data_6LXB # _entry.id 6LXB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6LXB pdb_00006lxb 10.2210/pdb6lxb/pdb WWPDB D_1300015619 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6LXB _pdbx_database_status.recvd_initial_deposition_date 2020-02-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kamata, S.' 1 0000-0002-2400-6533 'Honda, A.' 2 ? 'Ishikawa, R.' 3 ? 'Akahane, M.' 4 ? 'Oyama, T.' 5 ? 'Ishii, I.' 6 0000-0002-5367-205X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iscience _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2589-0042 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first 101727 _citation.page_last 101727 _citation.title 'PPAR alpha Ligand-Binding Domain Structures with Endogenous Fatty Acids and Fibrates.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.isci.2020.101727 _citation.pdbx_database_id_PubMed 33205029 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kamata, S.' 1 ? primary 'Oyama, T.' 2 ? primary 'Saito, K.' 3 ? primary 'Honda, A.' 4 ? primary 'Yamamoto, Y.' 5 ? primary 'Suda, K.' 6 ? primary 'Ishikawa, R.' 7 ? primary 'Itoh, T.' 8 ? primary 'Watanabe, Y.' 9 ? primary 'Shibata, T.' 10 ? primary 'Uchida, K.' 11 ? primary 'Suematsu, M.' 12 ? primary 'Ishii, I.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 106.450 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6LXB _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.778 _cell.length_a_esd ? _cell.length_b 62.317 _cell.length_b_esd ? _cell.length_c 53.544 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6LXB _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peroxisome proliferator-activated receptor alpha' 30856.053 1 ? ? ? ? 2 non-polymer syn '(2S)-2-ethoxy-3-[4-[2-[2-methyl-5-(4-methylsulfanylphenyl)pyrrol-1-yl]ethoxy]phenyl]propanoic acid' 439.567 1 ? ? ? ? 3 water nat water 18.015 11 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHC CQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIM EPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQ LVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHC CQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIM EPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQ LVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 THR n 1 6 ALA n 1 7 ASP n 1 8 LEU n 1 9 LYS n 1 10 SER n 1 11 LEU n 1 12 ALA n 1 13 LYS n 1 14 ARG n 1 15 ILE n 1 16 TYR n 1 17 GLU n 1 18 ALA n 1 19 TYR n 1 20 LEU n 1 21 LYS n 1 22 ASN n 1 23 PHE n 1 24 ASN n 1 25 MET n 1 26 ASN n 1 27 LYS n 1 28 VAL n 1 29 LYS n 1 30 ALA n 1 31 ARG n 1 32 VAL n 1 33 ILE n 1 34 LEU n 1 35 SER n 1 36 GLY n 1 37 LYS n 1 38 ALA n 1 39 SER n 1 40 ASN n 1 41 ASN n 1 42 PRO n 1 43 PRO n 1 44 PHE n 1 45 VAL n 1 46 ILE n 1 47 HIS n 1 48 ASP n 1 49 MET n 1 50 GLU n 1 51 THR n 1 52 LEU n 1 53 CYS n 1 54 MET n 1 55 ALA n 1 56 GLU n 1 57 LYS n 1 58 THR n 1 59 LEU n 1 60 VAL n 1 61 ALA n 1 62 LYS n 1 63 LEU n 1 64 VAL n 1 65 ALA n 1 66 ASN n 1 67 GLY n 1 68 ILE n 1 69 GLN n 1 70 ASN n 1 71 LYS n 1 72 GLU n 1 73 ALA n 1 74 GLU n 1 75 VAL n 1 76 ARG n 1 77 ILE n 1 78 PHE n 1 79 HIS n 1 80 CYS n 1 81 CYS n 1 82 GLN n 1 83 CYS n 1 84 THR n 1 85 SER n 1 86 VAL n 1 87 GLU n 1 88 THR n 1 89 VAL n 1 90 THR n 1 91 GLU n 1 92 LEU n 1 93 THR n 1 94 GLU n 1 95 PHE n 1 96 ALA n 1 97 LYS n 1 98 ALA n 1 99 ILE n 1 100 PRO n 1 101 GLY n 1 102 PHE n 1 103 ALA n 1 104 ASN n 1 105 LEU n 1 106 ASP n 1 107 LEU n 1 108 ASN n 1 109 ASP n 1 110 GLN n 1 111 VAL n 1 112 THR n 1 113 LEU