N ILE F 139 O ILE F 129 ? O ILE F 147 AB1 1 2 O LEU H 54 ? O LEU H 65 N LEU H 47 ? N LEU H 58 AB1 2 3 O ARG H 48 ? O ARG H 59 N ILE G 4 ? N ILE G 53 AB1 3 4 N TYR G 3 ? N TYR G 52 O MET H 15 ? O MET H 26 AB1 4 5 N GLY H 10 ? N GLY H 21 O MET H 30 ? O MET H 41 AB1 5 6 N VAL H 29 ? N VAL H 40 O HIS H 36 ? O HIS H 47 AB1 6 7 N PHE H 35 ? N PHE H 46 O TYR H 68 ? O TYR H 79 AB1 7 8 O SER H 67 ? O SER H 78 N TRP H 58 ? N TRP H 69 AB2 1 2 N GLU G 17 ? N GLU G 66 O GLN H 99 ? O GLN H 110 AB2 2 3 O THR H 100 ? O THR H 111 N VAL H 84 ? N VAL H 95 AB2 3 4 N GLN H 85 ? N GLN H 96 O LEU H 129 ? O LEU H 140 AB2 4 5 N ILE H 128 ? N ILE H 139 O ILE H 136 ? O ILE H 147 AB3 1 2 O SER G 36 ? O SER G 85 N ALA G 28 ? N ALA G 77 AB3 2 3 N LEU G 25 ? N LEU G 74 O LYS H 106 ? O LYS H 117 AB3 3 4 N GLY H 103 ? N GLY H 114 O ALA H 114 ? O ALA H 125 AB3 4 5 N VAL H 115 ? N VAL H 126 O SER H 152 ? O SER H 163 AB3 5 6 O VAL H 151 ? O VAL H 162 N VAL H 143 ? N VAL H 154 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id H _struct_site.pdbx_auth_comp_id E5X _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'binding site for residue E5X H 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 GLU B 89 ? GLU B 104 . ? 3_645 ? 2 AC1 8 ASP H 118 ? ASP H 129 . ? 1_555 ? 3 AC1 8 TYR H 119 ? TYR H 130 . ? 1_555 ? 4 AC1 8 ALA H 121 ? ALA H 132 . ? 1_555 ? 5 AC1 8 SER H 124 ? SER H 135 . ? 1_555 ? 6 AC1 8 GLY H 140 ? GLY H 151 . ? 1_555 ? 7 AC1 8 TYR H 150 ? TYR H 161 . ? 1_555 ? 8 AC1 8 HOH Q . ? HOH H 325 . ? 1_555 ? # _atom_sites.entry_id 6L4Z _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016793 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016800 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004661 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 50 50 ASP ASP A . n A 1 2 MET 2 51 51 MET MET A . n A 1 3 TYR 3 52 52 TYR TYR A . n A 1 4 ILE 4 53 53 ILE ILE A . n A 1 5 GLU 5 54 54 GLU GLU A . n A 1 6 ARG 6 55 55 ARG ARG A . n A 1 7 ALA 7 56 56 ALA ALA A . n A 1 8 GLY 8 57 57 GLY GLY A . n A 1 9 ASP 9 58 58 ASP ASP A . n A 1 10 ILE 10 59 59 ILE ILE A . n A 1 11 THR 11 60 60 THR THR A . n A 1 12 TRP 12 61 61 TRP TRP A . n A 1 13 GLU 13 62 62 GLU GLU A . n A 1 14 LYS 14 63 63 LYS LYS A . n A 1 15 ASP 15 64 64 ASP ASP A . n A 1 16 ALA 16 65 65 ALA ALA A . n A 1 17 GLU 17 66 66 GLU GLU A . n A 1 18 VAL 18 67 67 VAL VAL A . n A 1 19 THR 19 68 68 THR THR A . n A 1 20 GLY 20 69 69 GLY GLY A . n A 1 21 ASN 21 70 70 ASN ASN A . n A 1 22 SER 22 71 71 SER SER A . n A 1 23 PRO 23 72 72 PRO PRO A . n A 1 24 ARG 24 73 73 ARG ARG A . n A 1 25 LEU 25 74 74 LEU LEU A . n A 1 26 ASP 26 75 75 ASP ASP A . n A 1 27 VAL 27 76 76 VAL VAL A . n A 1 28 ALA 28 77 77 ALA ALA A . n A 1 29 LEU 29 78 78 LEU LEU A . n A 1 30 ASP 30 79 79 ASP ASP A . n A 1 31 GLU 31 80 80 GLU GLU A . n A 1 32 SER 32 81 81 SER SER A . n A 1 33 GLY 33 82 82 GLY GLY A . n A 1 34 ASP 34 83 83 ASP ASP A . n A 1 35 PHE 35 84 84 PHE PHE A . n A 1 36 SER 36 85 85 SER SER A . n A 1 37 LEU 37 86 86 LEU LEU A . n A 1 38 VAL 38 87 87 VAL VAL A . n B 2 1 GLY 1 16 16 GLY GLY B . n B 2 2 GLU 2 17 17 GLU GLU B . n B 2 3 THR 3 18 18 THR THR B . n B 2 4 THR 4 19 19 THR THR B . n B 2 5 ASP 5 20 20 ASP ASP B . n B 2 6 GLY 6 21 21 GLY GLY B . n B 2 7 VAL 7 22 22 VAL VAL B . n B 2 8 TYR 8 23 23 TYR TYR B . n B 2 9 ARG 9 24 24 ARG ARG B . n B 2 10 VAL 10 25 25 VAL VAL B . n B 2 11 MET 11 26 26 MET MET B . n B 2 12 THR 12 27 27 THR THR B . n B 2 13 ARG 13 28 28 ARG ARG B . n B 2 14 ARG 14 29 29 ARG ARG B . n B 2 15 LEU 15 30 30 LEU LEU B . n B 2 16 LEU 16 31 31 LEU LEU B . n B 2 17 GLY 17 32 32 GLY GLY B . n B 2 18 SER 18 33 33 SER SER B . n B 2 19 THR 19 34 34 THR THR B . n B 2 20 GLN 20 35 35 GLN GLN B . n B 2 21 VAL 21 36 36 VAL VAL B . n B 2 22 GLY 22 37 37 GLY GLY B . n B 2 23 VAL 23 38 38 VAL VAL B . n B 2 24 GLY 24 39 39 GLY GLY B . n B 2 25 VAL 25 40 40 VAL VAL B . n B 2 26 MET 26 41 41 MET MET B . n B 2 27 GLN 27 42 42 GLN GLN B . n B 2 28 GLU 28 43 43 GLU GLU B . n B 2 29 GLY 29 44 44 GLY GLY B . n B 2 30 VAL 30 45 45 VAL VAL B . n B 2 31 PHE 31 46 46 PHE PHE B . n B 2 32 HIS 32 47 47 HIS HIS B . n B 2 33 THR 33 48 48 THR THR B . n B 2 34 MET 34 49 49 MET MET B . n B 2 35 TRP 35 50 50 TRP TRP B . n B 2 36 HIS 36 51 51 HIS HIS B . n B 2 37 VAL 37 52 52 VAL VAL B . n B 2 38 THR 38 53 53 THR THR B . n B 2 39 LYS 39 54 54 LYS LYS B . n B 2 40 GLY 40 55 55 GLY GLY B . n B 2 41 ALA 41 56 56 ALA ALA B . n B 2 42 ALA 42 57 57 ALA ALA B . n B 2 43 LEU 43 58 58 LEU LEU B . n B 2 44 ARG 44 59 59 ARG ARG B . n B 2 45 SER 45 60 60 SER SER B . n B 2 46 GLY 46 61 61 GLY GLY B . n B 2 47 GLU 47 62 62 GLU GLU B . n B 2 48 GLY 48 63 63 GLY GLY B . n B 2 49 ARG 49 64 64 ARG ARG B . n B 2 50 LEU 50 65 65 LEU LEU B . n B 2 51 ASP 51 66 66 ASP ASP B . n B 2 52 PRO 52 67 67 PRO PRO B . n B 2 53 TYR 53 68 68 TYR TYR B . n B 2 54 TRP 54 69 69 TRP TRP B . n B 2 55 GLY 55 70 70 GLY GLY B . n B 2 56 ASP 56 71 71 ASP ASP B . n B 2 57 VAL 57 72 72 VAL VAL B . n B 2 58 LYS 58 73 73 LYS LYS B . n B 2 59 GLN 59 74 74 GLN GLN B . n B 2 60 ASP 60 75 75 ASP ASP B . n B 2 61 LEU 61 76 76 LEU LEU B . n B 2 62 VAL 62 77 77 VAL VAL B . n B 2 63 SER 63 78 78 SER SER B . n B 2 64 TYR 64 79 79 TYR TYR B . n B 2 65 CYS 65 80 80 CYS CYS B . n B 2 66 GLY 66 81 81 GLY GLY B . n B 2 67 PRO 67 82 82 PRO PRO B . n B 2 68 TRP 68 83 83 TRP TRP B . n B 2 69 LYS 69 84 84 LYS LYS B . n B 2 70 LEU 70 85 85 LEU LEU B . n B 2 71 ASP 71 86 86 ASP ASP B . n B 2 72 ALA 72 87 87 ALA ALA B . n B 2 73 ALA 73 88 88 ALA ALA B . n B 2 74 TRP 74 89 89 TRP TRP B . n B 2 75 ASP 75 90 90 ASP ASP B . n B 2 76 GLY 76 91 91 GLY GLY B . n B 2 77 LEU 77 92 92 LEU LEU B . n B 2 78 SER 78 93 93 SER SER B . n B 2 79 GLU 79 94 94 GLU GLU B . n B 2 80 VAL 80 95 95 VAL VAL B . n B 2 81 GLN 81 96 96 GLN GLN B . n B 2 82 LEU 82 97 97 LEU LEU B . n B 2 83 LEU 83 98 98 LEU LEU B . n B 2 84 ALA 84 99 99 ALA ALA B . n B 2 85 VAL 85 100 100 VAL VAL B . n B 2 86 PRO 86 101 101 PRO PRO B . n B 2 87 PRO 87 102 102 PRO PRO B . n B 2 88 GLY 88 103 103 GLY GLY B . n B 2 89 GLU 89 104 104 GLU GLU B . n B 2 90 ARG 90 105 105 ARG ARG B . n B 2 91 ALA 91 106 106 ALA ALA B . n B 2 92 LYS 92 107 107 LYS LYS B . n B 2 93 ASN 93 108 108 ASN ASN B . n B 2 94 ILE 94 109 109 ILE ILE B . n B 2 95 GLN 95 110 110 GLN GLN B . n B 2 96 THR 96 111 111 THR THR B . n B 2 97 LEU 97 112 112 LEU LEU B . n B 2 98 PRO 98 113 113 PRO PRO B . n B 2 99 GLY 99 114 114 GLY GLY B . n B 2 100 ILE 100 115 115 ILE ILE B . n B 2 101 PHE 101 116 116 PHE PHE B . n B 2 102 LYS 102 117 117 LYS LYS B . n B 2 103 THR 103 118 118 THR THR B . n B 2 104 LYS 104 119 119 LYS LYS B . n B 2 105 ASP 105 120 120 ASP ASP B . n B 2 106 GLY 106 121 121 GLY GLY B . n B 2 107 ASP 107 122 122 ASP ASP B . n B 2 108 ILE 108 123 123 ILE ILE B . n B 2 109 GLY 109 124 124 GLY GLY B . n B 2 110 ALA 110 125 125 ALA ALA B . n B 2 111 VAL 111 126 126 VAL VAL B . n B 2 112 ALA 112 127 127 ALA ALA B . n B 2 113 LEU 113 128 128 LEU LEU B . n B 2 114 ASP 114 129 129 ASP ASP B . n B 2 115 TYR 115 130 130 TYR TYR B . n B 2 116 PRO 116 131 131 PRO PRO B . n B 2 117 ALA 117 132 132 ALA ALA B . n B 2 118 GLY 118 133 133 GLY GLY B . n B 2 119 THR 119 134 134 THR THR B . n B 2 120 SER 120 135 135 SER SER B . n B 2 121 GLY 121 136 136 GLY GLY B . n B 2 122 SER 122 137 137 SER SER B . n B 2 123 PRO 123 138 138 PRO PRO B . n B 2 124 ILE 124 139 139 ILE ILE B . n B 2 125 LEU 125 140 140 LEU LEU B . n B 2 126 ASP 126 141 141 ASP ASP B . n B 2 127 LYS 127 142 142 LYS LYS B . n B 2 128 CYS 128 143 143 CYS CYS B . n B 2 129 GLY 129 144 144 GLY GLY B . n B 2 130 ARG 130 145 145 ARG ARG B . n B 2 131 VAL 131 146 146 VAL VAL B . n B 2 132 ILE 132 147 147 ILE ILE B . n B 2 133 GLY 133 148 148 GLY GLY B . n B 2 134 LEU 134 149 149 LEU LEU B . n B 2 135 TYR 135 150 150 TYR TYR B . n B 2 136 GLY 136 151 151 GLY GLY B . n B 2 137 ASN 137 152 152 ASN ASN B . n B 2 138 GLY 138 153 153 GLY GLY B . n B 2 139 VAL 139 154 154 VAL VAL B . n B 2 140 VAL 140 155 155 VAL VAL B . n B 2 141 ILE 141 156 156 ILE