data_6LCY
# 
_entry.id   6LCY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.380 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6LCY         pdb_00006lcy 10.2210/pdb6lcy/pdb 
WWPDB D_1300014575 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6LCY 
_pdbx_database_status.recvd_initial_deposition_date   2019-11-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, Y.' 1 ? 
'Zhang, X.' 2 ? 
'Rao, F.'   3 ? 
'Wang, C.'  4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Metab' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2522-5812 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            3 
_citation.language                  ? 
_citation.page_first                1400 
_citation.page_last                 1414 
_citation.title                     
'5-IP 7 is a GPCR messenger mediating neural control of synaptotagmin-dependent insulin exocytosis and glucose homeostasis.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s42255-021-00468-7 
_citation.pdbx_database_id_PubMed   34663975 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, X.' 1  ?                   
primary 'Li, N.'    2  ?                   
primary 'Zhang, J.' 3  0000-0001-5521-2092 
primary 'Zhang, Y.' 4  ?                   
primary 'Yang, X.'  5  ?                   
primary 'Luo, Y.'   6  ?                   
primary 'Zhang, B.' 7  ?                   
primary 'Xu, Z.'    8  ?                   
primary 'Zhu, Z.'   9  ?                   
primary 'Yang, X.'  10 ?                   
primary 'Yan, Y.'   11 ?                   
primary 'Lin, B.'   12 ?                   
primary 'Wang, S.'  13 0000-0002-5013-1039 
primary 'Chen, D.'  14 ?                   
primary 'Ye, C.'    15 0000-0002-9197-8922 
primary 'Ding, Y.'  16 ?                   
primary 'Lou, M.'   17 ?                   
primary 'Wu, Q.'    18 ?                   
primary 'Hou, Z.'   19 ?                   
primary 'Zhang, K.' 20 ?                   
primary 'Liang, Z.' 21 ?                   
primary 'Wei, A.'   22 ?                   
primary 'Wang, B.'  23 ?                   
primary 'Wang, C.'  24 ?                   
primary 'Jiang, N.' 25 ?                   
primary 'Zhang, W.' 26 ?                   
primary 'Xiao, G.'  27 ?                   
primary 'Ma, C.'    28 ?                   
primary 'Ren, Y.'   29 ?                   
primary 'Qi, X.'    30 0000-0002-7139-5164 
primary 'Han, W.'   31 ?                   
primary 'Wang, C.'  32 0000-0003-3192-2780 
primary 'Rao, F.'   33 0000-0002-6038-6406 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6LCY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     104.406 
_cell.length_a_esd                 ? 
_cell.length_b                     104.406 
_cell.length_b_esd                 ? 
_cell.length_c                     53.404 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6LCY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Synaptotagmin-7             16455.207 1  ? ? 'C2B domain' ? 
2 non-polymer syn 'INOSITOL HEXAKISPHOSPHATE' 660.035   2  ? ? ?            ? 
3 water       nat water                       18.015    34 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Synaptotagmin VII,SytVII' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPGSGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFA
FDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPGSGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFA
FDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   SER n 
1 5   GLY n 
1 6   SER n 
1 7   GLY n 
1 8   SER n 
1 9   ARG n 
1 10  GLY n 
1 11  GLU n 
1 12  LEU n 
1 13  LEU n 
1 14  LEU n 
1 15  SER n 
1 16  LEU n 
1 17  CYS n 
1 18  TYR n 
1 19  ASN n 
1 20  PRO n 
1 21  SER n 
1 22  ALA n 
1 23  ASN n 
1 24  SER n 
1 25  ILE n 
1 26  ILE n 
1 27  VAL n 
1 28  ASN n 
1 29  ILE n 
1 30  ILE n 
1 31  LYS n 
1 32  ALA n 
1 33  ARG n 
1 34  ASN n 
1 35  LEU n 
1 36  LYS n 
1 37  ALA n 
1 38  MET n 
1 39  ASP n 
1 40  ILE n 
1 41  GLY n 
1 42  GLY n 
1 43  THR n 
1 44  SER n 
1 45  ASP n 
1 46  PRO n 
1 47  TYR n 
1 48  VAL n 
1 49  LYS n 
1 50  VAL n 
1 51  TRP n 
1 52  LEU n 
1 53  MET n 
1 54  TYR n 
1 55  LYS n 
1 56  ASP n 
1 57  LYS n 
1 58  ARG n 
1 59  VAL n 
1 60  GLU n 
1 61  LYS n 
1 62  LYS n 
1 63  LYS n 
1 64  THR n 
1 65  VAL n 
1 66  THR n 
1 67  LYS n 
1 68  LYS n 
1 69  ARG n 
1 70  ASN n 
1 71  LEU n 
1 72  ASN n 
1 73  PRO n 
1 74  ILE n 
1 75  PHE n 
1 76  ASN n 
1 77  GLU n 
1 78  SER n 
1 79  PHE n 
1 80  ALA n 
1 81  PHE n 
1 82  ASP n 
1 83  ILE n 
1 84  PRO n 
1 85  THR n 
1 86  GLU n 
1 87  LYS n 
1 88  LEU n 
1 89  ARG n 
1 90  GLU n 
1 91  THR n 
1 92  THR n 
1 93  ILE n 
1 94  ILE n 
1 95  ILE n 
1 96  THR n 
1 97  VAL n 
1 98  MET n 
1 99  ASP n 
1 100 LYS n 
1 101 ASP n 
1 102 LYS n 
1 103 LEU n 
1 104 SER n 
1 105 ARG n 
1 106 ASN n 
1 107 ASP n 
1 108 VAL n 
1 109 ILE n 
1 110 GLY n 
1 111 LYS n 
1 112 ILE n 
1 113 TYR n 
1 114 LEU n 
1 115 SER n 
1 116 TRP n 
1 117 LYS n 
1 118 SER n 
1 119 GLY n 
1 120 PRO n 
1 121 GLY n 
1 122 GLU n 
1 123 VAL n 
1 124 LYS n 
1 125 HIS n 
1 126 TRP n 
1 127 LYS n 
1 128 ASP n 
1 129 MET n 
1 130 ILE n 
1 131 ALA n 
1 132 ARG n 
1 133 PRO n 
1 134 ARG n 
1 135 GLN n 
1 136 PRO n 
1 137 VAL n 
1 138 ALA n 
1 139 GLN n 
1 140 TRP n 
1 141 HIS n 
1 142 GLN n 
1 143 LEU n 
1 144 LYS n 
1 145 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   145 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Syt7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SYT7_MOUSE 
_struct_ref.pdbx_db_accession          Q9R0N7 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIP
TEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA
;
_struct_ref.pdbx_align_begin           263 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6LCY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 145 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9R0N7 
_struct_ref_seq.db_align_beg                  263 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  403 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       263 
_struct_ref_seq.pdbx_auth_seq_align_end       403 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6LCY GLY A 1 ? UNP Q9R0N7 ? ? 'expression tag' 259 1 
1 6LCY PRO A 2 ? UNP Q9R0N7 ? ? 'expression tag' 260 2 
1 6LCY GLY A 3 ? UNP Q9R0N7 ? ? 'expression tag' 261 3 