n 1 114 LEU n 1 115 LYS n 1 116 TYR n 1 117 GLY n 1 118 VAL n 1 119 TYR n 1 120 GLU n 1 121 ALA n 1 122 ILE n 1 123 PHE n 1 124 ALA n 1 125 MET n 1 126 LEU n 1 127 SER n 1 128 SER n 1 129 VAL n 1 130 MET n 1 131 ASN n 1 132 LYS n 1 133 ASP n 1 134 GLY n 1 135 MET n 1 136 LEU n 1 137 VAL n 1 138 ALA n 1 139 TYR n 1 140 GLY n 1 141 ASN n 1 142 GLY n 1 143 PHE n 1 144 ILE n 1 145 THR n 1 146 ARG n 1 147 GLU n 1 148 PHE n 1 149 LEU n 1 150 LYS n 1 151 SER n 1 152 LEU n 1 153 ARG n 1 154 LYS n 1 155 PRO n 1 156 PHE n 1 157 CYS n 1 158 ASP n 1 159 ILE n 1 160 MET n 1 161 GLU n 1 162 PRO n 1 163 LYS n 1 164 PHE n 1 165 ASP n 1 166 PHE n 1 167 ALA n 1 168 MET n 1 169 LYS n 1 170 PHE n 1 171 ASN n 1 172 ALA n 1 173 LEU n 1 174 GLU n 1 175 LEU n 1 176 ASP n 1 177 ASP n 1 178 SER n 1 179 ASP n 1 180 ILE n 1 181 SER n 1 182 LEU n 1 183 PHE n 1 184 VAL n 1 185 ALA n 1 186 ALA n 1 187 ILE n 1 188 ILE n 1 189 CYS n 1 190 CYS n 1 191 GLY n 1 192 ASP n 1 193 ARG n 1 194 PRO n 1 195 GLY n 1 196 LEU n 1 197 LEU n 1 198 ASN n 1 199 VAL n 1 200 GLY n 1 201 HIS n 1 202 ILE n 1 203 GLU n 1 204 LYS n 1 205 MET n 1 206 GLN n 1 207 GLU n 1 208 GLY n 1 209 ILE n 1 210 VAL n 1 211 HIS n 1 212 VAL n 1 213 LEU n 1 214 ARG n 1 215 LEU n 1 216 HIS n 1 217 LEU n 1 218 GLN n 1 219 SER n 1 220 ASN n 1 221 HIS n 1 222 PRO n 1 223 ASP n 1 224 ASP n 1 225 ILE n 1 226 PHE n 1 227 LEU n 1 228 PHE n 1 229 PRO n 1 230 LYS n 1 231 LEU n 1 232 LEU n 1 233 GLN n 1 234 LYS n 1 235 MET n 1 236 ALA n 1 237 ASP n 1 238 LEU n 1 239 ARG n 1 240 GLN n 1 241 LEU n 1 242 VAL n 1 243 THR n 1 244 GLU n 1 245 HIS n 1 246 ALA n 1 247 GLN n 1 248 LEU n 1 249 VAL n 1 250 GLN n 1 251 ILE n 1 252 ILE n 1 253 LYS n 1 254 LYS n 1 255 THR n 1 256 GLU n 1 257 SER n 1 258 ASP n 1 259 ALA n 1 260 ALA n 1 261 LEU n 1 262 HIS n 1 263 PRO n 1 264 LEU n 1 265 LEU n 1 266 GLN n 1 267 GLU n 1 268 ILE n 1 269 TYR n 1 270 ARG n 1 271 ASP n 1 272 MET n 1 273 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 273 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PPARA_HUMAN _struct_ref.pdbx_db_accession Q07869 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCT SVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKF DFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTE HAQLVQIIKKTESDAALHPLLQEIYRDMY ; _struct_ref.pdbx_align_begin 200 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6LXB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 273 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q07869 _struct_ref_seq.db_align_beg 200 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 468 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 200 _struct_ref_seq.pdbx_auth_seq_align_end 468 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6LXB GLY A 1 ? UNP Q07869 ? ? 'expression tag' 196 1 1 6LXB SER A 2 ? UNP Q07869 ? ? 'expression tag' 197 2 1 6LXB HIS A 3 ? UNP Q07869 ? ? 'expression tag' 198 3 1 6LXB MET A 4 ? UNP Q07869 ? ? 'expression tag' 199 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EWR non-polymer . '(2S)-2-ethoxy-3-[4-[2-[2-methyl-5-(4-methylsulfanylphenyl)pyrrol-1-yl]ethoxy]phenyl]propanoic acid' ? 