ILE B . n B 2 142 LYS 142 157 157 LYS LYS B . n B 2 143 ASN 143 158 158 ASN ASN B . n B 2 144 GLY 144 159 159 GLY GLY B . n B 2 145 SER 145 160 160 SER SER B . n B 2 146 TYR 146 161 161 TYR TYR B . n B 2 147 VAL 147 162 162 VAL VAL B . n B 2 148 SER 148 163 163 SER SER B . n B 2 149 ALA 149 164 164 ALA ALA B . n B 2 150 ILE 150 165 165 ILE ILE B . n B 2 151 THR 151 166 166 THR THR B . n B 2 152 GLN 152 167 167 GLN GLN B . n B 2 153 GLY 153 168 168 GLY GLY B . n B 2 154 LYS 154 169 169 LYS LYS B . n B 2 155 ARG 155 170 170 ARG ARG B . n C 3 1 MET 1 51 51 MET MET C . n C 3 2 TYR 2 52 52 TYR TYR C . n C 3 3 ILE 3 53 53 ILE ILE C . n C 3 4 GLU 4 54 54 GLU GLU C . n C 3 5 ARG 5 55 55 ARG ARG C . n C 3 6 ALA 6 56 56 ALA ALA C . n C 3 7 GLY 7 57 57 GLY GLY C . n C 3 8 ASP 8 58 58 ASP ASP C . n C 3 9 ILE 9 59 59 ILE ILE C . n C 3 10 THR 10 60 60 THR THR C . n C 3 11 TRP 11 61 61 TRP TRP C . n C 3 12 GLU 12 62 62 GLU GLU C . n C 3 13 LYS 13 63 63 LYS LYS C . n C 3 14 ASP 14 64 64 ASP ASP C . n C 3 15 ALA 15 65 65 ALA ALA C . n C 3 16 GLU 16 66 66 GLU GLU C . n C 3 17 VAL 17 67 67 VAL VAL C . n C 3 18 THR 18 68 68 THR THR C . n C 3 19 GLY 19 69 69 GLY GLY C . n C 3 20 ASN 20 70 70 ASN ASN C . n C 3 21 SER 21 71 71 SER SER C . n C 3 22 PRO 22 72 72 PRO PRO C . n C 3 23 ARG 23 73 73 ARG ARG C . n C 3 24 LEU 24 74 74 LEU LEU C . n C 3 25 ASP 25 75 75 ASP ASP C . n C 3 26 VAL 26 76 76 VAL VAL C . n C 3 27 ALA 27 77 77 ALA ALA C . n C 3 28 LEU 28 78 78 LEU LEU C . n C 3 29 ASP 29 79 79 ASP ASP C . n C 3 30 GLU 30 80 80 GLU GLU C . n C 3 31 SER 31 81 81 SER SER C . n C 3 32 GLY 32 82 82 GLY GLY C . n C 3 33 ASP 33 83 83 ASP ASP C . n C 3 34 PHE 34 84 84 PHE PHE C . n C 3 35 SER 35 85 85 SER SER C . n C 3 36 LEU 36 86 86 LEU LEU C . n C 3 37 VAL 37 87 87 VAL VAL C . n D 4 1 THR 1 18 18 THR THR D . n D 4 2 THR 2 19 19 THR THR D . n D 4 3 ASP 3 20 20 ASP ASP D . n D 4 4 GLY 4 21 21 GLY GLY D . n D 4 5 VAL 5 22 22 VAL VAL D . n D 4 6 TYR 6 23 23 TYR TYR D . n D 4 7 ARG 7 24 24 ARG ARG D . n D 4 8 VAL 8 25 25 VAL VAL D . n D 4 9 MET 9 26 26 MET MET D . n D 4 10 THR 10 27 27 THR THR D . n D 4 11 ARG 11 28 ? ? ? D . n D 4 12 ARG 12 29 ? ? ? D . n D 4 13 LEU 13 30 ? ? ? D . n D 4 14 LEU 14 31 ? ? ? D . n D 4 15 GLY 15 32 ? ? ? D . n D 4 16 SER 16 33 33 SER SER D . n D 4 17 THR 17 34 34 THR THR D . n D 4 18 GLN 18 35 35 GLN GLN D . n D 4 19 VAL 19 36 36 VAL VAL D . n D 4 20 GLY 20 37 37 GLY GLY D . n D 4 21 VAL 21 38 38 VAL VAL D . n D 4 22 GLY 22 39 39 GLY GLY D . n D 4 23 VAL 23 40 40 VAL VAL D . n D 4 24 MET 24 41 41 MET MET D . n D 4 25 GLN 25 42 42 GLN GLN D . n D 4 26 GLU 26 43 43 GLU GLU D . n D 4 27 GLY 27 44 44 GLY GLY D . n D 4 28 VAL 28 45 45 VAL VAL D . n D 4 29 PHE 29 46 46 PHE PHE D . n D 4 30 HIS 30 47 47 HIS HIS D . n D 4 31 THR 31 48 48 THR THR D . n D 4 32 MET 32 49 49 MET MET D . n D 4 33 TRP 33 50 50 TRP TRP D . n D 4 34 HIS 34 51 51 HIS HIS D . n D 4 35 VAL 35 52 52 VAL VAL D . n D 4 36 THR 36 53 53 THR THR D . n D 4 37 LYS 37 54 54 LYS LYS D . n D 4 38 GLY 38 55 55 GLY GLY D . n D 4 39 ALA 39 56 56 ALA ALA D . n D 4 40 ALA 40 57 57 ALA ALA D . n D 4 41 LEU 41 58 58 LEU LEU D . n D 4 42 ARG 42 59 59 ARG ARG D . n D 4 43 SER 43 60 60 SER SER D . n D 4 44 GLY 44 61 61 GLY GLY D . n D 4 45 GLU 45 62 62 GLU GLU D . n D 4 46 GLY 46 63 63 GLY GLY D . n D 4 47 ARG 47 64 64 ARG ARG D . n D 4 48 LEU 48 65 65 LEU LEU D . n D 4 49 ASP 49 66 66 ASP ASP D . n D 4 50 PRO 50 67 67 PRO PRO D . n D 4 51 TYR 51 68 68 TYR TYR D . n D 4 52 TRP 52 69 69 TRP TRP D . n D 4 53 GLY 53 70 70 GLY GLY D . n D 4 54 ASP 54 71 71 ASP ASP D . n D 4 55 VAL 55 72 72 VAL VAL D . n D 4 56 LYS 56 73 73 LYS LYS D . n D 4 57 GLN 57 74 74 GLN GLN D . n D 4 58 ASP 58 75 75 ASP ASP D . n D 4 59 LEU 59 76 76 LEU LEU D . n D 4 60 VAL 60 77 77 VAL VAL D . n D 4 61 SER 61 78 78 SER SER D . n D 4 62 TYR 62 79 79 TYR TYR D . n D 4 63 CYS 63 80 80 CYS CYS D . n D 4 64 GLY 64 81 81 GLY GLY D . n D 4 65 PRO 65 82 82 PRO PRO D . n D 4 66 TRP 66 83 83 TRP TRP D . n D 4 67 LYS 67 84 84 LYS LYS D . n D 4 68 LEU 68 85 85 LEU LEU D . n D 4 69 ASP 69 86 86 ASP ASP D . n D 4 70 ALA 70 87 87 ALA ALA D . n D 4 71 ALA 71 88 88 ALA ALA D . n D 4 72 TRP 72 89 89 TRP TRP D . n D 4 73 ASP 73 90 90 ASP ASP D . n D 4 74 GLY 74 91 91 GLY GLY D . n D 4 75 LEU 75 92 92 LEU LEU D . n D 4 76 SER 76 93 93 SER SER D . n D 4 77 GLU 77 94 94 GLU GLU D . n D 4 78 VAL 78 95 95 VAL VAL D . n D 4 79 GLN 79 96 96 GLN GLN D . n D 4 80 LEU 80 97 97 LEU LEU D . n D 4 81 LEU 81 98 98 LEU LEU D . n D 4 82 ALA 82 99 99 ALA ALA D . n D 4 83 VAL 83 100 100 VAL VAL D . n D 4 84 PRO 84 101 101 PRO PRO D . n D 4 85 PRO 85 102 102 PRO PRO D . n D 4 86 GLY 86 103 103 GLY GLY D . n D 4 87 GLU 87 104 104 GLU GLU D . n D 4 88 ARG 88 105 105 ARG ARG D . n D 4 89 ALA 89 106 106 ALA ALA D . n D 4 90 LYS 90 107 107 LYS LYS D . n D 4 91 ASN 91 108 108 ASN ASN D . n D 4 92 ILE 92 109 109 ILE ILE D . n D 4 93 GLN 93 110 110 GLN GLN D . n D 4 94 THR 94 111 111 THR THR D . n D 4 95 LEU 95 112 112 LEU LEU D . n D 4 96 PRO 96 113 113 PRO PRO D . n D 4 97 GLY 97 114 114 GLY GLY D . n D 4 98 ILE 98 115 115 ILE ILE D . n D 4 99 PHE 99 116 116 PHE PHE D . n D 4 100 LYS 100 117 117 LYS LYS D . n D 4 101 THR 101 118 118 THR THR D . n D 4 102 LYS 102 119 119 LYS LYS D . n D 4 103 ASP 103 120 120 ASP ASP D . n D 4 104 GLY 104 121 121 GLY GLY D . n D 4 105 ASP 105 122 122 ASP ASP D . n D 4 106 ILE 106 123 123 ILE ILE D . n D 4 107 GLY 107 124 124 GLY GLY D . n D 4 108 ALA 108 125 125 ALA ALA D . n D 4 109 VAL 109 126 126 VAL VAL D . n D 4 110 ALA 110 127 127 ALA ALA D . n D 4 111 LEU 111 128 128 LEU LEU D . n D 4 112 ASP 112 129 129 ASP ASP D . n D 4 113 TYR 113 130 130 TYR TYR D . n D 4 114 PRO 114 131 131 PRO PRO D . n D 4 115 ALA 115 132 132 ALA ALA D . n D 4 116 GLY 116 133 133 GLY GLY D . n D 4 117 THR 117 134 134 THR THR D . n D 4 118 SER 118 135 135 SER SER D . n D 4 119 GLY 119 136 136 GLY GLY D . n D 4 120 SER 120 137 137 SER SER D . n D 4 121 PRO 121 138 138 PRO PRO D . n D 4 122 ILE 122 139 139 ILE ILE D . n D 4 123 LEU 123 140 140 LEU LEU D . n D 4 124 ASP 124 141 141 ASP ASP D . n D 4 125 LYS 125 142 142 LYS LYS D . n D 4 126 CYS 126 143 143 CYS CYS D . n D 4 127 GLY 127 144 144 GLY GLY D . n D 4 128 ARG 128 145 145 ARG ARG D . n D 4 129 VAL 129 146 146 VAL VAL D . n D 4 130 ILE 130 147 147 ILE ILE D . n D 4 131 GLY 131 148 148 GLY GLY D . n D 4 132 LEU 132 149 149 LEU LEU D . n D 4 133 TYR 133 150 150 TYR TYR D . n D 4 134 GLY 134 151 151 GLY GLY D . n D 4 135 ASN 135 152 152 ASN ASN D . n D 4 136 GLY 136 153 153 GLY GLY D . n D 4 137 VAL 137 154 154 VAL VAL D . n D 4 138 VAL 138 155 155 VAL VAL D . n D 4 139 ILE 139 156 156 ILE ILE D . n D 4 140 LYS 140 157 157 LYS LYS D . n D 4 141 ASN 141 158 158 ASN ASN D . n D 4 142 GLY 142 159 159 GLY GLY D . n D 4 143 SER 143 160 160 SER SER D . n D 4 144 TYR 144 161 161 TYR TYR D . n D 4 145 VAL 145 162 162 VAL VAL D . n D 4 146 SER 146 163 163 SER SER D . n D 4 147 ALA 147 164 164 ALA ALA D . n D 4 148 ILE 148 165 165 ILE ILE D . n D 4 149 THR 149 166 166 THR THR D . n D 4 150 GLN 150 167 167 GLN GLN D . n D 4 151 GLY 151 168 168 GLY GLY D . n D 4 152 LYS 152 169 169 LYS LYS D . n D 4 153 ARG 153 170 170 ARG ARG D . n E 1 1 ASP 1 50 50 ASP ASP E . n E 1 2 MET 2 51 51 MET MET E . n E 1 3 TYR 3 52 52 TYR TYR E . n E 1 4 ILE 4 53 53 ILE ILE E . n E 1 5 GLU 5 54 54 GLU GLU E . n E 1 6 ARG 6 55 55 ARG ARG E . n E 1 7 ALA 7 56 56 ALA ALA E . n E 1 8 GLY 8 57 57 GLY GLY E . n E 1 9 ASP 9 58 58 ASP ASP E . n E 1 10 ILE 10 59 59 ILE ILE E . n E 1 11 THR 11 60 60 THR THR E . n E 1 12 TRP 12 61 61 TRP TRP E . n E 1 13 GLU 13 62 62 GLU GLU E . n E 1 14 LYS 14 63 63 LYS LYS E . n E 1 15 ASP 15 64 64 ASP ASP E . n E 1 16 ALA 16 65 65 ALA ALA E . n E 1 17 GLU 17 66 66 GLU GLU E . n E 1 18 VAL 18 67 67 VAL VAL E . n E 1 19 THR 19 68 68 THR THR E . n E 1 20 GLY 20 69 69 GLY GLY E . n E 1 21 ASN 21 70 70 ASN ASN E . n E 1 22 SER 22 71 71 SER SER E . n E 1 23 PRO 23 72 72 PRO PRO E . n E 1 24 ARG 24 73 73 ARG ARG E . n E 1 25 LEU 