1 6LCY SER A 4 ? UNP Q9R0N7 ? ? 'expression tag' 262 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                                                                      
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ?                                                                      
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                                                                      
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                                                                      
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                    ?                                                                      
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                                                                      
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                                                                      
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ?                                                                      
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                   ?                                                                      
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ?                                                                      
'H2 O'           18.015  
IHP non-polymer         . 'INOSITOL HEXAKISPHOSPHATE' 'MYO-INOSITOL HEXAKISPHOSPHATE; INOSITOL 1,2,3,4,5,6-HEXAKISPHOSPHATE' 
'C6 H18 O24 P6'  660.035 
ILE 'L-peptide linking' y ISOLEUCINE                  ?                                                                      
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                     ?                                                                      
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ?                                                                      
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ?                                                                      
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ?                                                                      
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ?                                                                      
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ?                                                                      
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ?                                                                      
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                                                                      
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                                                                      
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ?                                                                      
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6LCY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            5.11 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         75.91 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100mM NaCl, 50mM Tris-Cl, 1mM EDTA, 1mM DDT, 5mM IP6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-07-06 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            30.640 
_reflns.entry_id                         6LCY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.300 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       14840 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.100 
_reflns.pdbx_Rmerge_I_obs                0.079 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.847 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.090 
_reflns.pdbx_Rpim_I_all                  0.043 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         60777 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.300 2.340  ? ? ? ? ? ? 724 100.000 ? ? ? ? 0.518 ? ? ? ? ? ? ? ? 3.900 ? 1.002 ? ? 0.600 0.298 ? 1  1 0.802 ? ? 
2.340 2.380  ? ? ? ? ? ? 729 99.900  ? ? ? ? 0.490 ? ? ? ? ? ? ? ? 4.100 ? 0.945 ? ? 0.560 0.268 ? 2  1 0.895 ? ? 
2.380 2.430  ? ? ? ? ? ? 755 100.000 ? ? ? ? 0.419 ? ? ? ? ? ? ? ? 4.300 ? 0.922 ? ? 0.477 0.226 ? 3  1 0.906 ? ? 
2.430 2.480  ? ? ? ? ? ? 732 100.000 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 4.300 ? 0.880 ? ? 0.430 0.204 ? 4  1 0.911 ? ? 
2.480 2.530  ? ? ? ? ? ? 738 99.900  ? ? ? ? 0.331 ? ? ? ? ? ? ? ? 4.200 ? 0.898 ? ? 0.378 0.180 ? 5  1 0.932 ? ? 
2.530 2.590  ? ? ? ? ? ? 730 100.000 ? ? ? ? 0.319 ? ? ? ? ? ? ? ? 4.200 ? 0.941 ? ? 0.365 0.176 ? 6  1 0.937 ? ? 
2.590 2.660  ? ? ? ? ? ? 755 100.000 ? ? ? ? 0.255 ? ? ? ? ? ? ? ? 4.000 ? 0.918 ? ? 0.293 0.143 ? 7  1 0.953 ? ? 
2.660 2.730  ? ? ? ? ? ? 735 99.600  ? ? ? ? 0.222 ? ? ? ? ? ? ? ? 3.900 ? 0.965 ? ? 0.256 0.125 ? 8  1 0.951 ? ? 
2.730 2.810  ? ? ? ? ? ? 745 99.900  ? ? ? ? 0.200 ? ? ? ? ? ? ? ? 4.200 ? 0.853 ? ? 0.228 0.108 ? 9  1 0.962 ? ? 
2.810 2.900  ? ? ? ? ? ? 733 99.900  ? ? ? ? 0.173 ? ? ? ? ? ? ? ? 4.200 ? 0.836 ? ? 0.198 0.094 ? 10 1 0.968 ? ? 
2.900 3.000  ? ? ? ? ? ? 735 99.900  ? ? ? ? 0.122 ? ? ? ? ? ? ? ? 4.200 ? 0.858 ? ? 0.139 0.067 ? 11 1 0.982 ? ? 
3.000 3.120  ? ? ? ? ? ? 744 100.000 ? ? ? ? 0.101 ? ? ? ? ? ? ? ? 4.100 ? 0.870 ? ? 0.116 0.056 ? 12 1 0.983 ? ? 
3.120 3.260  ? ? ? ? ? ? 750 99.700  ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 3.900 ? 0.908 ? ? 0.092 0.045 ? 13 1 0.985 ? ? 
3.260 3.440  ? ? ? ? ? ? 726 99.600  ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 4.200 ? 0.888 ? ? 0.072 0.034 ? 14 1 0.990 ? ? 
3.440 3.650  ? ? ? ? ? ? 759 99.700  ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 4.200 ? 0.826 ? ? 0.059 0.028 ? 15 1 0.992 ? ? 
3.650 3.930  ? ? ? ? ? ? 736 99.700  ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 4.000 ? 0.935 ? ? 0.053 0.026 ? 16 1 0.993 ? ? 
3.930 4.330  ? ? ? ? ? ? 746 98.900  ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 4.000 ? 0.737 ? ? 0.042 0.020 ? 17 1 0.994 ? ? 
4.330 4.950  ? ? ? ? ? ? 752 99.500  ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 4.200 ? 0.607 ? ? 0.036 0.017 ? 18 1 0.997 ? ? 
4.950 6.240  ? ? ? ? ? ? 753 98.900  ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 4.000 ? 0.589 ? ? 0.037 0.018 ? 19 1 0.996 ? ? 