'C25 H29 N O4 S' 439.567 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6LXB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bis-Tris(pH 6.5), 25 %(w/v) PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details Mirrors _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-06-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 38.150 _reflns.entry_id 6LXB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.360 _reflns.d_resolution_low 42.950 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11702 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.400 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.056 _reflns.pdbx_Rpim_I_all 0.030 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.360 2.450 ? 3.5 ? ? ? ? 1213 99.100 ? ? ? ? 0.342 ? ? ? ? ? ? ? ? 3.200 ? ? ? ? 0.410 0.224 ? 1 1 0.921 ? ? 8.830 42.950 ? ? ? ? ? ? 235 98.100 ? ? ? ? 0.012 ? ? ? ? ? ? ? ? 3.300 ? ? ? ? 0.014 0.008 ? 2 1 1.000 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 92.080 _refine.B_iso_mean 47.2346 _refine.B_iso_min 22.460 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'SF FILE CONTAINS FRIEDEL PAIRS UNDER I/F_MINUS AND I/F_PLUS COLUMNS.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6LXB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3600 _refine.ls_d_res_low 35.3620 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11683 _refine.ls_number_reflns_R_free 1142 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.1900 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2048 _refine.ls_R_factor_R_free 0.2390 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2028 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.930 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3VI8 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.5600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3600 _refine_hist.d_res_low 35.3620 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 2107 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 256 _refine_hist.pdbx_B_iso_mean_ligand 41.39 _refine_hist.pdbx_B_iso_mean_solvent 37.92 _refine_hist.pdbx_number_atoms_protein 2037 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 59 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2113 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.545 ? 2847 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.037 ? 325 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 359 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.027 ? 1282 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3601 2.4675 . . 130 2539 93.0000 . . . 0.3296 0.0000 0.2658 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4675 2.5975 . . 135 2593 96.0000 . . . 0.2910 0.0000 0.2542 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5975 2.7602 . . 125 2612 96.0000 . . . 0.2851 0.0000 0.2474 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7602 2.9732 . . 141 2638 97.0000 . . . 0.2851 0.0000 0.2411 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9732 3.2723 . . 174 2538 96.0000 . . . 0.3079 0.0000 0.2456 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2723 3.7453 . . 152 2652 97.0000 . . . 0.2567 0.0000 0.2039 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7453 4.7169 . . 149 2593 97.0000 . . . 0.1753 0.0000 0.1612 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7169 35.3620 . . 136 2652 98.0000 . . . 0.1976 0.0000 0.1730 . . . . . . . . . . . # _struct.entry_id 6LXB _struct.title 'X-ray structure of human PPARalpha ligand binding domain-saroglitazar co-crystals obtained by soaking' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6LXB _struct_keywords.text 'Nuclear receptor, Protein-ligand complex, PPAR, Transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 5 ? PHE A 23 ? THR A 200 PHE A 218 1 ? 