25 74 74 LEU LEU E . n E 1 26 ASP 26 75 75 ASP ASP E . n E 1 27 VAL 27 76 76 VAL VAL E . n E 1 28 ALA 28 77 77 ALA ALA E . n E 1 29 LEU 29 78 78 LEU LEU E . n E 1 30 ASP 30 79 79 ASP ASP E . n E 1 31 GLU 31 80 80 GLU GLU E . n E 1 32 SER 32 81 81 SER SER E . n E 1 33 GLY 33 82 82 GLY GLY E . n E 1 34 ASP 34 83 83 ASP ASP E . n E 1 35 PHE 35 84 84 PHE PHE E . n E 1 36 SER 36 85 85 SER SER E . n E 1 37 LEU 37 86 86 LEU LEU E . n E 1 38 VAL 38 87 87 VAL VAL E . n F 5 1 THR 1 19 19 THR THR F . n F 5 2 ASP 2 20 20 ASP ASP F . n F 5 3 GLY 3 21 21 GLY GLY F . n F 5 4 VAL 4 22 22 VAL VAL F . n F 5 5 TYR 5 23 23 TYR TYR F . n F 5 6 ARG 6 24 24 ARG ARG F . n F 5 7 VAL 7 25 25 VAL VAL F . n F 5 8 MET 8 26 26 MET MET F . n F 5 9 THR 9 27 27 THR THR F . n F 5 10 ARG 10 28 28 ARG ARG F . n F 5 11 ARG 11 29 29 ARG ARG F . n F 5 12 LEU 12 30 30 LEU LEU F . n F 5 13 LEU 13 31 31 LEU LEU F . n F 5 14 GLY 14 32 32 GLY GLY F . n F 5 15 SER 15 33 33 SER SER F . n F 5 16 THR 16 34 34 THR THR F . n F 5 17 GLN 17 35 35 GLN GLN F . n F 5 18 VAL 18 36 36 VAL VAL F . n F 5 19 GLY 19 37 37 GLY GLY F . n F 5 20 VAL 20 38 38 VAL VAL F . n F 5 21 GLY 21 39 39 GLY GLY F . n F 5 22 VAL 22 40 40 VAL VAL F . n F 5 23 MET 23 41 41 MET MET F . n F 5 24 GLN 24 42 42 GLN GLN F . n F 5 25 GLU 25 43 43 GLU GLU F . n F 5 26 GLY 26 44 44 GLY GLY F . n F 5 27 VAL 27 45 45 VAL VAL F . n F 5 28 PHE 28 46 46 PHE PHE F . n F 5 29 HIS 29 47 47 HIS HIS F . n F 5 30 THR 30 48 48 THR THR F . n F 5 31 MET 31 49 49 MET MET F . n F 5 32 TRP 32 50 50 TRP TRP F . n F 5 33 HIS 33 51 51 HIS HIS F . n F 5 34 VAL 34 52 52 VAL VAL F . n F 5 35 THR 35 53 53 THR THR F . n F 5 36 LYS 36 54 54 LYS LYS F . n F 5 37 GLY 37 55 55 GLY GLY F . n F 5 38 ALA 38 56 56 ALA ALA F . n F 5 39 ALA 39 57 57 ALA ALA F . n F 5 40 LEU 40 58 58 LEU LEU F . n F 5 41 ARG 41 59 59 ARG ARG F . n F 5 42 SER 42 60 60 SER SER F . n F 5 43 GLY 43 61 61 GLY GLY F . n F 5 44 GLU 44 62 62 GLU GLU F . n F 5 45 GLY 45 63 63 GLY GLY F . n F 5 46 ARG 46 64 64 ARG ARG F . n F 5 47 LEU 47 65 65 LEU LEU F . n F 5 48 ASP 48 66 66 ASP ASP F . n F 5 49 PRO 49 67 67 PRO PRO F . n F 5 50 TYR 50 68 68 TYR TYR F . n F 5 51 TRP 51 69 69 TRP TRP F . n F 5 52 GLY 52 70 70 GLY GLY F . n F 5 53 ASP 53 71 71 ASP ASP F . n F 5 54 VAL 54 72 72 VAL VAL F . n F 5 55 LYS 55 73 73 LYS LYS F . n F 5 56 GLN 56 74 74 GLN GLN F . n F 5 57 ASP 57 75 75 ASP ASP F . n F 5 58 LEU 58 76 76 LEU LEU F . n F 5 59 VAL 59 77 77 VAL VAL F . n F 5 60 SER 60 78 78 SER SER F . n F 5 61 TYR 61 79 79 TYR TYR F . n F 5 62 CYS 62 80 80 CYS CYS F . n F 5 63 GLY 63 81 81 GLY GLY F . n F 5 64 PRO 64 82 82 PRO PRO F . n F 5 65 TRP 65 83 83 TRP TRP F . n F 5 66 LYS 66 84 84 LYS LYS F . n F 5 67 LEU 67 85 85 LEU LEU F . n F 5 68 ASP 68 86 86 ASP ASP F . n F 5 69 ALA 69 87 87 ALA ALA F . n F 5 70 ALA 70 88 88 ALA ALA F . n F 5 71 TRP 71 89 89 TRP TRP F . n F 5 72 ASP 72 90 90 ASP ASP F . n F 5 73 GLY 73 91 91 GLY GLY F . n F 5 74 LEU 74 92 92 LEU LEU F . n F 5 75 SER 75 93 93 SER SER F . n F 5 76 GLU 76 94 94 GLU GLU F . n F 5 77 VAL 77 95 95 VAL VAL F . n F 5 78 GLN 78 96 96 GLN GLN F . n F 5 79 LEU 79 97 97 LEU LEU F . n F 5 80 LEU 80 98 98 LEU LEU F . n F 5 81 ALA 81 99 99 ALA ALA F . n F 5 82 VAL 82 100 100 VAL VAL F . n F 5 83 PRO 83 101 101 PRO PRO F . n F 5 84 PRO 84 102 102 PRO PRO F . n F 5 85 GLY 85 103 103 GLY GLY F . n F 5 86 GLU 86 104 104 GLU GLU F . n F 5 87 ARG 87 105 105 ARG ARG F . n F 5 88 ALA 88 106 106 ALA ALA F . n F 5 89 LYS 89 107 107 LYS LYS F . n F 5 90 ASN 90 108 108 ASN ASN F . n F 5 91 ILE 91 109 109 ILE ILE F . n F 5 92 GLN 92 110 110 GLN GLN F . n F 5 93 THR 93 111 111 THR THR F . n F 5 94 LEU 94 112 112 LEU LEU F . n F 5 95 PRO 95 113 113 PRO PRO F . n F 5 96 GLY 96 114 114 GLY GLY F . n F 5 97 ILE 97 115 115 ILE ILE F . n F 5 98 PHE 98 116 116 PHE PHE F . n F 5 99 LYS 99 117 117 LYS LYS F . n F 5 100 THR 100 118 118 THR THR F . n F 5 101 LYS 101 119 119 LYS LYS F . n F 5 102 ASP 102 120 120 ASP ASP F . n F 5 103 GLY 103 121 121 GLY GLY F . n F 5 104 ASP 104 122 122 ASP ASP F . n F 5 105 ILE 105 123 123 ILE ILE F . n F 5 106 GLY 106 124 124 GLY GLY F . n F 5 107 ALA 107 125 125 ALA ALA F . n F 5 108 VAL 108 126 126 VAL VAL F . n F 5 109 ALA 109 127 127 ALA ALA F . n F 5 110 LEU 110 128 128 LEU LEU F . n F 5 111 ASP 111 129 129 ASP ASP F . n F 5 112 TYR 112 130 130 TYR TYR F . n F 5 113 PRO 113 131 131 PRO PRO F . n F 5 114 ALA 114 132 132 ALA ALA F . n F 5 115 GLY 115 133 133 GLY GLY F . n F 5 116 THR 116 134 134 THR THR F . n F 5 117 SER 117 135 135 SER SER F . n F 5 118 GLY 118 136 136 GLY GLY F . n F 5 119 SER 119 137 137 SER SER F . n F 5 120 PRO 120 138 138 PRO PRO F . n F 5 121 ILE 121 139 139 ILE ILE F . n F 5 122 LEU 122 140 140 LEU LEU F . n F 5 123 ASP 123 141 141 ASP ASP F . n F 5 124 LYS 124 142 142 LYS LYS F . n F 5 125 CYS 125 143 143 CYS CYS F . n F 5 126 GLY 126 144 144 GLY GLY F . n F 5 127 ARG 127 145 145 ARG ARG F . n F 5 128 VAL 128 146 146 VAL VAL F . n F 5 129 ILE 129 147 147 ILE ILE F . n F 5 130 GLY 130 148 148 GLY GLY F . n F 5 131 LEU 131 149 149 LEU LEU F . n F 5 132 TYR 132 150 150 TYR TYR F . n F 5 133 GLY 133 151 151 GLY GLY F . n F 5 134 ASN 134 152 152 ASN ASN F . n F 5 135 GLY 135 153 153 GLY GLY F . n F 5 136 VAL 136 154 154 VAL VAL F . n F 5 137 VAL 137 155 155 VAL VAL F . n F 5 138 ILE 138 156 156 ILE ILE F . n F 5 139 LYS 139 157 157 LYS LYS F . n F 5 140 ASN 140 158 158 ASN ASN F . n F 5 141 GLY 141 159 159 GLY GLY F . n F 5 142 SER 142 160 160 SER SER F . n F 5 143 TYR 143 161 161 TYR TYR F . n F 5 144 VAL 144 162 162 VAL VAL F . n F 5 145 SER 145 163 163 SER SER F . n F 5 146 ALA 146 164 164 ALA ALA F . n F 5 147 ILE 147 165 165 ILE ILE F . n F 5 148 THR 148 166 166 THR THR F . n F 5 149 GLN 149 167 167 GLN GLN F . n F 5 150 GLY 150 168 168 GLY GLY F . n F 5 151 LYS 151 169 169 LYS LYS F . n F 5 152 ARG 152 170 170 ARG ARG F . n G 6 1 ASP 1 50 50 ASP ASP G . n G 6 2 MET 2 51 51 MET MET G . n G 6 3 TYR 3 52 52 TYR TYR G . n G 6 4 ILE 4 53 53 ILE ILE G . n G 6 5 GLU 5 54 54 GLU GLU G . n G 6 6 ARG 6 55 55 ARG ARG G . n G 6 7 ALA 7 56 56 ALA ALA G . n G 6 8 GLY 8 57 57 GLY GLY G . n G 6 9 ASP 9 58 58 ASP ASP G . n G 6 10 ILE 10 59 59 ILE ILE G . n G 6 11 THR 11 60 60 THR THR G . n G 6 12 TRP 12 61 61 TRP TRP G . n G 6 13 GLU 13 62 62 GLU GLU G . n G 6 14 LYS 14 63 63 LYS LYS G . n G 6 15 ASP 15 64 64 ASP ASP G . n G 6 16 ALA 16 65 65 ALA ALA G . n G 6 17 GLU 17 66 66 GLU GLU G . n G 6 18 VAL 18 67 67 VAL VAL G . n G 6 19 THR 19 68 68 THR THR G . n G 6 20 GLY 20 69 69 GLY GLY G . n G 6 21 ASN 21 70 70 ASN ASN G . n G 6 22 SER 22 71 71 SER SER G . n G 6 23 PRO 23 72 72 PRO PRO G . n G 6 24 ARG 24 73 73 ARG ARG G . n G 6 25 LEU 25 74 74 LEU LEU G . n G 6 26 ASP 26 75 75 ASP ASP G . n G 6 27 VAL 27 76 76 VAL VAL G . n G 6 28 ALA 28 77 77 ALA ALA G . n G 6 29 LEU 29 78 78 LEU LEU G . n G 6 30 ASP 30 79 79 ASP ASP G . n G 6 31 GLU 31 80 80 GLU GLU G . n G 6 32 SER 32 81 81 SER SER G . n G 6 33 GLY 33 82 82 GLY GLY G . n G 6 34 ASP 34 83 83 ASP ASP G . n G 6 35 PHE 35 84 84 PHE PHE G . n G 6 36 SER 36 85 85 SER SER G . n G 6 37 LEU 37 86 86 LEU LEU G . n G 6 38 VAL 38 87 87 VAL VAL G . n G 6 39 GLU 39 88 88 GLU GLU G . n G 6 40 GLU 40 89 89 GLU GLU G . n H 7 1 GLU 1 12 12 GLU GLU H . n H 7 2 VAL 2 13 13 VAL VAL H . n H 7 3 LYS 3 14 14 LYS LYS H . n H 7 4 LYS 4 15 15 LYS LYS H . n H 7 5 GLY 5 16 16 GLY GLY H . n H 7 6 GLU 6 17 17 GLU GLU H . n H 7 7 THR 7 18 18 THR THR H . n H 7 8 THR 8 19 19 THR THR H . n H 7 9 ASP 9 20 20 ASP ASP H . n H 7 10 GLY 10 21 21 GLY GLY H . n H 7 11 VAL 11 22 22 VAL VAL H . n H 7 12 TYR 12 23 23 TYR TYR H . n H 7 13 ARG 13 24 24 ARG ARG H . n H 7 14 VAL 14 25 25 VAL VAL H . n H 7 15 MET 15 26 26 MET MET H . n H 7 16 THR 16 27 27 THR THR H . n H 7 17 ARG 17 28 ? ? ? H . n H 7 18 ARG 18 29 ? ? ? H . n H 7 19 LEU 19 30 ? ? ? H . n H 7 20 LEU 20 31 ? ? ? H . n H 7 21 GLY 21 32 ? ? ? H . n H 7 22 SER 22 33 ? ? ? H . n H 7 23 THR 23 34 34 THR THR H . n H 7 24 GLN 24 35 35 GLN GLN H . n H 7 25 VAL 25 36 36 VAL VAL