6.240 50.000 ? ? ? ? ? ? 763 96.700  ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 3.800 ? 0.564 ? ? 0.040 0.019 ? 20 1 0.994 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                97.880 
_refine.B_iso_mean                               33.0726 
_refine.B_iso_min                                13.930 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6LCY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3010 
_refine.ls_d_res_low                             45.2090 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14713 
_refine.ls_number_reflns_R_free                  740 
_refine.ls_number_reflns_R_work                  13973 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.7800 
_refine.ls_percent_reflns_R_free                 5.0300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2034 
_refine.ls_R_factor_R_free                       0.2387 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2016 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3N5A 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.2100 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3100 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.3010 
_refine_hist.d_res_low                        45.2090 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               1238 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       138 
_refine_hist.pdbx_B_iso_mean_ligand           57.79 
_refine_hist.pdbx_B_iso_mean_solvent          28.76 
_refine_hist.pdbx_number_atoms_protein        1120 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         84 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.3010 2.4784 . . 156 2666 96.0000  . . . 0.3197 0.0000 0.2455 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4784 2.7278 . . 141 2806 99.0000  . . . 0.2993 0.0000 0.2482 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7278 3.1224 . . 135 2829 100.0000 . . . 0.2352 0.0000 0.2352 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1224 3.9336 . . 159 2809 100.0000 . . . 0.2308 0.0000 0.1950 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9336 10     . . 149 2863 99.0000  . . . 0.2040 0.0000 0.1666 . . . . . . . . . . . 
# 
_struct.entry_id                     6LCY 
_struct.title                        'Crystal structure of Synaptotagmin-7 C2B in complex with IP6' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6LCY 
_struct_keywords.text            'Synaptotagmin-7, IP6, Insulin secretion, Exocytosis' 
_struct_keywords.pdbx_keywords   EXOCYTOSIS 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 84  ? ARG A 89  ? PRO A 342 ARG A 347 5 ? 6  
HELX_P HELX_P2 AA2 GLY A 119 ? ARG A 132 ? GLY A 377 ARG A 390 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 74  ? ASP A 82  ? ILE A 332 ASP A 340 
AA1 2 SER A 24  ? ARG A 33  ? SER A 282 ARG A 291 
AA1 3 GLU A 11  ? ASN A 19  ? GLU A 269 ASN A 277 
AA1 4 VAL A 137 ? GLN A 142 ? VAL A 395 GLN A 400 
AA2 1 LYS A 57  ? LYS A 63  ? LYS A 315 LYS A 321 
AA2 2 PRO A 46  ? TYR A 54  ? PRO A 304 TYR A 312 
AA2 3 THR A 91  ? ASP A 99  ? THR A 349 ASP A 357 
AA2 4 ASP A 107 ? LEU A 114 ? ASP A 365 LEU A 372 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 79 ? O PHE A 337 N VAL A 27  ? N VAL A 285 
AA1 2 3 O LYS A 31 ? O LYS A 289 N LEU A 13  ? N LEU A 271 
AA1 3 4 N LEU A 16 ? N LEU A 274 O VAL A 137 ? O VAL A 395 
AA2 1 2 O VAL A 59 ? O VAL A 317 N LEU A 52  ? N LEU A 310 
AA2 2 3 N TYR A 47 ? N TYR A 305 O MET A 98  ? O MET A 356 
AA2 3 4 N ILE A 93 ? N ILE A 351 O LEU A 114 ? O LEU A 372 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A IHP 501 ? 12 'binding site for residue IHP A 501' 
AC2 Software A IHP 502 ? 6  'binding site for residue IHP A 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 TYR A 47  ? TYR A 305 . ? 1_555 ? 
2  AC1 12 LYS A 49  ? LYS A 307 . ? 1_555 ? 
3  AC1 12 TRP A 51  ? TRP A 309 . ? 1_555 ? 
4  AC1 12 TYR A 54  ? TYR A 312 . ? 2_545 ? 
5  AC1 12 LYS A 55  ? LYS A 313 . ? 2_545 ? 
6  AC1 12 LYS A 57  ? LYS A 315 . ? 2_545 ? 
7  AC1 12 ARG A 58  ? ARG A 316 . ? 1_555 ? 
8  AC1 12 LYS A 61  ? LYS A 319 . ? 1_555 ? 
9  AC1 12 LYS A 63  ? LYS A 321 . ? 1_555 ? 
10 AC1 12 LYS A 87  ? LYS A 345 . ? 2_545 ? 
11 AC1 12 ASN A 106 ? ASN A 364 . ? 1_555 ? 
12 AC1 12 HOH D .   ? HOH A 625 . ? 1_555 ? 
13 AC2 6  LYS A 31  ? LYS A 289 . ? 1_555 ? 
14 AC2 6  ARG A 33  ? ARG A 291 . ? 1_555 ? 
15 AC2 6  LYS A 68  ? LYS A 326 . ? 4_654 ? 
16 AC2 6  ARG A 69  ? ARG A 327 . ? 4_654 ? 
17 AC2 6  LYS A 102 ? LYS A 360 . ? 4_654 ? 
18 AC2 6  TRP A 140 ? TRP A 398 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6LCY 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.009578 
_atom_sites.fract_transf_matrix[1][2]   0.005530 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011060 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018725 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   259 ?   ?   ?   A . n 
A 1 2   PRO 2   260 ?   ?   ?   A . n 
A 1 3   GLY 3   261 ?   ?   ?   A . n 
A 1 4   SER 4   262 ?   ?   ?   A . n 
A 1 5   GLY 5   263 ?   ?   ?   A . n 
A 1 6   SER 6   264 ?   ?   ?   A . n 
A 1 7   GLY 7   265 ?   ?   ?   A . n 
A 1 8   SER 8   266 266 SER SER A . n 
A 1 9   ARG 9   267 267 ARG ARG A . n 
A 1 10  GLY 10  268 268 GLY GLY A . n 
A 1 11  GLU 11  269 269 GLU GLU A . n 