19 HELX_P HELX_P2 AA2 ASN A 26 ? GLY A 36 ? ASN A 221 GLY A 231 1 ? 11 HELX_P HELX_P3 AA3 ASP A 48 ? THR A 58 ? ASP A 243 THR A 253 1 ? 11 HELX_P HELX_P4 AA4 GLU A 72 ? LYS A 97 ? GLU A 267 LYS A 292 1 ? 26 HELX_P HELX_P5 AA5 ASP A 106 ? SER A 127 ? ASP A 301 SER A 322 1 ? 22 HELX_P HELX_P6 AA6 ARG A 146 ? LEU A 152 ? ARG A 341 LEU A 347 1 ? 7 HELX_P HELX_P7 AA7 PRO A 155 ? ILE A 159 ? PRO A 350 ILE A 354 5 ? 5 HELX_P HELX_P8 AA8 MET A 160 ? ALA A 172 ? MET A 355 ALA A 367 1 ? 13 HELX_P HELX_P9 AA9 ASP A 176 ? CYS A 189 ? ASP A 371 CYS A 384 1 ? 14 HELX_P HELX_P10 AB1 ASN A 198 ? HIS A 221 ? ASN A 393 HIS A 416 1 ? 24 HELX_P HELX_P11 AB2 PHE A 226 ? THR A 255 ? PHE A 421 THR A 450 1 ? 30 HELX_P HELX_P12 AB3 HIS A 262 ? ARG A 270 ? HIS A 457 ARG A 465 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 154 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 349 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 155 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 350 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.20 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 44 ? ILE A 46 ? PHE A 239 ILE A 241 AA1 2 GLY A 142 ? THR A 145 ? GLY A 337 THR A 340 AA1 3 GLY A 134 ? VAL A 137 ? GLY A 329 VAL A 332 AA1 4 MET A 130 ? ASN A 131 ? MET A 325 ASN A 326 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 46 ? N ILE A 241 O PHE A 143 ? O PHE A 338 AA1 2 3 O GLY A 142 ? O GLY A 337 N VAL A 137 ? N VAL A 332 AA1 3 4 O GLY A 134 ? O GLY A 329 N ASN A 131 ? N ASN A 326 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EWR _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'binding site for residue EWR A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 ILE A 77 ? ILE A 272 . ? 1_555 ? 2 AC1 16 PHE A 78 ? PHE A 273 . ? 1_555 ? 3 AC1 16 CYS A 80 ? CYS A 275 . ? 1_555 ? 4 AC1 16 CYS A 81 ? CYS A 276 . ? 1_555 ? 5 AC1 16 CYS A 83 ? CYS A 278 . ? 1_555 ? 6 AC1 16 THR A 84 ? THR A 279 . ? 1_555 ? 7 AC1 16 SER A 85 ? SER A 280 . ? 1_555 ? 8 AC1 16 TYR A 119 ? TYR A 314 . ? 1_555 ? 9 AC1 16 LEU A 126 ? LEU A 321 . ? 1_555 ? 10 AC1 16 MET A 135 ? MET A 330 . ? 1_555 ? 11 AC1 16 VAL A 137 ? VAL A 332 . ? 1_555 ? 12 AC1 16 ALA A 138 ? ALA A 333 . ? 1_555 ? 13 AC1 16 TYR A 139 ? TYR A 334 . ? 1_555 ? 14 AC1 16 MET A 160 ? MET A 355 . ? 1_555 ? 15 AC1 16 HIS A 245 ? HIS A 440 . ? 1_555 ? 16 AC1 16 TYR A 269 ? TYR A 464 . ? 1_555 ? # _atom_sites.entry_id 6LXB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022332 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006592 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016047 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019473 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 196 ? ? ? A . n A 1 2 SER 2 197 ? ? ? A . n A 1 3 HIS 3 198 ? ? ? A . n A 1 4 MET 4 199 ? ? ? A . n A 1 5 THR 5 200 200 THR THR A . n A 1 6 ALA 6 201 201 ALA ALA A . n A 1 7 ASP 7 202 202 ASP ASP A . n A 1 8 LEU 8 203 203 LEU LEU A . n A 1 9 LYS 9 204 204 LYS LYS A . n A 1 10 SER 10 205 205 SER SER A . n A 1 11 LEU 11 206 206 LEU LEU A . n A 1 12 ALA 12 207 207 ALA ALA A . n A 1 13 LYS 13 208 208 LYS LYS A . n A 1 14 ARG 14 209 209 ARG ARG A . n A 1 15 ILE 15 210 210 ILE ILE A . n A 1 16 TYR 16 211 211 TYR TYR A . n A 1 17 GLU 17 212 212 GLU GLU A . n A 1 18 ALA 18 213 213 ALA ALA A . n A 1 19 TYR 19 214 214 TYR TYR A . n A 1 20 LEU 20 215 215 LEU LEU A . n A 1 21 LYS 21 216 216 LYS LYS A . n A 1 22 ASN 22 217 217 ASN ASN A . n A 1 23 PHE 23 218 218 PHE