H . n H 7 26 GLY 26 37 37 GLY GLY H . n H 7 27 VAL 27 38 38 VAL VAL H . n H 7 28 GLY 28 39 39 GLY GLY H . n H 7 29 VAL 29 40 40 VAL VAL H . n H 7 30 MET 30 41 41 MET MET H . n H 7 31 GLN 31 42 42 GLN GLN H . n H 7 32 GLU 32 43 43 GLU GLU H . n H 7 33 GLY 33 44 44 GLY GLY H . n H 7 34 VAL 34 45 45 VAL VAL H . n H 7 35 PHE 35 46 46 PHE PHE H . n H 7 36 HIS 36 47 47 HIS HIS H . n H 7 37 THR 37 48 48 THR THR H . n H 7 38 MET 38 49 49 MET MET H . n H 7 39 TRP 39 50 50 TRP TRP H . n H 7 40 HIS 40 51 51 HIS HIS H . n H 7 41 VAL 41 52 52 VAL VAL H . n H 7 42 THR 42 53 53 THR THR H . n H 7 43 LYS 43 54 54 LYS LYS H . n H 7 44 GLY 44 55 55 GLY GLY H . n H 7 45 ALA 45 56 56 ALA ALA H . n H 7 46 ALA 46 57 57 ALA ALA H . n H 7 47 LEU 47 58 58 LEU LEU H . n H 7 48 ARG 48 59 59 ARG ARG H . n H 7 49 SER 49 60 60 SER SER H . n H 7 50 GLY 50 61 61 GLY GLY H . n H 7 51 GLU 51 62 62 GLU GLU H . n H 7 52 GLY 52 63 63 GLY GLY H . n H 7 53 ARG 53 64 64 ARG ARG H . n H 7 54 LEU 54 65 65 LEU LEU H . n H 7 55 ASP 55 66 66 ASP ASP H . n H 7 56 PRO 56 67 67 PRO PRO H . n H 7 57 TYR 57 68 68 TYR TYR H . n H 7 58 TRP 58 69 69 TRP TRP H . n H 7 59 GLY 59 70 70 GLY GLY H . n H 7 60 ASP 60 71 71 ASP ASP H . n H 7 61 VAL 61 72 72 VAL VAL H . n H 7 62 LYS 62 73 73 LYS LYS H . n H 7 63 GLN 63 74 74 GLN GLN H . n H 7 64 ASP 64 75 75 ASP ASP H . n H 7 65 LEU 65 76 76 LEU LEU H . n H 7 66 VAL 66 77 77 VAL VAL H . n H 7 67 SER 67 78 78 SER SER H . n H 7 68 TYR 68 79 79 TYR TYR H . n H 7 69 CYS 69 80 80 CYS CYS H . n H 7 70 GLY 70 81 81 GLY GLY H . n H 7 71 PRO 71 82 82 PRO PRO H . n H 7 72 TRP 72 83 83 TRP TRP H . n H 7 73 LYS 73 84 84 LYS LYS H . n H 7 74 LEU 74 85 85 LEU LEU H . n H 7 75 ASP 75 86 86 ASP ASP H . n H 7 76 ALA 76 87 87 ALA ALA H . n H 7 77 ALA 77 88 88 ALA ALA H . n H 7 78 TRP 78 89 89 TRP TRP H . n H 7 79 ASP 79 90 90 ASP ASP H . n H 7 80 GLY 80 91 91 GLY GLY H . n H 7 81 LEU 81 92 92 LEU LEU H . n H 7 82 SER 82 93 93 SER SER H . n H 7 83 GLU 83 94 94 GLU GLU H . n H 7 84 VAL 84 95 95 VAL VAL H . n H 7 85 GLN 85 96 96 GLN GLN H . n H 7 86 LEU 86 97 97 LEU LEU H . n H 7 87 LEU 87 98 98 LEU LEU H . n H 7 88 ALA 88 99 99 ALA ALA H . n H 7 89 VAL 89 100 100 VAL VAL H . n H 7 90 PRO 90 101 101 PRO PRO H . n H 7 91 PRO 91 102 102 PRO PRO H . n H 7 92 GLY 92 103 103 GLY GLY H . n H 7 93 GLU 93 104 104 GLU GLU H . n H 7 94 ARG 94 105 105 ARG ARG H . n H 7 95 ALA 95 106 106 ALA ALA H . n H 7 96 LYS 96 107 107 LYS LYS H . n H 7 97 ASN 97 108 108 ASN ASN H . n H 7 98 ILE 98 109 109 ILE ILE H . n H 7 99 GLN 99 110 110 GLN GLN H . n H 7 100 THR 100 111 111 THR THR H . n H 7 101 LEU 101 112 112 LEU LEU H . n H 7 102 PRO 102 113 113 PRO PRO H . n H 7 103 GLY 103 114 114 GLY GLY H . n H 7 104 ILE 104 115 115 ILE ILE H . n H 7 105 PHE 105 116 116 PHE PHE H . n H 7 106 LYS 106 117 117 LYS LYS H . n H 7 107 THR 107 118 118 THR THR H . n H 7 108 LYS 108 119 119 LYS LYS H . n H 7 109 ASP 109 120 120 ASP ASP H . n H 7 110 GLY 110 121 121 GLY GLY H . n H 7 111 ASP 111 122 122 ASP ASP H . n H 7 112 ILE 112 123 123 ILE ILE H . n H 7 113 GLY 113 124 124 GLY GLY H . n H 7 114 ALA 114 125 125 ALA ALA H . n H 7 115 VAL 115 126 126 VAL VAL H . n H 7 116 ALA 116 127 127 ALA ALA H . n H 7 117 LEU 117 128 128 LEU LEU H . n H 7 118 ASP 118 129 129 ASP ASP H . n H 7 119 TYR 119 130 130 TYR TYR H . n H 7 120 PRO 120 131 131 PRO PRO H . n H 7 121 ALA 121 132 132 ALA ALA H . n H 7 122 GLY 122 133 133 GLY GLY H . n H 7 123 THR 123 134 134 THR THR H . n H 7 124 SER 124 135 135 SER SER H . n H 7 125 GLY 125 136 136 GLY GLY H . n H 7 126 SER 126 137 137 SER SER H . n H 7 127 PRO 127 138 138 PRO PRO H . n H 7 128 ILE 128 139 139 ILE ILE H . n H 7 129 LEU 129 140 140 LEU LEU H . n H 7 130 ASP 130 141 141 ASP ASP H . n H 7 131 LYS 131 142 142 LYS LYS H . n H 7 132 CYS 132 143 143 CYS CYS H . n H 7 133 GLY 133 144 144 GLY GLY H . n H 7 134 ARG 134 145 145 ARG ARG H . n H 7 135 VAL 135 146 146 VAL VAL H . n H 7 136 ILE 136 147 147 ILE ILE H . n H 7 137 GLY 137 148 148 GLY GLY H . n H 7 138 LEU 138 149 149 LEU LEU H . n H 7 139 TYR 139 150 150 TYR TYR H . n H 7 140 GLY 140 151 151 GLY GLY H . n H 7 141 ASN 141 152 152 ASN ASN H . n H 7 142 GLY 142 153 153 GLY GLY H . n H 7 143 VAL 143 154 154 VAL VAL H . n H 7 144 VAL 144 155 155 VAL VAL H . n H 7 145 ILE 145 156 156 ILE ILE H . n H 7 146 LYS 146 157 157 LYS LYS H . n H 7 147 ASN 147 158 158 ASN ASN H . n H 7 148 GLY 148 159 159 GLY GLY H . n H 7 149 SER 149 160 160 SER SER H . n H 7 150 TYR 150 161 161 TYR TYR H . n H 7 151 VAL 151 162 162 VAL VAL H . n H 7 152 SER 152 163 163 SER SER H . n H 7 153 ALA 153 164 164 ALA ALA H . n H 7 154 ILE 154 165 165 ILE ILE H . n H 7 155 THR 155 166 166 THR THR H . n H 7 156 GLN 156 167 167 GLN GLN H . n H 7 157 GLY 157 168 168 GLY GLY H . n H 7 158 LYS 158 169 169 LYS LYS H . n H 7 159 ARG 159 170 170 ARG ARG H . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code I 8 E5X 1 201 201 E5X DRG H . J 9 HOH 1 101 143 HOH HOH A . J 9 HOH 2 102 91 HOH HOH A . J 9 HOH 3 103 5 HOH HOH A . J 9 HOH 4 104 41 HOH HOH A . J 9 HOH 5 105 130 HOH HOH A . J 9 HOH 6 106 87 HOH HOH A . J 9 HOH 7 107 4 HOH HOH A . J 9 HOH 8 108 124 HOH HOH A . J 9 HOH 9 109 101 HOH HOH A . J 9 HOH 10 110 133 HOH HOH A . J 9 HOH 11 111 140 HOH HOH A . K 9 HOH 1 201 92 HOH HOH B . K 9 HOH 2 202 53 HOH HOH B . K 9 HOH 3 203 83 HOH HOH B . K 9 HOH 4 204 2 HOH HOH B . K 9 HOH 5 205 109 HOH HOH B . K 9 HOH 6 206 136 HOH HOH B . K 9 HOH 7 207 82 HOH HOH B . K 9 HOH 8 208 6 HOH HOH B . K 9 HOH 9 209 22 HOH HOH B . K 9 HOH 10 210 24 HOH HOH B . K 9 HOH 11 211 126 HOH HOH B . K 9 HOH 12 212 69 HOH HOH B . K 9 HOH 13 213 117 HOH HOH B . K 9 HOH 14 214 60 HOH HOH B . K 9 HOH 15 215 139 HOH HOH B . K 9 HOH 16 216 150 HOH HOH B . K 9 HOH 17 217 164 HOH HOH B . K 9 HOH 18 218 33 HOH HOH B . K 9 HOH 19 219 3 HOH HOH B . K 9 HOH 20 220 79 HOH HOH B . K 9 HOH 21 221 98 HOH HOH B . K 9 HOH 22 222 35 HOH HOH B . K 9 HOH 23 223 114 HOH HOH B . K 9 HOH 24 224 108 HOH HOH B . K 9 HOH 25 225 34 HOH HOH B . K 9 HOH 26 226 174 HOH HOH B . K 9 HOH 27 227 166 HOH HOH B . K 9 HOH 28 228 173 HOH HOH B . K 9 HOH 29 229 54 HOH HOH B . L 9 HOH 1 101 36 HOH HOH C . L 9 HOH 2 102 40 HOH HOH C . L 9 HOH 3 103 147 HOH HOH C . L 9 HOH 4 104 57 HOH HOH C . L 9 HOH 5 105 67 HOH HOH C . L 9 HOH 6 106 63 HOH HOH C . L 9 HOH 7 107 77 HOH HOH C . L 9 HOH 8 108 148 HOH HOH C . L 9 HOH 9 109 161 HOH HOH C . L 9 HOH 10 110 168 HOH HOH C . L 9 HOH 11 111 155 HOH HOH C . M 9 HOH 1 201 84 HOH HOH D . M 9 HOH 2 202 121 HOH HOH D . M 9 HOH 3 203 100 HOH HOH D . M 9 HOH 4 204 14 HOH HOH D . M 9 HOH 5 205 94 HOH HOH D . M 9 HOH 6 206 13 HOH HOH D . M 9 HOH 7 207 99 HOH HOH D . M 9 HOH 8 208 52 HOH HOH D . M 9 HOH 9 209 61 HOH HOH D . M 9 HOH 10 210 135 HOH HOH D . M 9 HOH 11 211 156 HOH HOH D . M 9 HOH 12 212 102 HOH HOH D . M 9 HOH 13 213 30 HOH HOH D . M 9 HOH 14 214 103 HOH HOH D . M 9 HOH 15 215 107 HOH HOH D . M 9 HOH 16 216 157 HOH HOH D . M 9 HOH 17 217 20 HOH HOH D . M 9 HOH 18 218 142 HOH HOH D . M 9 HOH 19 219 105 HOH HOH D . M 9 HOH 20 220 116 HOH HOH D . M 9 HOH 21 221 106 HOH HOH D . M 9 HOH 22 222 141 HOH HOH D . M 9 HOH 23 223 81 HOH HOH D . M 9 HOH 24 224 165 HOH HOH D . M 9 HOH 25 225 127 HOH HOH D . M 9 HOH 26 226 72 HOH HOH D . M 9 HOH 27 227 145 HOH HOH D . M 9 HOH 28 228 115 HOH HOH D . M 9 HOH 29 229 149 HOH HOH D . M 9 HOH 30 230 162 HOH HOH D . N 9 HOH 1 101 25 HOH HOH E . N 9 HOH 2 102 96 HOH HOH E . N 9 HOH 3 103 90 HOH HOH E . N 9 HOH 4 104 172 HOH HOH E . N 9 HOH 5 105 137 HOH HOH E . N 9 HOH 6 106 160 HOH HOH E . O 9 HOH 1 201 119 HOH HOH F . O 9 HOH 2 202 95 HOH HOH F . O 9 HOH 3 203 17 HOH HOH F . O 9 HOH 4 204 104 HOH HOH F . O 9 HOH 5 205 16 HOH HOH F . O 9 HOH 6 206 131 HOH HOH F . O 9 HOH 7 207 151 HOH HOH F . O 9 HOH 8 208 132 HOH HOH F . O 9 HOH 9 209 27 HOH HOH F . O 9 HOH 10 210 51 HOH HOH F . O 9 HOH 11 211 169 HOH HOH F . O 9 HOH 12 212 111 HOH HOH F . O 9 HOH 13 213 46 HOH HOH F . O 9 HOH 14 214 86 HOH HOH F . O 9 HOH 15 215 78 HOH HOH F . O 9 HOH 16 216 118 HOH HOH F . O 9 