A 1 12  LEU 12  270 270 LEU LEU A . n 
A 1 13  LEU 13  271 271 LEU LEU A . n 
A 1 14  LEU 14  272 272 LEU LEU A . n 
A 1 15  SER 15  273 273 SER SER A . n 
A 1 16  LEU 16  274 274 LEU LEU A . n 
A 1 17  CYS 17  275 275 CYS CYS A . n 
A 1 18  TYR 18  276 276 TYR TYR A . n 
A 1 19  ASN 19  277 277 ASN ASN A . n 
A 1 20  PRO 20  278 278 PRO PRO A . n 
A 1 21  SER 21  279 279 SER SER A . n 
A 1 22  ALA 22  280 280 ALA ALA A . n 
A 1 23  ASN 23  281 281 ASN ASN A . n 
A 1 24  SER 24  282 282 SER SER A . n 
A 1 25  ILE 25  283 283 ILE ILE A . n 
A 1 26  ILE 26  284 284 ILE ILE A . n 
A 1 27  VAL 27  285 285 VAL VAL A . n 
A 1 28  ASN 28  286 286 ASN ASN A . n 
A 1 29  ILE 29  287 287 ILE ILE A . n 
A 1 30  ILE 30  288 288 ILE ILE A . n 
A 1 31  LYS 31  289 289 LYS LYS A . n 
A 1 32  ALA 32  290 290 ALA ALA A . n 
A 1 33  ARG 33  291 291 ARG ARG A . n 
A 1 34  ASN 34  292 292 ASN ASN A . n 
A 1 35  LEU 35  293 293 LEU LEU A . n 
A 1 36  LYS 36  294 294 LYS LYS A . n 
A 1 37  ALA 37  295 295 ALA ALA A . n 
A 1 38  MET 38  296 296 MET MET A . n 
A 1 39  ASP 39  297 297 ASP ASP A . n 
A 1 40  ILE 40  298 298 ILE ILE A . n 
A 1 41  GLY 41  299 299 GLY GLY A . n 
A 1 42  GLY 42  300 300 GLY GLY A . n 
A 1 43  THR 43  301 301 THR THR A . n 
A 1 44  SER 44  302 302 SER SER A . n 
A 1 45  ASP 45  303 303 ASP ASP A . n 
A 1 46  PRO 46  304 304 PRO PRO A . n 
A 1 47  TYR 47  305 305 TYR TYR A . n 
A 1 48  VAL 48  306 306 VAL VAL A . n 
A 1 49  LYS 49  307 307 LYS LYS A . n 
A 1 50  VAL 50  308 308 VAL VAL A . n 
A 1 51  TRP 51  309 309 TRP TRP A . n 
A 1 52  LEU 52  310 310 LEU LEU A . n 
A 1 53  MET 53  311 311 MET MET A . n 
A 1 54  TYR 54  312 312 TYR TYR A . n 
A 1 55  LYS 55  313 313 LYS LYS A . n 
A 1 56  ASP 56  314 314 ASP ASP A . n 
A 1 57  LYS 57  315 315 LYS LYS A . n 
A 1 58  ARG 58  316 316 ARG ARG A . n 
A 1 59  VAL 59  317 317 VAL VAL A . n 
A 1 60  GLU 60  318 318 GLU GLU A . n 
A 1 61  LYS 61  319 319 LYS LYS A . n 
A 1 62  LYS 62  320 320 LYS LYS A . n 
A 1 63  LYS 63  321 321 LYS LYS A . n 
A 1 64  THR 64  322 322 THR THR A . n 
A 1 65  VAL 65  323 323 VAL VAL A . n 
A 1 66  THR 66  324 324 THR THR A . n 
A 1 67  LYS 67  325 325 LYS LYS A . n 
A 1 68  LYS 68  326 326 LYS LYS A . n 
A 1 69  ARG 69  327 327 ARG ARG A . n 
A 1 70  ASN 70  328 328 ASN ASN A . n 
A 1 71  LEU 71  329 329 LEU LEU A . n 
A 1 72  ASN 72  330 330 ASN ASN A . n 
A 1 73  PRO 73  331 331 PRO PRO A . n 
A 1 74  ILE 74  332 332 ILE ILE A . n 
A 1 75  PHE 75  333 333 PHE PHE A . n 
A 1 76  ASN 76  334 334 ASN ASN A . n 
A 1 77  GLU 77  335 335 GLU GLU A . n 
A 1 78  SER 78  336 336 SER SER A . n 
A 1 79  PHE 79  337 337 PHE PHE A . n 
A 1 80  ALA 80  338 338 ALA ALA A . n 
A 1 81  PHE 81  339 339 PHE PHE A . n 
A 1 82  ASP 82  340 340 ASP ASP A . n 
A 1 83  ILE 83  341 341 ILE ILE A . n 
A 1 84  PRO 84  342 342 PRO PRO A . n 
A 1 85  THR 85  343 343 THR THR A . n 
A 1 86  GLU 86  344 344 GLU GLU A . n 
A 1 87  LYS 87  345 345 LYS LYS A . n 
A 1 88  LEU 88  346 346 LEU LEU A . n 
A 1 89  ARG 89  347 347 ARG ARG A . n 
A 1 90  GLU 90  348 348 GLU GLU A . n 
A 1 91  THR 91  349 349 THR THR A . n 
A 1 92  THR 92  350 350 THR THR A . n 
A 1 93  ILE 93  351 351 ILE ILE A . n 
A 1 94  ILE 94  352 352 ILE ILE A . n 
A 1 95  ILE 95  353 353 ILE ILE A . n 
A 1 96  THR 96  354 354 THR THR A . n 
A 1 97  VAL 97  355 355 VAL VAL A . n 
A 1 98  MET 98  356 356 MET MET A . n 
A 1 99  ASP 99  357 357 ASP ASP A . n 
A 1 100 LYS 100 358 358 LYS LYS A . n 
A 1 101 ASP 101 359 359 ASP ASP A . n 
A 1 102 LYS 102 360 360 LYS LYS A . n 
A 1 103 LEU 103 361 361 LEU LEU A . n 
A 1 104 SER 104 362 362 SER SER A . n 
A 1 105 ARG 105 363 363 ARG ARG A . n 
A 1 106 ASN 106 364 364 ASN ASN A . n 
A 1 107 ASP 107 365 365 ASP ASP A . n 
A 1 108 VAL 108 366 366 VAL VAL A . n 
A 1 109 ILE 109 367 367 ILE ILE A . n 
A 1 110 GLY 110 368 368 GLY GLY A . n 
A 1 111 LYS 111 369 369 LYS LYS A . n 
A 1 112 ILE 112 370 370 ILE ILE A . n 
A 1 113 TYR 113 371 371 TYR TYR A . n 
A 1 114 LEU 114 372 372 LEU LEU A . n 
A 1 115 SER 115 373 373 SER SER A . n 
A 1 116 TRP 116 374 374 TRP TRP A . n 
A 1 117 LYS 117 375 375 LYS LYS A . n 
A 1 118 SER 118 376 376 SER SER A . n 
A 1 119 GLY 119 377 377 GLY GLY A . n 
A 1 120 PRO 120 378 378 PRO PRO A . n 
A 1 121 GLY 121 379 379 GLY GLY A . n 
A 1 122 GLU 122 380 380 GLU GLU A . n 
A 1 123 VAL 123 381 381 VAL VAL A . n 
A 1 124 LYS 124 382 382 LYS LYS A . n 
A 1 125 HIS 125 383 383 HIS HIS A . n 
A 1 126 TRP 126 384 384 TRP TRP A . n 
A 1 127 LYS 127 385 385 LYS LYS A . n 
A 1 128 ASP 128 386 386 ASP ASP A . n 
A 1 129 MET 129 387 387 MET MET A . n 
A 1 130 ILE 130 388 388 ILE ILE A . n 
A 1 131 ALA 131 389 389 ALA ALA A . n 
A 1 132 ARG 132 390 390 ARG ARG A . n 
A 1 133 PRO 133 391 391 PRO PRO A . n 
A 1 134 ARG 134 392 392 ARG ARG A . n 
A 1 135 GLN 135 393 393 GLN GLN A . n 
A 1 136 PRO 136 394 394 PRO PRO A . n 
A 1 137 VAL 137 395 395 VAL VAL A . n 
A 1 138 ALA 138 396 396 ALA ALA A . n 
A 1 139 GLN 139 397 397 GLN GLN A . n 
A 1 140 TRP 140 398 398 TRP TRP A . n 
A 1 141 HIS 141 399 399 HIS HIS A . n 
A 1 142 GLN 142 400 400 GLN GLN A . n 
A 1 143 LEU 143 401 401 LEU LEU A . n 
A 1 144 LYS 144 402 402 LYS LYS A . n 
A 1 145 ALA 145 403 403 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 IHP 1  501 1  IHP IHP A . 
C 2 IHP 1  502 2  IHP IHP A . 
D 3 HOH 1  601 20 HOH HOH A . 
D 3 HOH 2  602 22 HOH HOH A . 
D 3 HOH 3  603 23 HOH HOH A . 
D 3 HOH 4  604 2  HOH HOH A . 
D 3 HOH 5  605 10 HOH HOH A . 
D 3 HOH 6  606 8  HOH HOH A . 
D 3 HOH 7  607 26 HOH HOH A . 
D 3 HOH 8  608 4  HOH HOH A . 
D 3 HOH 9  609 29 HOH HOH A . 
D 3 HOH 10 610 16 HOH HOH A . 
D 3 HOH 11 611 3  HOH HOH A . 
D 3 HOH 12 612 13 HOH HOH A . 
D 3 HOH 13 613 7  HOH HOH A . 
D 3 HOH 14 614 15 HOH HOH A . 
D 3 HOH 15 615 21 HOH HOH A . 
D 3 HOH 16 616 9  HOH HOH A . 
D 3 HOH 17 617 12 HOH HOH A . 
D 3 HOH 18 618 32 HOH HOH A . 
D 3 HOH 19 619 17 HOH HOH A . 
D 3 HOH 20 620 24 HOH HOH A . 
D 3 HOH 21 621 5  HOH HOH A . 
D 3 HOH 22 622 6  HOH HOH A . 
D 3 HOH 23 623 1  HOH HOH A . 
D 3 HOH 24 624 33 HOH HOH A . 
D 3 HOH 25 625 25 HOH HOH A . 
D 3 HOH 26 626 31 HOH HOH A . 
D 3 HOH 27 627 28 HOH HOH A . 
D 3 HOH 28 628 34 HOH HOH A . 
D 3 HOH 29 629 14 HOH HOH A . 
D 3 HOH 30 630 30 HOH HOH A . 
D 3 HOH 31 631 19 HOH HOH A . 
D 3 HOH 32 632 11 HOH HOH A . 
D 3 HOH 33 633 18 HOH HOH A . 
D 3 HOH 34 634 27 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 480  ? 
1 MORE         -2   ? 
1 'SSA (A^2)'  7940 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-03-03 
2 'Structure model' 1 1 2021-11-17 
3 'Structure model' 1 2 2023-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 2 'Structure model' database_2                    
4 3 'Structure model' chem_comp_atom                
5 3 'Structure model' chem_comp_bond                
6 3 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_abbrev'            
2  2 'Structure model' '_citation.journal_id_CSD'            
3  2 'Structure model' '_citation.journal_id_ISSN'           
4  2 'Structure model' '_citation.journal_volume'            
5  2 'Structure model' '_citation.page_first'                
6  2 'Structure model' '_citation.page_last'                 
7  2 'Structure model' '_citation.pdbx_database_id_DOI'      
8  2 'Structure model' '_citation.pdbx_database_id_PubMed'   
9  2 'Structure model' '_citation.title'                     
10 2 'Structure model' '_citation.year'                      
11 2 'Structure model' '_database_2.pdbx_DOI'                
12 2 'Structure model' '_database_2.pdbx_database_accession' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? v1.13 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? .     2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? 3.25  3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .     4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .     5 
# 
_pdbx_entry_details.entry_id                 6LCY 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 288 ? ? -90.46  -71.42  
2 1 THR A 301 ? ? -125.01 -167.40 
3 1 ASP A 303 ? ? -119.32 75.96   
4 1 LYS A 313 ? ? 57.53   -129.58 
5 1 SER A 362 ? ? -115.04 -154.93 
6 1 SER A 376 ? ? -128.01 -158.78 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 259 ? A GLY 1 
2 1 Y 1 A PRO 260 ? A PRO 2 
3 1 Y 1 A GLY 261 ? A GLY 3 
4 1 Y 1 A SER 262 ? A SER 4 
5 1 Y 1 A GLY 263 ? A GLY 5 
6 1 Y 1 A SER 264 ? A SER 6 
7 1 Y 1 A GLY 265 ? A GLY 7 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
HOH O    O N N 158 
HOH H1   H N N 159 
HOH H2   H N N 160 
IHP C1   C N N 161 
IHP C2   C N N 162 
IHP C3   C N N 163 
IHP C4   C N N 164 
IHP C5   C N N 165 
IHP C6   C N N 166 
IHP O11  O N N 167 
IHP P1   P N N 168 
IHP O21  O N N 169 
IHP O31  O N N 170 
IHP O41  O N N 171 
IHP O12  O N N 172 
IHP P2   P N N 173 
IHP O22  O N N 174 
IHP O32  O N N 175 
IHP O42  O N N 176 
IHP O13  O N N 177 
IHP P3   P N N 178 
IHP O23  O N N 179 
IHP O33  O N N 180 
IHP O43  O N N 181 
IHP O14  O N N 182 
IHP P4   P N N 183 
IHP O24  O N N 184 
IHP O34  O N N 185 
IHP O44  O N N 186 
IHP O15  O N N 187 
IHP P5   P N N 188 
IHP O25  O N N 189 
IHP O35  O N N 190 
IHP O45  O N N 191 
IHP O16  O N N 192 
IHP P6   P N N 193 
IHP O26  O N N 194 
IHP O36  O N N 195 
IHP O46  O N N 196 
IHP H1   H N N 197 
IHP H2   H N N 198 
IHP H3   H N N 199 
IHP H4   H N N 200 
IHP H5   H N N 201 
IHP H6   H N N 202 
IHP H31  H N N 203 
IHP H41  H N N 204 
IHP H32  H N N 205 
IHP H42  H N N 206 
IHP H33  H N N 207 
IHP H43  H N N 208 
IHP H34  H N N 209 