HOH 17 217 153 HOH HOH F . P 9 HOH 1 101 74 HOH HOH G . P 9 HOH 2 102 154 HOH HOH G . P 9 HOH 3 103 39 HOH HOH G . P 9 HOH 4 104 167 HOH HOH G . P 9 HOH 5 105 93 HOH HOH G . P 9 HOH 6 106 47 HOH HOH G . P 9 HOH 7 107 9 HOH HOH G . P 9 HOH 8 108 68 HOH HOH G . P 9 HOH 9 109 49 HOH HOH G . P 9 HOH 10 110 73 HOH HOH G . P 9 HOH 11 111 21 HOH HOH G . P 9 HOH 12 112 123 HOH HOH G . P 9 HOH 13 113 70 HOH HOH G . P 9 HOH 14 114 97 HOH HOH G . P 9 HOH 15 115 113 HOH HOH G . P 9 HOH 16 116 158 HOH HOH G . P 9 HOH 17 117 7 HOH HOH G . P 9 HOH 18 118 120 HOH HOH G . P 9 HOH 19 119 55 HOH HOH G . P 9 HOH 20 120 134 HOH HOH G . Q 9 HOH 1 301 37 HOH HOH H . Q 9 HOH 2 302 28 HOH HOH H . Q 9 HOH 3 303 89 HOH HOH H . Q 9 HOH 4 304 31 HOH HOH H . Q 9 HOH 5 305 8 HOH HOH H . Q 9 HOH 6 306 66 HOH HOH H . Q 9 HOH 7 307 44 HOH HOH H . Q 9 HOH 8 308 23 HOH HOH H . Q 9 HOH 9 309 38 HOH HOH H . Q 9 HOH 10 310 11 HOH HOH H . Q 9 HOH 11 311 110 HOH HOH H . Q 9 HOH 12 312 1 HOH HOH H . Q 9 HOH 13 313 88 HOH HOH H . Q 9 HOH 14 314 12 HOH HOH H . Q 9 HOH 15 315 163 HOH HOH H . Q 9 HOH 16 316 42 HOH HOH H . Q 9 HOH 17 317 76 HOH HOH H . Q 9 HOH 18 318 29 HOH HOH H . Q 9 HOH 19 319 19 HOH HOH H . Q 9 HOH 20 320 10 HOH HOH H . Q 9 HOH 21 321 15 HOH HOH H . Q 9 HOH 22 322 138 HOH HOH H . Q 9 HOH 23 323 45 HOH HOH H . Q 9 HOH 24 324 129 HOH HOH H . Q 9 HOH 25 325 171 HOH HOH H . Q 9 HOH 26 326 56 HOH HOH H . Q 9 HOH 27 327 43 HOH HOH H . Q 9 HOH 28 328 75 HOH HOH H . Q 9 HOH 29 329 85 HOH HOH H . Q 9 HOH 30 330 59 HOH HOH H . Q 9 HOH 31 331 26 HOH HOH H . Q 9 HOH 32 332 159 HOH HOH H . Q 9 HOH 33 333 58 HOH HOH H . Q 9 HOH 34 334 50 HOH HOH H . Q 9 HOH 35 335 65 HOH HOH H . Q 9 HOH 36 336 18 HOH HOH H . Q 9 HOH 37 337 62 HOH HOH H . Q 9 HOH 38 338 64 HOH HOH H . Q 9 HOH 39 339 125 HOH HOH H . Q 9 HOH 40 340 48 HOH HOH H . Q 9 HOH 41 341 122 HOH HOH H . Q 9 HOH 42 342 170 HOH HOH H . Q 9 HOH 43 343 80 HOH HOH H . Q 9 HOH 44 344 128 HOH HOH H . Q 9 HOH 45 345 71 HOH HOH H . Q 9 HOH 46 346 152 HOH HOH H . Q 9 HOH 47 347 112 HOH HOH H . Q 9 HOH 48 348 144 HOH HOH H . Q 9 HOH 49 349 146 HOH HOH H . Q 9 HOH 50 350 32 HOH HOH H . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 author_and_software_defined_assembly PISA dimeric 2 4 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,J,K 2 1 C,D,L,M 3 1 E,F,N,O 4 1 G,H,I,P,Q # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3760 ? 1 MORE -27 ? 1 'SSA (A^2)' 9130 ? 2 'ABSA (A^2)' 3820 ? 2 MORE -28 ? 2 'SSA (A^2)' 8580 ? 3 'ABSA (A^2)' 3750 ? 3 MORE -28 ? 3 'SSA (A^2)' 9140 ? 4 'ABSA (A^2)' 3810 ? 4 MORE -23 ? 4 'SSA (A^2)' 9650 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-15 2 'Structure model' 1 1 2023-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 5 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 9 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 10 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 39.2042 63.3108 42.0349 0.4660 ? 0.0743 ? -0.1048 ? 0.0003 ? -0.0636 ? 0.3889 ? 5.9090 ? -1.5878 ? -0.8700 ? 7.2237 ? 1.6449 ? 4.9890 ? 0.0595 ? 0.6141 ? -0.5307 ? 0.0070 ? -0.0207 ? -0.9393 ? 0.2881 ? 0.5726 ? -0.3123 ? 2 'X-RAY DIFFRACTION' ? refined 28.0433 77.6909 55.9137 0.2078 ? 0.0058 ? -0.0152 ? 0.2167 ? -0.0123 ? 0.2349 ? 1.9763 ? 1.4599 ? -0.6671 ? 2.2810 ? -1.5182 ? 1.0737 ? 0.3082 ? -0.5366 ? 0.0814 ? 0.5760 ? -0.2899 ? 0.5224 ? 0.0718 ? -0.2300 ? -0.1833 ? 3 'X-RAY DIFFRACTION' ? refined 35.2967 97.3807 48.5026 0.3212 ? 0.0185 ? -0.0302 ? 0.1574 ? -0.0125 ? 0.2349 ? 4.7734 ? 0.9798 ? -1.7183 ? 5.4713 ? -1.4570 ? 2.2984 ? -0.4416 ? 0.1184 ? 0.5091 ? -0.0674 ? 0.1137 ? -0.0791 ? -0.2748 ? 0.2070 ? 0.1888 ? 4 'X-RAY DIFFRACTION' ? refined 39.8296 92.2242 33.9048 0.2600 ? -0.0900 ? -0.0162 ? 0.2536 ? 0.0651 ? 0.1773 ? 3.7244 ? 0.5343 ? 0.7875 ? 0.9468 ? -1.0594 ? 5.7857 ? -0.4552 ? 0.3386 ? 0.3295 ? -0.3315 ? 0.2409 ? 0.2694 ? -0.0246 ? 0.7001 ? 0.1233 ? 5 'X-RAY DIFFRACTION' ? refined 36.5878 64.8724 44.3491 0.3804 ? 0.0117 ? -0.0266 ? 0.1455 ? -0.0292 ? 0.2470 ? 7.6008 ? -1.5850 ? -1.1987 ? 2.6751 ? -0.8240 ? 4.2332 ? -0.0501 ? 0.4034 ? -0.6904 ? 0.0385 ? -0.0198 ? -0.2674 ? 0.4483 ? -0.1521 ? 0.0690 ? 6 'X-RAY DIFFRACTION' ? refined 34.8451 69.7524 39.2418 0.2576 ? 0.0300 ? -0.0401 ? 0.1430 ? -0.0285 ? 0.1777 ? 3.2433 ? 0.9284 ? -0.3850 ? 1.9850 ? 0.2264 ? 0.7957 ? 0.0609 ? 0.0862 ? -0.3402 ? 0.0824 ? 0.0168 ? -0.2078 ? 0.3291 ? 0.0069 ? -0.0646 ? 7 'X-RAY DIFFRACTION' ? refined 32.3470 72.9857 31.9623 0.3241 ? 0.0323 ? -0.0166 ? 0.2149 ? -0.0386 ? 0.1148 ? 2.7344 ? 4.3597 ? -0.4895 ? 2.0233 ? -2.3273 ? 3.2947 ? -0.0280 ? 0.1877 ? -0.1521 ? -0.1117 ? 0.1315 ? -0.5097 ? 0.1544 ? -0.1739 ? -0.0937 ? 8 'X-RAY DIFFRACTION' ? refined 29.5414 82.8162 47.9397 0.2239 ? 0.0128 ? -0.0266 ? 0.1688 ? 0.0033 ? 0.1299 ? 1.5139 ? 0.6372 ? -0.3444 ? 2.5719 ? 0.8014 ? -0.0116 ? 0.0067 ? -0.0875 ? 0.1417 ? 0.0823 ? -0.0388 ? 0.2484 ? -0.0058 ? -0.0774 ? 0.0218 ? 9 'X-RAY DIFFRACTION' ? refined 32.5488 84.5423 45.3323 0.2635 ? 0.0265 ? -0.0319 ? 0.1324 ? -0.0003 ? 0.0990 ? 2.2483 ? 0.9109 ? 0.1720 ? 2.2452 ? 0.2297 ? 0.6319 ? 0.0443 ? 0.0247 ? 0.0810 ? -0.0241 ? -0.0420 ? 0.1773 ? -0.1156 ? -0.0083 ? -0.0351 ? 10 'X-RAY DIFFRACTION' ? refined 35.3537 87.0826 42.6280 0.2144 ? 0.0567 ? -0.0030 ? 0.0962 ? 0.0426 ? 0.1740 ? 9.6078 ? 2.5004 ? 4.9911 ? 4.8525 ? 2.7611 ? 6.5510 ? 0.1809 ? 0.2034 ? -0.1173 ? -0.0090 ? -0.1267 ? -0.0676 ? 0.0046 ? 0.1144 ? 0.0293 ? 11 'X-RAY DIFFRACTION' ? refined 42.0106 72.2692 7.5221 0.3949 ? 0.1178 ? 0.0722 ? 0.6060 ? -0.0354 ? 0.2957 ? 5.9544 ? 0.9156 ? 0.4233 ? 2.0940 ? 2.8056 ? 3.8333 ? -0.6525 ? 0.4276 ? -0.5644 ? 0.7540 ? 0.2563 ? -0.0409 ? -0.0221 ? 1.8718 ? 0.2577 ? 12 'X-RAY DIFFRACTION' ? refined 30.3740 78.2497 -6.4477 0.5372 ? -0.1477 ? 0.0477 ? 0.6591 ? -0.0066 ? 0.2559 ? 4.0026 ? -0.8787 ? 3.1446 ? 8.2252 ? 0.5064 ? 2.6398 ? -0.7710 ? 1.9683 ? 0.4897 ? -0.8818 ? -0.6838 ? -0.0530 ? 0.4275 ? -0.1066 ? 1.1721 ? 13 'X-RAY DIFFRACTION' ? refined 16.2490 67.3445 11.6853 0.4290 ? -0.0265 ? -0.0696 ? 0.3555 ? -0.0276 ? 0.3427 ? 1.1758 ? 0.3931 ? 0.3857 ? 4.2999 ? -1.2784 ? 0.7753 ? 0.1323 ? 0.3681 ? -0.1704 ? 0.3179 ? 0.0676 ? 0.5978 ? 0.3021 ? 0.1608 ? -0.2390 ? 14 'X-RAY DIFFRACTION' ? refined 38.2825 71.6847 12.8154 0.4673 ? 0.0384 ? 0.0427 ? 0.3729 ? 0.0072 ? 0.1680 ? 2.5885 ? -1.5801 ? -1.1015 ? 1.8143 ? 2.0744 ? 2.3242 ? 0.0787 ? 0.3370 ? -0.0098 ? -0.3922 ? -0.0073 ? -0.2016 ? -0.2821 ? 0.1267 ? -0.0607 ? 15 'X-RAY DIFFRACTION' ? refined 40.8449 73.1355 21.9411 0.4598 ? 0.1143 ? -0.0168 ? 0.3453 ? -0.0130 ? 0.1550 ? 7.3841 ? -0.1535 ? 1.3048 ? 3.6742 ? 1.3965 ? 0.8799 ? 0.4814 ? 0.5125 ? -0.5971 ? 0.0337 ? -0.0877 ? -0.3232 ? 0.2452 ? 0.3461 ? -0.3914 ? 16 'X-RAY DIFFRACTION' ? refined 27.6032 78.6487 14.1737 0.6884 ? 0.1197 ? -0.0462 ? 0.3255 ? -0.0261 ? 0.1692 ? 2.6660 ? 0.9594 ? 0.7746 ? 0.6412 ? 0.5397 ? 0.8236 ? 0.0782 ? 0.5284 ? 0.0103 ? -0.5089 ? -0.0564 ? 0.2704 ? -0.4072 ? 0.1975 ? 0.0747 ? 17 'X-RAY DIFFRACTION' ? refined 24.6165 70.0453 5.3791 0.4387 ? -0.0435 ? -0.0326 ? 0.3395 ? -0.0719 ? 0.2086 ? 3.1750 ? -0.6399 ? -0.2309 ? 2.4017 ? -0.4833 ? -0.0197 ? -0.0018 ? 0.4564 ? -0.2335 ? -0.2443 ? -0.0647 ? 0.2355 ? -0.1526 ? -0.0045 ? 0.0603 ? 18 'X-RAY DIFFRACTION' ? refined 26.4865 75.4459 6.8992 0.6754 ? 0.0558 ? -0.1000 ? 0.3824 ? -0.0697 ? 0.1250 ? 4.0512 ? -0.4157 ? -0.4718 ? 0.7570 ? -1.4208 ? 3.4023 ? -0.1591 ? 0.4750 ? -0.3312 ? -0.8253 ? -0.1945 ? 0.1780 ? -0.4626 ? 0.2419 ? 0.2204 ? 19 'X-RAY DIFFRACTION' ? refined 21.5222 69.0888 10.1401 0.2813 ? 0.0471 ? -0.0888 ? 0.3509 ? -0.0489 ? 0.2307 ? 2.0829 ? -0.8605 ? -0.8630 ? 0.6134 ? -0.2480 ? 2.0023 ? -0.3504 ? 0.0280 ? -0.2165 ? -0.9689 ? -0.0392 ? 0.4812 ? -0.4245 ? -0.2673 ? 0.5240 ? 20 'X-RAY DIFFRACTION' ? refined 41.9613 48.7370 -8.6662 0.4445 ? 0.0624 ? -0.0429 ? 0.4306 ? -0.0765 ? 0.1261 ? 5.0879 ? 0.6353 ? -1.7913 ? 3.3041 ? -3.2939 ? 3.6230 ? -0.2376 ? -0.5255 ? 0.1668 ? -0.0114 ? -0.2037 ? -0.5394 ? 0.4364 ? 1.1257 ? 0.3156 ? 21 'X-RAY DIFFRACTION' ? refined 29.8148 39.9582 5.5517 0.3373 ? 