IHP H44  H N N 210 
IHP H35  H N N 211 
IHP H45  H N N 212 
IHP H36  H N N 213 
IHP H46  H N N 214 
ILE N    N N N 215 
ILE CA   C N S 216 
ILE C    C N N 217 
ILE O    O N N 218 
ILE CB   C N S 219 
ILE CG1  C N N 220 
ILE CG2  C N N 221 
ILE CD1  C N N 222 
ILE OXT  O N N 223 
ILE H    H N N 224 
ILE H2   H N N 225 
ILE HA   H N N 226 
ILE HB   H N N 227 
ILE HG12 H N N 228 
ILE HG13 H N N 229 
ILE HG21 H N N 230 
ILE HG22 H N N 231 
ILE HG23 H N N 232 
ILE HD11 H N N 233 
ILE HD12 H N N 234 
ILE HD13 H N N 235 
ILE HXT  H N N 236 
LEU N    N N N 237 
LEU CA   C N S 238 
LEU C    C N N 239 
LEU O    O N N 240 
LEU CB   C N N 241 
LEU CG   C N N 242 
LEU CD1  C N N 243 
LEU CD2  C N N 244 
LEU OXT  O N N 245 
LEU H    H N N 246 
LEU H2   H N N 247 
LEU HA   H N N 248 
LEU HB2  H N N 249 
LEU HB3  H N N 250 
LEU HG   H N N 251 
LEU HD11 H N N 252 
LEU HD12 H N N 253 
LEU HD13 H N N 254 
LEU HD21 H N N 255 
LEU HD22 H N N 256 
LEU HD23 H N N 257 
LEU HXT  H N N 258 
LYS N    N N N 259 
LYS CA   C N S 260 
LYS C    C N N 261 
LYS O    O N N 262 
LYS CB   C N N 263 
LYS CG   C N N 264 
LYS CD   C N N 265 
LYS CE   C N N 266 
LYS NZ   N N N 267 
LYS OXT  O N N 268 
LYS H    H N N 269 
LYS H2   H N N 270 
LYS HA   H N N 271 
LYS HB2  H N N 272 
LYS HB3  H N N 273 
LYS HG2  H N N 274 
LYS HG3  H N N 275 
LYS HD2  H N N 276 
LYS HD3  H N N 277 
LYS HE2  H N N 278 
LYS HE3  H N N 279 
LYS HZ1  H N N 280 
LYS HZ2  H N N 281 
LYS HZ3  H N N 282 
LYS HXT  H N N 283 
MET N    N N N 284 
MET CA   C N S 285 
MET C    C N N 286 
MET O    O N N 287 
MET CB   C N N 288 
MET CG   C N N 289 
MET SD   S N N 290 
MET CE   C N N 291 
MET OXT  O N N 292 
MET H    H N N 293 
MET H2   H N N 294 
MET HA   H N N 295 
MET HB2  H N N 296 
MET HB3  H N N 297 
MET HG2  H N N 298 
MET HG3  H N N 299 
MET HE1  H N N 300 
MET HE2  H N N 301 
MET HE3  H N N 302 
MET HXT  H N N 303 
PHE N    N N N 304 
PHE CA   C N S 305 
PHE C    C N N 306 
PHE O    O N N 307 
PHE CB   C N N 308 
PHE CG   C Y N 309 
PHE CD1  C Y N 310 
PHE CD2  C Y N 311 
PHE CE1  C Y N 312 
PHE CE2  C Y N 313 
PHE CZ   C Y N 314 
PHE OXT  O N N 315 
PHE H    H N N 316 
PHE H2   H N N 317 
PHE HA   H N N 318 
PHE HB2  H N N 319 
PHE HB3  H N N 320 
PHE HD1  H N N 321 
PHE HD2  H N N 322 
PHE HE1  H N N 323 
PHE HE2  H N N 324 
PHE HZ   H N N 325 
PHE HXT  H N N 326 
PRO N    N N N 327 
PRO CA   C N S 328 
PRO C    C N N 329 
PRO O    O N N 330 
PRO CB   C N N 331 
PRO CG   C N N 332 
PRO CD   C N N 333 
PRO OXT  O N N 334 
PRO H    H N N 335 
PRO HA   H N N 336 
PRO HB2  H N N 337 
PRO HB3  H N N 338 
PRO HG2  H N N 339 
PRO HG3  H N N 340 
PRO HD2  H N N 341 
PRO HD3  H N N 342 
PRO HXT  H N N 343 
SER N    N N N 344 
SER CA   C N S 345 
SER C    C N N 346 
SER O    O N N 347 
SER CB   C N N 348 
SER OG   O N N 349 
SER OXT  O N N 350 
SER H    H N N 351 
SER H2   H N N 352 
SER HA   H N N 353 
SER HB2  H N N 354 
SER HB3  H N N 355 
SER HG   H N N 356 
SER HXT  H N N 357 
THR N    N N N 358 
THR CA   C N S 359 
THR C    C N N 360 
THR O    O N N 361 
THR CB   C N R 362 
THR OG1  O N N 363 
THR CG2  C N N 364 
THR OXT  O N N 365 
THR H    H N N 366 
THR H2   H N N 367 
THR HA   H N N 368 
THR HB   H N N 369 
THR HG1  H N N 370 
THR HG21 H N N 371 
THR HG22 H N N 372 
THR HG23 H N N 373 
THR HXT  H N N 374 
TRP N    N N N 375 
TRP CA   C N S 376 
TRP C    C N N 377 
TRP O    O N N 378 
TRP CB   C N N 379 
TRP CG   C Y N 380 
TRP CD1  C Y N 381 
TRP CD2  C Y N 382 
TRP NE1  N Y N 383 
TRP CE2  C Y N 384 
TRP CE3  C Y N 385 
TRP CZ2  C Y N 386 
TRP CZ3  C Y N 387 
TRP CH2  C Y N 388 
TRP OXT  O N N 389 
TRP H    H N N 390 
TRP H2   H N N 391 
TRP HA   H N N 392 
TRP HB2  H N N 393 
TRP HB3  H N N 394 
TRP HD1  H N N 395 
TRP HE1  H N N 396 
TRP HE3  H N N 397 
TRP HZ2  H N N 398 
TRP HZ3  H N N 399 
TRP HH2  H N N 400 
TRP HXT  H N N 401 
TYR N    N N N 402 
TYR CA   C N S 403 
TYR C    C N N 404 
TYR O    O N N 405 
TYR CB   C N N 406 
TYR CG   C Y N 407 
TYR CD1  C Y N 408 
TYR CD2  C Y N 409 
TYR CE1  C Y N 410 
TYR CE2  C Y N 411 
TYR CZ   C Y N 412 
TYR OH   O N N 413 
TYR OXT  O N N 414 
TYR H    H N N 415 
TYR H2   H N N 416 
TYR HA   H N N 417 
TYR HB2  H N N 418 
TYR HB3  H N N 419 
TYR HD1  H N N 420 
TYR HD2  H N N 421 
TYR HE1  H N N 422 
TYR HE2  H N N 423 
TYR HH   H N N 424 
TYR HXT  H N N 425 
VAL N    N N N 426 
VAL CA   C N S 427 
VAL C    C N N 428 
VAL O    O N N 429 
VAL CB   C N N 430 
VAL CG1  C N N 431 
VAL CG2  C N N 432 
VAL OXT  O N N 433 
VAL H    H N N 434 
VAL H2   H N N 435 
VAL HA   H N N 436 
VAL HB   H N N 437 
VAL HG11 H N N 438 
VAL HG12 H N N 439 
VAL HG13 H N N 440 
VAL HG21 H N N 441 
VAL HG22 H N N 442 
VAL HG23 H N N 443 
VAL HXT  H N N 444 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
IHP C1  C2   sing N N 152 
IHP C1  C6   sing N N 153 
IHP C1  O11  sing N N 154 
IHP C1  H1   sing N N 155 
IHP C2  C3   sing N N 156 
IHP C2  O12  sing N N 157 
IHP C2  H2   sing N N 158 
IHP C3  C4   sing N N 159 
IHP C3  O13  sing N N 160 
IHP C3  H3   sing N N 161 
IHP C4  C5   sing N N 162 
IHP C4  O14  sing N N 163 
IHP C4  H4   sing N N 164 
IHP C5  C6   sing N N 165 
IHP C5  O15  sing N N 166 
IHP C5  H5   sing N N 167 
IHP C6  O16  sing N N 168 
IHP C6  H6   sing N N 169 
IHP O11 P1   sing N N 170 
IHP P1  O21  doub N N 171 
IHP P1  O31  sing N N 172 
IHP P1  O41  sing N N 173 
IHP O31 H31  sing N N 174 
IHP O41 H41  sing N N 175 
IHP O12 P2   sing N N 176 
IHP P2  O22  doub N N 177 
IHP P2  O32  sing N N 178 
IHP P2  O42  sing N N 179 
IHP O32 H32  sing N N 180 
IHP O42 H42  sing N N 181 
IHP O13 P3   sing N N 182 
IHP P3  O23  doub N N 183 
IHP P3  O33  sing N N 184 
IHP P3  O43  sing N N 185 
IHP O33 H33  sing N N 186 
IHP O43 H43  sing N N 187 
IHP O14 P4   sing N N 188 
IHP P4  O24  doub N N 189 
IHP P4  O34  sing N N 190 
IHP P4  O44  sing N N 191 
IHP O34 H34  sing N N 192 
IHP O44 H44  sing N N 193 
IHP O15 P5   sing N N 194 
IHP P5  O25  doub N N 195 
IHP P5  O35  sing N N 196 
IHP P5  O45  sing N N 197 
IHP O35 H35  sing N N 198 
IHP O45 H45  sing N N 199 
IHP O16 P6   sing N N 200 
IHP P6  O26  doub N N 201 
IHP P6  O36  sing N N 202 
IHP P6  O46  sing N N 203 
IHP O36 H36  sing N N 204 
IHP O46 H46  sing N N 205 
ILE N   CA   sing N N 206 
ILE N   H    sing N N 207 
ILE N   H2   sing N N 208 
ILE CA  C    sing N N 209 
ILE CA  CB   sing N N 210 
ILE CA  HA   sing N N 211 
ILE C   O    doub N N 212 
ILE C   OXT  sing N N 213 
ILE CB  CG1  sing N N 214 
ILE CB  CG2  sing N N 215 
ILE CB  HB   sing N N 216 
ILE CG1 CD1  sing N N 217 
ILE CG1 HG12 sing N N 218 
ILE CG1 HG13 sing N N 219 
ILE CG2 HG21 sing N N 220 
ILE CG2 HG22 sing N N 221 
ILE CG2 HG23 sing N N 222 
ILE CD1 HD11 sing N N 223 
ILE CD1 HD12 sing N N 224 
ILE CD1 HD13 sing N N 225 
ILE OXT HXT  sing N N 226 
LEU N   CA   sing N N 227 
LEU N   H    sing N N 228 
LEU N   H2   sing N N 229 
LEU CA  C    sing N N 230 
LEU CA  CB   sing N N 231 
LEU CA  HA   sing N N 232 
LEU C   O    doub N N 233 
LEU C   OXT  sing N N 234 
LEU CB  CG   sing N N 235 
LEU CB  HB2  sing N N 236 
LEU CB  HB3  sing N N 237 
LEU CG  CD1  sing N N 238 
LEU CG  CD2  sing N N 239 
LEU CG  HG   sing N N 240 
LEU CD1 HD11 sing N N 241 
LEU CD1 HD12 sing N N 242 
LEU CD1 HD13 sing N N 243 
LEU CD2 HD21 sing N N 244 
LEU CD2 HD22 sing N N 245 
LEU CD2 HD23 sing N N 246 
LEU OXT HXT  sing N N 247 
LYS N   CA   sing N N 248 
LYS N   H    sing N N 249 
LYS N   H2   sing N N 250 
LYS CA  C    sing N N 251 
LYS CA  CB   sing N N 252 
LYS CA  HA   sing N N 253 
LYS C   O    doub N N 254 
LYS C   OXT  sing N N 255 
LYS CB  CG   sing N N 256 
LYS CB  HB2  sing N N 257 
LYS CB  HB3  sing N N 258 
LYS CG  CD   sing N N 259 
LYS CG  HG2  sing N N 260 
LYS CG  HG3  sing N N 261 
LYS CD  CE   sing N N 262 
LYS CD  HD2  sing N N 263 
LYS CD  HD3  sing N N 264 
LYS CE  NZ   sing N N 265 
LYS CE  HE2  sing N N 266 
LYS CE  HE3  sing N N 267 
LYS NZ  HZ1  sing N N 268 
LYS NZ  HZ2  sing N N 269 
LYS NZ  HZ3  sing N N 270 
LYS OXT HXT  sing N N 271 
MET N   CA   sing N N 272 
MET N   H    sing N N 273 
MET N   H2   sing N N 274 
MET CA  C    sing N N 275 
MET CA  CB   sing N N 276 
MET CA  HA   sing N N 277 
MET C   O    doub N N 278 
MET C   OXT  sing N N 279 
MET CB  CG   sing N N 280 
MET CB  HB2  sing N N 281 
MET CB  HB3  sing N N 282 
MET CG  SD   sing N N 283 
MET CG  HG2  sing N N 284 
MET CG  HG3  sing N N 285 
MET SD  CE   sing N N 286 
MET CE  HE1  sing N N 287 
MET CE  HE2  sing N N 288 