0.0142 ? -0.0688 ? 0.5037 ? -0.0170 ? 0.3223 ? 3.1577 ? 3.8543 ? -3.8728 ? 6.8581 ? -3.5886 ? 8.9598 ? 0.2268 ? -2.2448 ? -0.3808 ? -0.1490 ? 0.0536 ? 0.0966 ? 0.4730 ? 1.0696 ? 0.3132 ? 22 'X-RAY DIFFRACTION' ? refined 22.3262 48.1630 6.5096 0.6320 ? 0.1363 ? 0.1692 ? 0.8387 ? 0.0707 ? 0.1151 ? 0.5473 ? -0.2000 ? 0.8524 ? 0.5528 ? -0.7046 ? 1.6152 ? -0.2442 ? -0.2149 ? -0.0592 ? 0.2404 ? -0.1987 ? 0.0736 ? -0.6111 ? 0.3254 ? -0.1638 ? 23 'X-RAY DIFFRACTION' ? refined 13.8517 52.8939 -14.2435 0.3152 ? 0.1280 ? 0.0170 ? 0.4535 ? 0.0230 ? 0.2573 ? 3.2106 ? 1.6028 ? -2.9814 ? 4.0531 ? -2.6479 ? 3.1415 ? 0.3872 ? 0.5260 ? 0.2918 ? -0.1860 ? 0.0900 ? 0.8109 ? -0.1546 ? -0.2754 ? -0.3963 ? 24 'X-RAY DIFFRACTION' ? refined 41.3091 54.9010 -10.0834 0.4656 ? -0.0682 ? -0.0406 ? 0.3025 ? 0.0047 ? 0.1891 ? 3.0983 ? 0.6577 ? 0.5457 ? 0.9957 ? -0.8289 ? 5.1408 ? 0.1671 ? -0.0629 ? 0.3300 ? -0.0817 ? -0.1273 ? 0.1716 ? -0.8717 ? 0.3413 ? 0.0320 ? 25 'X-RAY DIFFRACTION' ? refined 34.7902 47.5648 -14.4082 0.2356 ? -0.0153 ? -0.0236 ? 0.2751 ? -0.0430 ? 0.1308 ? 1.6438 ? 0.2128 ? 0.3864 ? 3.1107 ? -1.1290 ? 3.3967 ? 0.1519 ? -0.3205 ? 0.1127 ? 0.4494 ? -0.0928 ? -0.0912 ? 0.0581 ? -0.0584 ? -0.0330 ? 26 'X-RAY DIFFRACTION' ? refined 39.8175 47.7539 -21.6651 0.2873 ? 0.0055 ? 0.0507 ? 0.1783 ? -0.0187 ? 0.2669 ? 6.2481 ? -0.0384 ? 2.2057 ? 5.0324 ? 2.0548 ? 3.4581 ? 0.2576 ? 0.6895 ? 0.6460 ? -0.1973 ? 0.1682 ? -0.7642 ? 0.1013 ? 0.5272 ? -0.4111 ? 27 'X-RAY DIFFRACTION' ? refined 26.5303 41.6161 -14.3473 0.2721 ? -0.0322 ? -0.0130 ? 0.2415 ? -0.0072 ? 0.1223 ? 3.1156 ? -0.7004 ? -1.1852 ? 1.3410 ? -0.1797 ? 0.5718 ? 0.1014 ? -0.0820 ? -0.3430 ? -0.0973 ? -0.1557 ? 0.1283 ? -0.0419 ? 0.0978 ? 0.0254 ? 28 'X-RAY DIFFRACTION' ? refined 25.7889 48.1020 -1.7588 0.3106 ? -0.0119 ? 0.0143 ? 0.3377 ? -0.0456 ? 0.1294 ? 2.6370 ? 0.8619 ? -0.4754 ? 2.5605 ? -0.6023 ? 0.1069 ? 0.4149 ? -0.8313 ? 0.2215 ? 0.5645 ? -0.3091 ? -0.0137 ? 0.0312 ? -0.1111 ? -0.1014 ? 29 'X-RAY DIFFRACTION' ? refined 23.6768 47.2200 -7.7594 0.3278 ? 0.0127 ? 0.0013 ? 0.3369 ? -0.0100 ? 0.1345 ? 1.0759 ? 0.0574 ? -0.0019 ? 3.5797 ? 1.0898 ? 1.2840 ? -0.0482 ? -0.2067 ? -0.0737 ? 0.3669 ? 0.1222 ? 0.0213 ? -0.2282 ? -0.0382 ? -0.0643 ? 30 'X-RAY DIFFRACTION' ? refined 20.1620 50.2397 -10.1781 0.2719 ? -0.0356 ? -0.0045 ? 0.3946 ? -0.0089 ? 0.1018 ? 5.8749 ? -2.7673 ? -1.7915 ? 6.4172 ? 0.4412 ? 2.2482 ? -0.3539 ? 0.0961 ? 0.3292 ? 0.5018 ? 0.3912 ? 0.0253 ? 0.5025 ? -0.3044 ? 0.0734 ? 31 'X-RAY DIFFRACTION' ? refined 7.8486 29.0251 40.1980 0.5606 ? 0.1007 ? -0.1513 ? 0.2318 ? -0.0651 ? 0.2640 ? 5.5279 ? 1.1137 ? 0.7587 ? 0.9226 ? -0.8167 ? 1.4709 ? 0.1774 ? 0.4870 ? -0.9894 ? 0.1013 ? -0.0803 ? -0.8990 ? 0.7924 ? 0.3445 ? -0.2925 ? 32 'X-RAY DIFFRACTION' ? refined -2.3385 33.6489 50.1777 0.3844 ? -0.1366 ? -0.0539 ? 0.1671 ? 0.0791 ? 0.1919 ? 2.8870 ? -1.9109 ? 0.8368 ? 2.3068 ? -0.6689 ? 0.2621 ? -0.0705 ? -0.9606 ? -0.2567 ? -0.0340 ? 0.1574 ? -0.1417 ? 0.4612 ? -0.0581 ? 0.0831 ? 33 'X-RAY DIFFRACTION' ? refined 0.9607 51.9291 56.2818 0.2959 ? 0.1045 ? -0.0573 ? 0.1930 ? 0.0000 ? 0.2298 ? 2.9805 ? 2.1351 ? -1.2725 ? 4.5290 ? -0.7314 ? 3.0588 ? 0.2365 ? -0.3271 ? 0.1048 ? 1.0024 ? -0.0639 ? -0.0097 ? -0.1867 ? 0.0020 ? -0.2248 ? 34 'X-RAY DIFFRACTION' ? refined 11.1061 59.2981 36.2466 0.2505 ? -0.0637 ? -0.0155 ? 0.2261 ? 0.0131 ? 0.2280 ? 6.0875 ? -0.4350 ? -0.6858 ? 8.5914 ? 0.9882 ? 5.0643 ? 0.0372 ? 0.2086 ? 0.4967 ? 0.0652 ? 0.2786 ? -0.9274 ? -0.4393 ? 0.5416 ? -0.1039 ? 35 'X-RAY DIFFRACTION' ? refined -12.3429 25.9933 42.6155 0.2061 ? -0.0335 ? 0.0791 ? 0.2702 ? 0.0165 ? 0.4066 ? 2.1009 ? 2.0290 ? 0.9750 ? 3.5297 ? 2.0508 ? 1.7388 ? -0.1400 ? 0.3454 ? 0.0751 ? -0.0764 ? 0.5221 ? -0.0527 ? -0.1174 ? 0.8258 ? 0.0526 ? 36 'X-RAY DIFFRACTION' ? refined 3.5615 36.7626 40.7118 0.2847 ? -0.0009 ? -0.0003 ? 0.1134 ? -0.0333 ? 0.1272 ? 2.6293 ? 0.7554 ? 0.9156 ? 1.8036 ? 0.3016 ? 1.2589 ? 0.0607 ? 0.0030 ? -0.3541 ? -0.0031 ? 0.0690 ? -0.2726 ? 0.2542 ? -0.0253 ? -0.0741 ? 37 'X-RAY DIFFRACTION' ? refined 4.3345 29.4282 33.4244 0.8626 ? 0.1621 ? -0.1513 ? 0.4201 ? -0.0826 ? 0.2796 ? 6.0563 ? -0.2554 ? 2.1483 ? 0.1196 ? 0.5972 ? 5.4626 ? 1.1087 ? 0.2050 ? -0.8755 ? 0.7119 ? -0.0717 ? -0.0972 ? 1.9306 ? 0.6306 ? -0.4138 ? 38 'X-RAY DIFFRACTION' ? refined -2.7317 45.9964 37.4258 0.2621 ? -0.0060 ? -0.0134 ? 0.1664 ? 0.0235 ? 0.1185 ? 1.3392 ? 0.2910 ? 0.5229 ? 1.3999 ? 1.0814 ? 1.4780 ? -0.1436 ? 0.2502 ? 0.1345 ? -0.0617 ? 0.1577 ? 0.0883 ? 0.0556 ? 0.0596 ? 0.0307 ? 39 'X-RAY DIFFRACTION' ? refined 5.1461 40.1864 53.3038 0.3373 ? -0.0189 ? -0.0397 ? 0.1202 ? 0.0211 ? 0.1075 ? 4.6964 ? -2.6020 ? -0.4012 ? 3.8931 ? 1.2594 ? 0.5011 ? -0.1985 ? -0.2337 ? -0.0901 ? 0.4713 ? 0.1893 ? -0.2718 ? 0.2476 ? -0.0267 ? -0.1262 ? 40 'X-RAY DIFFRACTION' ? refined 2.2125 54.1505 50.4911 0.1988 ? 0.0076 ? -0.0326 ? 0.1451 ? 0.0032 ? 0.1297 ? 2.1197 ? 0.6162 ? 0.1642 ? 1.8822 ? 0.3713 ? 2.3878 ? -0.1329 ? 0.0275 ? 0.2446 ? 0.3543 ? 0.1626 ? 0.0635 ? -0.3553 ? 0.0432 ? 0.1052 ? 41 'X-RAY DIFFRACTION' ? refined 2.6593 49.7149 46.0489 0.2718 ? 0.0106 ? -0.0182 ? 0.1253 ? 0.0003 ? 0.1096 ? 1.6225 ? 0.7395 ? 1.0654 ? 1.2828 ? -0.0068 ? 1.6011 ? -0.0304 ? -0.0071 ? 0.0922 ? -0.1373 ? -0.0244 ? 0.0768 ? -0.1756 ? -0.0109 ? 0.0266 ? 42 'X-RAY DIFFRACTION' ? refined 5.6726 52.6310 43.9919 0.2419 ? 0.0105 ? -0.0307 ? 0.1257 ? 0.0278 ? 0.1428 ? 4.8306 ? 1.9468 ? 2.1632 ? 1.5314 ? 1.4036 ? 1.7178 ? 0.2845 ? 0.1497 ? 0.1893 ? 0.1776 ? -0.2419 ? 0.0897 ? 0.1999 ? -0.0552 ? 0.1462 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 50 ? ? A 54 ? ;chain 'A' and (resid 50 through 54 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 55 ? ? A 69 ? ;chain 'A' and (resid 55 through 69 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 70 ? ? A 74 ? ;chain 'A' and (resid 70 through 74 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 75 ? ? A 87 ? ;chain 'A' and (resid 75 through 87 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 16 ? ? B 32 ? ;chain 'B' and (resid 16 through 32 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 33 ? ? B 62 ? ;chain 'B' and (resid 33 through 62 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 63 ? ? B 79 ? ;chain 'B' and (resid 63 through 79 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 80 ? ? B 118 ? ;chain 'B' and (resid 80 through 118 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 119 ? ? B 155 ? ;chain 'B' and (resid 119 through 155 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? B 156 ? ? B 170 ? ;chain 'B' and (resid 156 through 170 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? C 51 ? ? C 60 ? ;chain 'C' and (resid 51 through 60 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? C 61 ? ? C 65 ? ;chain 'C' and (resid 61 through 65 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? C 66 ? ? C 87 ? ;chain 'C' and (resid 66 through 87 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? D 18 ? ? D 53 ? ;chain 'D' and (resid 18 through 53 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? D 54 ? ? D 71 ? ;chain 'D' and (resid 54 through 71 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? D 72 ? ? D 94 ? ;chain 'D' and (resid 72 through 94 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? D 95 ? ? D 136 ? ;chain 'D' and (resid 95 through 136 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? D 137 ? ? D 155 ? ;chain 'D' and (resid 137 through 155 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? D 156 ? ? D 170 ? ;chain 'D' and (resid 156 through 170 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? E 50 ? ? E 59 ? ;chain 'E' and (resid 50 through 59 ) ; 21 'X-RAY DIFFRACTION' 21 ? ? E 60 ? ? E 64 ? ;chain 'E' and (resid 60 through 64 ) ; 22 'X-RAY DIFFRACTION' 22 ? ? E 65 ? ? E 69 ? ;chain 'E' and (resid 65 through 69 ) ; 23 'X-RAY DIFFRACTION' 23 ? ? E 70 ? ? E 87 ? ;chain 'E' and (resid 70 through 87 ) ; 24 'X-RAY DIFFRACTION' 24 ? ? F 19 ? ? F 34 ? ;chain 'F' and (resid 19 through 34 ) ; 25 'X-RAY DIFFRACTION' 25 ? ? F 35 ? ? F 53 ? ;chain 'F' and (resid 35 through 53 ) ; 26 'X-RAY DIFFRACTION' 26 ? ? F 54 ? ? F 71 ? ;chain 'F' and (resid 54 through 71 ) ; 27 'X-RAY DIFFRACTION' 27 ? ? F 72 ? ? F 94 ? ;chain 'F' and (resid 72 through 94 ) ; 28 'X-RAY DIFFRACTION' 28 ? ? F 95 ? ? F 118 ? ;chain 'F' and (resid 95 through 118 ) ; 29 'X-RAY DIFFRACTION' 29 ? ? F 119 ? ? F 155 ? ;chain 'F' and (resid 119 through 155 ) ; 30 'X-RAY DIFFRACTION' 30 ? ? F 156 ? ? F 170 ? ;chain 'F' and (resid 156 through 170 ) ; 31 'X-RAY DIFFRACTION' 31 ? ? G 50 ? ? G 54 ? ;chain 'G' and (resid 50 through 54 ) ; 32 'X-RAY DIFFRACTION' 32 ? ? G 55 ? ? G 59 ? ;chain 'G' and (resid 55 through 59 ) ; 33 'X-RAY DIFFRACTION' 33 ? ? G 60 ? ? G 74 ? ;chain 'G' and (resid 60 through 74 ) ; 34 'X-RAY DIFFRACTION' 34 ? ? G 75 ? ? G 89 ? ;chain 'G' and (resid 75 through 89 ) ; 35 'X-RAY DIFFRACTION' 35 ? ? H 12 ? ? H 20 ? ;chain 'H' and (resid 12 through 20 ) ; 36 'X-RAY DIFFRACTION' 36 ? ? H 21 ? ? H 53 ? ;chain 'H' and (resid 21 through 53 ) ; 37 'X-RAY DIFFRACTION' 37 ? ? H 54 ? ? H 66 ? ;chain 'H' and (resid 54 through 66 ) ; 38 'X-RAY DIFFRACTION' 38 ? ? H 67 ? ? H 94 ? ;chain 'H' and (resid 67 through 94 ) ; 39 'X-RAY DIFFRACTION' 39 ? ? H 95 ? ? H 106 ? ;chain 'H' and (resid 95 through 106 ) ; 40 'X-RAY DIFFRACTION' 40 ? ? H 107 ? ? H 118 ? ;chain 'H' and (resid 107 through 118 ) ; 41 'X-RAY DIFFRACTION' 41 ? ? H 119 ? ? H 155 ? ;chain 'H' and (resid 119 through 155 ) ; 42 'X-RAY DIFFRACTION' 42 ? ? H 156 ? ? H 170 ? ;chain 'H' and (resid 156 through 170 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 6L4Z _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 F ASP 90 ? ? OG F SER 93 ? ? 2.12 2 1 O H HOH 347 ? ? O H HOH 350 ? ? 2.13 3 1 O A HOH 102 ? ? O A HOH 110 ? ? 2.17 4 1 NH1 G ARG 73 ? ? O G HOH 101 ? ? 2.17 5 1 O A HOH 108 ? ? O A HOH 111 ? ? 2.19 6 1 O B LYS 157 ? ? O B HOH 201 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O H ASP 90 ? ? 1_555 NH1 H ARG 105 ? ? 3_555 2.12 2 1 O E GLU 80 ? ? 1_555 OH H TYR 68 ? ? 4_565 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 64 ? ? -163.80 67.49 2 1 ARG B 28 ? ? -110.14 79.80 3 1 ARG B 29 ? ? -82.85 -135.81 4 1 SER B 60 ? ? -118.74 72.33 5 1 CYS B 80 ? ? 72.01 -5.36 6 1 LEU B 92 ? ? -133.98 -49.16 7 1 THR D 19 ? ? -64.50 -176.16 8 1 SER D 60 ? ? -118.44 74.29 9 1 CYS D 80 ? ? 71.13 -7.54 10 1 LEU D 92 ? ? -135.21 -49.12 11 1 ALA D 132 ? ? -74.58 20.55 12 1 LEU F 30 ? ? 59.16 -108.83 13 1 SER F 60 ? ? -116.75 72.71 14 1 CYS F 80 ? ? 70.81 -7.88 15 1 LEU F 92 ? ? -134.81 -46.24 16 1 ASP G 64 ? ? 56.44 70.75 17 1 CYS H 80 ? ? 70.96 -7.41 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id D _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 230 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.23 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 62 ? CG ? A GLU 13 CG 2 1 Y 1 A GLU 62 ? CD ? A GLU 13 CD 3 1 Y 1 A GLU 62 ? OE1 ? A GLU 13 OE1 4 1 Y 1 A GLU 62 ? OE2 ? A GLU 13 OE2 5 1 Y 1 A LYS 63 ? CG ? A LYS 14 CG 6 1 Y 1 A LYS 63 ? CD ? A LYS 14 CD 7 1 Y 1 A LYS 63 ? CE ? A LYS 14 CE 8 1 Y 1 A LYS 63 ? NZ ? A LYS 14 NZ 9 1 Y 1 A ASP 64 ? CG ? A ASP 15 CG 10 1 Y 1 A ASP 64 ? OD1 ? A ASP 15 OD1 11 1 Y 1 A ASP 64 ? OD2 ? A ASP 15 OD2 12 1 Y 1 A GLU 66 ? CG ? A GLU 17 CG 13 1 Y 1 A GLU 66 ? CD ? A GLU 17 CD 14 1 Y 1 A GLU 66 ? OE1 ? A GLU 17 OE1 15 1 Y 1 A GLU 66 ? OE2 ? A GLU 17 OE2 16 1 Y 1 B ARG 28 ? CG ? B ARG 13 CG 17 1 Y 1 B ARG 28 ? CD ? B ARG 13 CD 18 1 Y 1 B ARG 28 ? NE ? B ARG 13 NE 19 1 Y 1 B ARG 28 ? CZ ? B ARG 13 CZ 20 1 Y 1 B ARG 28 ? NH1 ? B ARG 13 NH1 21 1 Y 1 B ARG 28 ? NH2 ? B ARG 13 NH2 22 1 Y 1 B ARG 29 ? CG ? B ARG 14 CG 23 1 Y 1 B ARG 29 ? CD ? B ARG 14 CD 24 1 Y 1 B ARG 29 ? NE ? B ARG 14 NE 25 1 Y 1 B ARG 29 ? CZ ? B ARG 14 CZ 26 1 Y 1 B ARG 29 ? NH1 ? B ARG 14 NH1 27 1 Y 1 B ARG 29 ? NH2 ? B ARG 14 NH2 28 1 Y 1 B GLU 62 ? CG ? B GLU 47 CG 29 1 Y 1 B GLU 62 ? CD ? B GLU 47 CD 30 1 Y 1 B GLU 62 ? OE1 ? B GLU 47 OE1 31 1 Y 1 B GLU 62 ? OE2 ? B GLU 47 OE2 32 1 Y 1 B LYS 157 ? CG ? B LYS 142 CG 33 1 Y 1 B LYS 157 ? CD ? B LYS 142 CD 34 1 Y 1 B LYS 157 ? CE ? B LYS 142 CE 35 1 Y 1 B LYS 157 ? NZ ? B LYS 142 NZ 36 1 Y 1 B ASN 158 ? CG ? B ASN 143 CG 37 1 Y 1 B ASN 158 ? OD1 ? B ASN 143 OD1 38 1 Y 1 B ASN 158 ? ND2 ? B ASN 143 ND2 39 1 Y 1 B LYS 169 ? CG ? B LYS 154 CG 40 1 Y 1 B LYS 169 ? CD ? B LYS 154 CD 41 1 Y 1 B LYS 169 ? CE ? B LYS 154 CE 42 1 Y 1 B LYS 169 ? NZ ? B LYS 154 NZ 43 1 Y 1 C ASP 64 ? CG ? C ASP 14 CG 44 1 Y 1 C ASP 64 ? OD1 ? C ASP 14 OD1 45 1 Y 1 C ASP 64 ? OD2 ? C ASP 14 OD2 46 1 Y 1 C GLU 66 ? CG ? C GLU 16 CG 47 1 Y 1 C GLU 66 ? CD ? C GLU 16 CD 48 1 Y 1 C GLU 66 ? OE1 ? C GLU 16 OE1 49 1 Y 1 C GLU 66 ? OE2 ? C GLU 16 OE2 50 1 Y 1 D THR 18 ? OG1 ? D THR 1 OG1 51 1 Y 1 D THR 18 ? CG2 ? D THR 1 CG2 52 1 Y 1 D ARG 59 ? CG ? D ARG 42 CG 53 1 Y 1 D ARG 59 ? CD ? D ARG 42 CD 54 1 Y 1 D ARG 59 ? NE ? D ARG 42 NE 55 1 Y 1 D ARG 59 ? CZ ? D ARG 42 CZ 56 1 Y 1 D ARG 59 ? NH1 ? D ARG 42 NH1 57 1 Y 1 D ARG 59 ? NH2 ? D ARG 42 NH2 58 1 Y 1 D GLU 62 ? CG ? D GLU 45 CG 59 1 Y 1 D GLU 62 ? CD ? D GLU 45 CD 60 1 Y 1 D GLU 62 ? OE1 ? D GLU 45 OE1 61 1 Y 1 D GLU 62 ? OE2 ? D GLU 45 OE2 62 1 Y 1 D ARG 105 ? CG ? D ARG 88 CG 63 1 Y 1 D ARG 105 ? CD ? D ARG 88 CD 64 1 Y 1 D ARG 105 ? NE ? D ARG 88 NE 65 1 Y 1 D ARG 105 ? CZ ? D ARG 88 CZ 66 1 Y 1 D ARG 105 ? NH1 ? D ARG 88 NH1 67 1 Y 1 D ARG 105 ? NH2 ? D ARG 88 NH2 68 1 Y 1 D LYS 169 ? CG ? D LYS 152 CG 69 1 Y 1 D LYS 169 ? CD ? D LYS 152 CD 70 1 Y 1 D LYS 169 ? CE ? D LYS 152 CE 71 1 Y 1 D LYS 169 ? NZ ? D LYS 152 NZ 72 1 Y 1 E ASP 50 ? CG ? E ASP 1 CG 73 1 Y 1 E ASP 50 ? OD1 ? E ASP 1 OD1 74 1 Y 1 E ASP 50 ? OD2 ? E ASP 1 OD2 75 1 Y 1 E ASP 64 ? CG ? E ASP 15 CG 76 1 Y 1 E ASP 64 ? OD1 ? E ASP 15 OD1 77 1 Y 1 E ASP 64 ? OD2 ? E ASP 15 OD2 78 1 Y 1 E GLU 66 ? CG ? E GLU 17 CG 79 1 Y 1 E GLU 66 ? CD ? E GLU 17 CD 80 1 Y 1 E GLU 66 ? OE1 ? E GLU 17 OE1 81 1 Y 1 E GLU 66 ? OE2 ? E GLU 17 OE2 82 1 Y 1 E ASP 75 ? CG ? E ASP 26 CG 83 1 Y 1 E ASP 75 ? OD1 ? E ASP 26 OD1 84 1 Y 1 E ASP 75 ? OD2 ? E ASP 26 OD2 85 1 Y 1 F ARG 28 ? CG ? F ARG 10 CG 86 1 Y 1 F ARG 28 ? CD ? F ARG 10 CD 87 1 Y 1 F ARG 28 ? NE ? F ARG 10 NE 88 1 Y 1 F ARG 28 ? CZ ? F ARG 10 CZ 89 1 Y 1 F ARG 28 ? NH1 ? F ARG 10 NH1 90 1 Y 1 F ARG 28 ? NH2 ? F ARG 10 NH2 91 1 Y 1 F ARG 59 ? CG ? F ARG 41 CG 92 1 Y 1 F ARG 59 ? CD ? F ARG 41 CD 93 1 Y 1 F ARG 59 ? NE ? F ARG 41 NE 94 1 Y 1 F ARG 59 ? CZ ? F ARG 41 CZ 95 1 Y 1 F ARG 59 ? NH1 ? F ARG 41 NH1 96 1 Y 1 F ARG 59 ? NH2 ? F ARG 41 NH2 97 1 Y 1 F GLU 62 ? CG ? F GLU 44 CG 98 1 Y 1 F GLU 62 ? CD ? F GLU 44 CD 99 1 Y 1 F GLU 62 ? OE1 ? F GLU 44 OE1 100 1 Y 1 F GLU 62 ? OE2 ? F GLU 44 OE2 101 1 Y 1 F GLU 104 ? CG ? F GLU 86 CG 102 1 Y 1 F GLU 104 ? CD ? F GLU 86 CD 103 1 Y 1 F GLU 104 ? OE1 ? F GLU 86 OE1 104 1 Y 1 F GLU 104 ? OE2 ? F GLU 86 OE2 105 1 Y 1 F LYS 117 ? CG ? F LYS 99 CG 106 1 Y 1 F LYS 117 ? CD ? F LYS 99 CD 107 1 Y 1 F LYS 117 ? CE ? F LYS 99 CE 108 1 Y 1 F LYS 117 ? NZ ? F LYS 99 NZ 109 1 Y 1 F ASP 122 ? CG ? F ASP 104 CG 110 1 Y 1 F ASP 122 ? OD1 ? F ASP 104 OD1 111 1 Y 1 F ASP 122 ? OD2 ? F ASP 104 OD2 112 1 Y 1 F ASP 129 ? CG ? F ASP 111 CG 113 1 Y 1 F ASP 129 ? OD1 ? F ASP 111 OD1 114 1 Y 1 F ASP 129 ? OD2 ? F ASP 111 OD2 115 1 Y 1 G ASP 50 ? CG ? G ASP 1 CG 116 1 Y 1 G ASP 50 ? OD1 ? G ASP 1 OD1 117 1 Y 1 G ASP 50 ? OD2 ? G ASP 1 OD2 118 1 Y 1 G LYS 63 ? CG ? G LYS 14 CG 119 1 Y 1 G LYS 63 ? CD ? G LYS 14 CD 120 1 Y 1 G LYS 63 ? CE ? G LYS 14 CE 121 1 Y 1 G LYS 63 ? NZ ? G LYS 14 NZ 122 1 Y 1 G ASP 64 ? CG ? G ASP 15 CG 123 1 Y 1 G ASP 64 ? OD1 ? G ASP 15 OD1 124 1 Y 1 G ASP 64 ? OD2 ? G ASP 15 OD2 125 1 Y 1 G GLU 66 ? CG ? G GLU 17 CG 126 1 Y 1 G GLU 66 ? CD ? G GLU 17 CD 127 1 Y 1 G GLU 66 ? OE1 ? G GLU 17 OE1 128 1 Y 1 G GLU 66 ? OE2 ? G GLU 17 OE2 129 1 Y 1 G GLU 89 ? CG ? G GLU 40 CG 130 1 Y 1 G GLU 89 ? CD ? G GLU 40 CD 131 1 Y 1 G GLU 89 ? OE1 ? G GLU 40 OE1 132 1 Y 1 G GLU 89 ? OE2 ? G GLU 40 OE2 133 1 Y 1 H GLU 12 ? CG ? H GLU 1 CG 134 1 Y 1 H GLU 12 ? CD ? H GLU 1 CD 135 1 Y 1 H GLU 12 ? OE1 ? H GLU 1 OE1 