MET CE  HE3  sing N N 289 
MET OXT HXT  sing N N 290 
PHE N   CA   sing N N 291 
PHE N   H    sing N N 292 
PHE N   H2   sing N N 293 
PHE CA  C    sing N N 294 
PHE CA  CB   sing N N 295 
PHE CA  HA   sing N N 296 
PHE C   O    doub N N 297 
PHE C   OXT  sing N N 298 
PHE CB  CG   sing N N 299 
PHE CB  HB2  sing N N 300 
PHE CB  HB3  sing N N 301 
PHE CG  CD1  doub Y N 302 
PHE CG  CD2  sing Y N 303 
PHE CD1 CE1  sing Y N 304 
PHE CD1 HD1  sing N N 305 
PHE CD2 CE2  doub Y N 306 
PHE CD2 HD2  sing N N 307 
PHE CE1 CZ   doub Y N 308 
PHE CE1 HE1  sing N N 309 
PHE CE2 CZ   sing Y N 310 
PHE CE2 HE2  sing N N 311 
PHE CZ  HZ   sing N N 312 
PHE OXT HXT  sing N N 313 
PRO N   CA   sing N N 314 
PRO N   CD   sing N N 315 
PRO N   H    sing N N 316 
PRO CA  C    sing N N 317 
PRO CA  CB   sing N N 318 
PRO CA  HA   sing N N 319 
PRO C   O    doub N N 320 
PRO C   OXT  sing N N 321 
PRO CB  CG   sing N N 322 
PRO CB  HB2  sing N N 323 
PRO CB  HB3  sing N N 324 
PRO CG  CD   sing N N 325 
PRO CG  HG2  sing N N 326 
PRO CG  HG3  sing N N 327 
PRO CD  HD2  sing N N 328 
PRO CD  HD3  sing N N 329 
PRO OXT HXT  sing N N 330 
SER N   CA   sing N N 331 
SER N   H    sing N N 332 
SER N   H2   sing N N 333 
SER CA  C    sing N N 334 
SER CA  CB   sing N N 335 
SER CA  HA   sing N N 336 
SER C   O    doub N N 337 
SER C   OXT  sing N N 338 
SER CB  OG   sing N N 339 
SER CB  HB2  sing N N 340 
SER CB  HB3  sing N N 341 
SER OG  HG   sing N N 342 
SER OXT HXT  sing N N 343 
THR N   CA   sing N N 344 
THR N   H    sing N N 345 
THR N   H2   sing N N 346 
THR CA  C    sing N N 347 
THR CA  CB   sing N N 348 
THR CA  HA   sing N N 349 
THR C   O    doub N N 350 
THR C   OXT  sing N N 351 
THR CB  OG1  sing N N 352 
THR CB  CG2  sing N N 353 
THR CB  HB   sing N N 354 
THR OG1 HG1  sing N N 355 
THR CG2 HG21 sing N N 356 
THR CG2 HG22 sing N N 357 
THR CG2 HG23 sing N N 358 
THR OXT HXT  sing N N 359 
TRP N   CA   sing N N 360 
TRP N   H    sing N N 361 
TRP N   H2   sing N N 362 
TRP CA  C    sing N N 363 
TRP CA  CB   sing N N 364 
TRP CA  HA   sing N N 365 
TRP C   O    doub N N 366 
TRP C   OXT  sing N N 367 
TRP CB  CG   sing N N 368 
TRP CB  HB2  sing N N 369 
TRP CB  HB3  sing N N 370 
TRP CG  CD1  doub Y N 371 
TRP CG  CD2  sing Y N 372 
TRP CD1 NE1  sing Y N 373 
TRP CD1 HD1  sing N N 374 
TRP CD2 CE2  doub Y N 375 
TRP CD2 CE3  sing Y N 376 
TRP NE1 CE2  sing Y N 377 
TRP NE1 HE1  sing N N 378 
TRP CE2 CZ2  sing Y N 379 
TRP CE3 CZ3  doub Y N 380 
TRP CE3 HE3  sing N N 381 
TRP CZ2 CH2  doub Y N 382 
TRP CZ2 HZ2  sing N N 383 
TRP CZ3 CH2  sing Y N 384 
TRP CZ3 HZ3  sing N N 385 
TRP CH2 HH2  sing N N 386 
TRP OXT HXT  sing N N 387 
TYR N   CA   sing N N 388 
TYR N   H    sing N N 389 
TYR N   H2   sing N N 390 
TYR CA  C    sing N N 391 
TYR CA  CB   sing N N 392 
TYR CA  HA   sing N N 393 
TYR C   O    doub N N 394 
TYR C   OXT  sing N N 395 
TYR CB  CG   sing N N 396 
TYR CB  HB2  sing N N 397 
TYR CB  HB3  sing N N 398 
TYR CG  CD1  doub Y N 399 
TYR CG  CD2  sing Y N 400 
TYR CD1 CE1  sing Y N 401 
TYR CD1 HD1  sing N N 402 
TYR CD2 CE2  doub Y N 403 
TYR CD2 HD2  sing N N 404 
TYR CE1 CZ   doub Y N 405 
TYR CE1 HE1  sing N N 406 
TYR CE2 CZ   sing Y N 407 
TYR CE2 HE2  sing N N 408 
TYR CZ  OH   sing N N 409 
TYR OH  HH   sing N N 410 
TYR OXT HXT  sing N N 411 
VAL N   CA   sing N N 412 
VAL N   H    sing N N 413 
VAL N   H2   sing N N 414 
VAL CA  C    sing N N 415 
VAL CA  CB   sing N N 416 
VAL CA  HA   sing N N 417 
VAL C   O    doub N N 418 
VAL C   OXT  sing N N 419 
VAL CB  CG1  sing N N 420 
VAL CB  CG2  sing N N 421 
VAL CB  HB   sing N N 422 
VAL CG1 HG11 sing N N 423 
VAL CG1 HG12 sing N N 424 
VAL CG1 HG13 sing N N 425 
VAL CG2 HG21 sing N N 426 
VAL CG2 HG22 sing N N 427 
VAL CG2 HG23 sing N N 428 
VAL OXT HXT  sing N N 429 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        IHP 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   IHP 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'INOSITOL HEXAKISPHOSPHATE' IHP 
3 water                       HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   3N5A 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'light scattering' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#