136 1 Y 1 H GLU 12 ? OE2 ? H GLU 1 OE2 137 1 Y 1 H VAL 13 ? CG1 ? H VAL 2 CG1 138 1 Y 1 H VAL 13 ? CG2 ? H VAL 2 CG2 139 1 Y 1 H GLU 62 ? CG ? H GLU 51 CG 140 1 Y 1 H GLU 62 ? CD ? H GLU 51 CD 141 1 Y 1 H GLU 62 ? OE1 ? H GLU 51 OE1 142 1 Y 1 H GLU 62 ? OE2 ? H GLU 51 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 D ARG 28 ? D ARG 11 2 1 Y 1 D ARG 29 ? D ARG 12 3 1 Y 1 D LEU 30 ? D LEU 13 4 1 Y 1 D LEU 31 ? D LEU 14 5 1 Y 1 D GLY 32 ? D GLY 15 6 1 Y 1 H ARG 28 ? H ARG 17 7 1 Y 1 H ARG 29 ? H ARG 18 8 1 Y 1 H LEU 30 ? H LEU 19 9 1 Y 1 H LEU 31 ? H LEU 20 10 1 Y 1 H GLY 32 ? H GLY 21 11 1 Y 1 H SER 33 ? H SER 22 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 E5X CAD C Y N 88 E5X CAE C Y N 89 E5X CAF C Y N 90 E5X CAG C Y N 91 E5X CAH C Y N 92 E5X CAI C Y N 93 E5X CAJ C N N 94 E5X CAK C N N 95 E5X OAA O N N 96 E5X OAB O N N 97 E5X OAC O N N 98 E5X H1 H N N 99 E5X H2 H N N 100 E5X H3 H N N 101 E5X H4 H N N 102 E5X H5 H N N 103 E5X H6 H N N 104 E5X H7 H N N 105 E5X H8 H N N 106 GLN N N N N 107 GLN CA C N S 108 GLN C C N N 109 GLN O O N N 110 GLN CB C N N 111 GLN CG C N N 112 GLN CD C N N 113 GLN OE1 O N N 114 GLN NE2 N N N 115 GLN OXT O N N 116 GLN H H N N 117 GLN H2 H N N 118 GLN HA H N N 119 GLN HB2 H N N 120 GLN HB3 H N N 121 GLN HG2 H N N 122 GLN HG3 H N N 123 GLN HE21 H N N 124 GLN HE22 H N N 125 GLN HXT H N N 126 GLU N N N N 127 GLU CA C N S 128 GLU C C N N 129 GLU O O N N 130 GLU CB C N N 131 GLU CG C N N 132 GLU CD C N N 133 GLU OE1 O N N 134 GLU OE2 O N N 135 GLU OXT O N N 136 GLU H H N N 137 GLU H2 H N N 138 GLU HA H N N 139 GLU HB2 H N N 140 GLU HB3 H N N 141 GLU HG2 H N N 142 GLU HG3 H N N 143 GLU HE2 H N N 144 GLU HXT H N N 145 GLY N N N N 146 GLY CA C N N 147 GLY C C N N 148 GLY O O N N 149 GLY OXT O N N 150 GLY H H N N 151 GLY H2 H N N 152 GLY HA2 H N N 153 GLY HA3 H N N 154 GLY HXT H N N 155 HIS N N N N 156 HIS CA C N S 157 HIS C C N N 158 HIS O O N N 159 HIS CB C N N 160 HIS CG C Y N 161 HIS ND1 N Y N 162 HIS CD2 C Y N 163 HIS CE1 C Y N 164 HIS NE2 N Y N 165 HIS OXT O N N 166 HIS H H N N 167 HIS H2 H N N 168 HIS HA H N N 169 HIS HB2 H N N 170 HIS HB3 H N N 171 HIS HD1 H N N 172 HIS HD2 H N N 173 HIS HE1 H N N 174 HIS HE2 H N N 175 HIS HXT H N N 176 HOH O O N N 177 HOH H1 H N N 178 HOH H2 H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 PHE N N N N 269 PHE CA C N S 270 PHE C C N N 271 PHE O O N N 272 PHE CB C N N 273 PHE CG C Y N 274 PHE CD1 C Y N 275 PHE CD2 C Y N 276 PHE CE1 C Y N 277 PHE CE2 C Y N 278 PHE CZ C Y N 279 PHE OXT O N N 280 PHE H H N N 281 PHE H2 H N N 282 PHE HA H N N 283 PHE HB2 H N N 284 PHE HB3 H N N 285 PHE HD1 H N N 286 PHE HD2 H N N 287 PHE HE1 H N N 288 PHE HE2 H N N 289 PHE HZ H N N 290 PHE HXT H N N 291 PRO N N N N 292 PRO CA C N S 293 PRO C C N N 294 PRO O O N N 295 PRO CB C N N 296 PRO CG C N N 297 PRO CD C N N 298 PRO OXT O N N 299 PRO H H N N 300 PRO HA H N N 301 PRO HB2 H N N 302 PRO HB3 H N N 303 PRO HG2 H N N 304 PRO HG3 H N N 305 PRO HD2 H N N 306 PRO HD3 H N N 307 PRO HXT H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 E5X OAA CAJ sing N N 83 E5X CAJ CAD sing N N 84 E5X CAF CAH doub Y N 85 E5X CAF CAD sing Y N 86 E5X CAH CAE sing Y N 87 E5X CAD CAG doub Y N 88 E5X OAC CAK doub N N 89 E5X CAE CAK sing N N 90 E5X CAE CAI doub Y N 91 E5X CAG CAI sing Y N 92 E5X CAK OAB sing N N 93 E5X CAF H1 sing N N 94 E5X CAG H2 sing N N 95 E5X CAH H3 sing N N 96 E5X CAI H4 sing N N 97 E5X CAJ H5 sing N N 98 E5X CAJ H6 sing N N 99 E5X OAA H7 sing N N 100 E5X OAB H8 sing N N 101 GLN N CA sing N N 102 GLN N H sing N N 103 GLN N H2 sing N N 104 GLN CA C sing N N 105 GLN CA CB sing N N 106 GLN CA HA sing N N 107 GLN C O doub N N 108 GLN C OXT sing N N 109 GLN CB CG sing N N 110 GLN CB HB2 sing N N 111 GLN CB HB3 sing N N 112 GLN CG CD sing N N 113 GLN CG HG2 sing N N 114 GLN CG HG3 sing N N 115 GLN CD OE1 doub N N 116 GLN CD NE2 sing N N 117 GLN NE2 HE21 sing N N 118 GLN NE2 HE22 sing N N 119 GLN OXT HXT sing N N 120 GLU N CA sing N N 121 GLU N H sing N N 122 GLU N H2 sing N N 123 GLU CA C sing N N 124 GLU CA CB sing N N 125 GLU CA HA sing N N 126 GLU C O doub N N 127 GLU C OXT sing N N 128 GLU CB CG sing N N 129 GLU CB HB2 sing N N 130 GLU CB HB3 sing N N 131 GLU CG CD sing N N 132 GLU CG HG2 sing N N 133 GLU CG HG3 sing N N 134 GLU CD OE1 doub N N 135 GLU CD OE2 sing N N 136 GLU OE2 HE2 sing N N 137 GLU OXT HXT sing N N 138 GLY N CA sing N N 139 GLY N H sing N N 140 GLY N H2 sing N N 141 GLY CA C sing N N 142 GLY CA HA2 sing N N 143 GLY CA HA3 sing N N 144 GLY C O doub N N 145 GLY C OXT sing N N 146 GLY OXT HXT sing N N 147 HIS N CA sing N N 148 HIS N H sing N N 149 HIS N H2 sing N N 150 HIS CA C sing N N 151 HIS CA CB sing N N 152 HIS CA HA sing N N 153 HIS C O doub N N 154 HIS C OXT sing N N 155 HIS CB CG sing N N 156 HIS CB HB2 sing N N 157 HIS CB HB3 sing N N 158 HIS CG ND1 sing Y N 159 HIS CG CD2 doub Y N 160 HIS ND1 CE1 doub Y N 161 HIS ND1 HD1 sing N N 162 HIS CD2 NE2 sing Y N 163 HIS CD2 HD2 sing N N 164 HIS CE1 NE2 sing Y N 165 HIS CE1 HE1 sing N N 166 HIS NE2 HE2 sing N N 167 HIS OXT HXT sing N N 168 HOH O H1 sing N N 169 HOH O H2 sing N N 170 ILE N CA sing N N 171 ILE N H sing N N 172 ILE N H2 sing N N 173 ILE CA C sing N N 174 ILE CA CB sing N N 175 ILE CA HA sing N N 176 ILE C O doub N N 177 ILE C OXT sing N N 178 ILE CB CG1 sing N N 179 ILE CB CG2 sing N N 180 ILE CB HB sing N N 181 ILE CG1 CD1 sing N N 182 ILE CG1 HG12 sing N N 183 ILE CG1 HG13 sing N N 184 ILE CG2 HG21 sing N N 185 ILE CG2 HG22 sing N N 186 ILE CG2 HG23 sing N N 187 ILE CD1 HD11 sing N N 188 ILE CD1 HD12 sing N N 189 ILE CD1 HD13 sing N N 190 ILE OXT HXT sing N N 191 LEU N CA sing N N 192 LEU N H sing N N 193 LEU N H2 sing N N 194 LEU CA C sing N N 195 LEU CA CB sing N N 196 LEU CA HA sing N N 197 LEU C O doub N N 198 LEU C OXT sing N N 199 LEU CB CG sing N N 200 LEU CB HB2 sing N N 201 LEU CB HB3 sing N N 202 LEU CG CD1 sing N N 203 LEU CG CD2 sing N N 204 LEU CG HG sing N N 205 LEU CD1 HD11 sing N N 206 LEU CD1 HD12 sing N N 207 LEU CD1 HD13 sing N N 208 LEU CD2 HD21 sing N N 209 LEU CD2 HD22 sing N N 210 LEU CD2 HD23 sing N N 211 LEU OXT HXT sing N N 212 LYS N CA sing N N 213 LYS N H sing N N 214 LYS N H2 sing N N 215 LYS CA C sing N N 216 LYS CA CB sing N N 217 LYS CA HA sing N N 218 LYS C O doub N N 219 LYS C OXT sing N N 220 LYS CB CG sing N N 221 LYS CB HB2 sing N N 222 LYS CB HB3 sing N N 223 LYS CG CD sing N N 224 LYS CG HG2 sing N N 225 LYS CG HG3 sing N N 226 LYS CD CE sing N N 227 LYS CD HD2 sing N N 228 LYS CD HD3 sing N N 229 LYS CE NZ sing N N 230 LYS CE HE2 sing N N 231 LYS CE HE3 sing N N 232 LYS NZ HZ1 sing N N 233 LYS NZ HZ2 sing N N 234 LYS NZ HZ3 sing N N 235 LYS OXT HXT sing N N 236 MET N CA sing N N 237 MET N H sing N N 238 MET N H2 sing N N 239 MET CA C sing N N 240 MET CA CB sing N N 241 MET CA HA sing N N 242 MET C O doub N N 243 MET C OXT sing N N 244 MET CB CG sing N N 245 MET CB HB2 sing N N 246 MET CB HB3 sing N N 247 MET CG SD sing N N 248 MET CG HG2 sing N N 249 MET CG HG3 sing N N 250 MET SD CE sing N N 251 MET CE HE1 sing N N 252 MET CE HE2 sing N N 253 MET CE HE3 sing N N 254 MET OXT HXT sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Other government' Singapore 'Start up grant' 1 'Other government' Singapore CBRG15May045 2 'Other government' Singapore NRF2016NRF-CRP001-063 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id E5X _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id E5X _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 8 '4-(hydroxymethyl)benzoic acid' E5X 9 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5GPI _pdbx_initial_refinement_model.details ? # _pdbx_reflns_twin.domain_id 1 _pdbx_reflns_twin.crystal_id 1 _pdbx_reflns_twin.diffrn_id 1 _pdbx_reflns_twin.fraction 0.440 _pdbx_reflns_twin.operator k,h,-l _pdbx_reflns_twin.type ? _pdbx_reflns_twin.mean_F_square_over_mean_F2 ? _pdbx_reflns_twin.mean_I2_over_mean_I_square ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 2 'gel filtration' ? 3 3 'gel filtration' ? 4 4 'gel filtration' ? #