PHE A . n A 1 24 ASN 24 219 219 ASN ASN A . n A 1 25 MET 25 220 220 MET MET A . n A 1 26 ASN 26 221 221 ASN ASN A . n A 1 27 LYS 27 222 222 LYS LYS A . n A 1 28 VAL 28 223 223 VAL VAL A . n A 1 29 LYS 29 224 224 LYS LYS A . n A 1 30 ALA 30 225 225 ALA ALA A . n A 1 31 ARG 31 226 226 ARG ARG A . n A 1 32 VAL 32 227 227 VAL VAL A . n A 1 33 ILE 33 228 228 ILE ILE A . n A 1 34 LEU 34 229 229 LEU LEU A . n A 1 35 SER 35 230 230 SER SER A . n A 1 36 GLY 36 231 231 GLY GLY A . n A 1 37 LYS 37 232 ? ? ? A . n A 1 38 ALA 38 233 ? ? ? A . n A 1 39 SER 39 234 ? ? ? A . n A 1 40 ASN 40 235 ? ? ? A . n A 1 41 ASN 41 236 ? ? ? A . n A 1 42 PRO 42 237 237 PRO PRO A . n A 1 43 PRO 43 238 238 PRO PRO A . n A 1 44 PHE 44 239 239 PHE PHE A . n A 1 45 VAL 45 240 240 VAL VAL A . n A 1 46 ILE 46 241 241 ILE ILE A . n A 1 47 HIS 47 242 242 HIS HIS A . n A 1 48 ASP 48 243 243 ASP ASP A . n A 1 49 MET 49 244 244 MET MET A . n A 1 50 GLU 50 245 245 GLU GLU A . n A 1 51 THR 51 246 246 THR THR A . n A 1 52 LEU 52 247 247 LEU LEU A . n A 1 53 CYS 53 248 248 CYS CYS A . n A 1 54 MET 54 249 249 MET MET A . n A 1 55 ALA 55 250 250 ALA ALA A . n A 1 56 GLU 56 251 251 GLU GLU A . n A 1 57 LYS 57 252 252 LYS LYS A . n A 1 58 THR 58 253 253 THR THR A . n A 1 59 LEU 59 254 254 LEU LEU A . n A 1 60 VAL 60 255 255 VAL VAL A . n A 1 61 ALA 61 256 256 ALA ALA A . n A 1 62 LYS 62 257 257 LYS LYS A . n A 1 63 LEU 63 258 ? ? ? A . n A 1 64 VAL 64 259 ? ? ? A . n A 1 65 ALA 65 260 ? ? ? A . n A 1 66 ASN 66 261 ? ? ? A . n A 1 67 GLY 67 262 ? ? ? A . n A 1 68 ILE 68 263 ? ? ? A . n A 1 69 GLN 69 264 ? ? ? A . n A 1 70 ASN 70 265 ? ? ? A . n A 1 71 LYS 71 266 266 LYS LYS A . n A 1 72 GLU 72 267 267 GLU GLU A . n A 1 73 ALA 73 268 268 ALA ALA A . n A 1 74 GLU 74 269 269 GLU GLU A . n A 1 75 VAL 75 270 270 VAL VAL A . n A 1 76 ARG 76 271 271 ARG ARG A . n A 1 77 ILE 77 272 272 ILE ILE A . n A 1 78 PHE 78 273 273 PHE PHE A . n A 1 79 HIS 79 274 274 HIS HIS A . n A 1 80 CYS 80 275 275 CYS CYS A . n A 1 81 CYS 81 276 276 CYS CYS A . n A 1 82 GLN 82 277 277 GLN GLN A . n A 1 83 CYS 83 278 278 CYS CYS A . n A 1 84 THR 84 279 279 THR THR A . n A 1 85 SER 85 280 280 SER SER A . n A 1 86 VAL 86 281 281 VAL VAL A . n A 1 87 GLU 87 282 282 GLU GLU A . n A 1 88 THR 88 283 283 THR THR A . n A 1 89 VAL 89 284 284 VAL VAL A . n A 1 90 THR 90 285 285 THR THR A . n A 1 91 GLU 91 286 286 GLU GLU A . n A 1 92 LEU 92 287 287 LEU LEU A . n A 1 93 THR 93 288 288 THR THR A . n A 1 94 GLU 94 289 289 GLU GLU A . n A 1 95 PHE 95 290 290 PHE PHE A . n A 1 96 ALA 96 291 291 ALA ALA A . n A 1 97 LYS 97 292 292 LYS LYS A . n A 1 98 ALA 98 293 293 ALA ALA A . n A 1 99 ILE 99 294 294 ILE ILE A . n A 1 100 PRO 100 295 295 PRO PRO A . n A 1 101 GLY 101 296 296 GLY GLY A . n A 1 102 PHE 102 297 297 PHE PHE A . n A 1 103 ALA 103 298 298 ALA ALA A . n A 1 104 ASN 104 299 299 ASN ASN A . n A 1 105 LEU 105 300 300 LEU LEU A . n A 1 106 ASP 106 301 301 ASP ASP A . n A 1 107 LEU 107 302 302 LEU LEU A . n A 1 108 ASN 108 303 303 ASN ASN A . n A 1 109 ASP 109 304 304 ASP ASP A . n A 1 110 GLN 110 305 305 GLN GLN A . n A 1 111 VAL 111 306 306 VAL VAL A . n A 1 112 THR 112 307 307 THR THR A . n A 1 113 LEU 113 308 308 LEU LEU A . n A 1 114 LEU 114 309 309 LEU LEU A . n A 1 115 LYS 115 310 310 LYS LYS A . n A 1 116 TYR 116 311 311 TYR TYR A . n A 1 117 GLY 117 312 312 GLY GLY A . n A 1 118 VAL 118 313 313 VAL VAL A . n A 1 119 TYR 119 314 314 TYR TYR A . n A 1 120 GLU 120 315 315 GLU GLU A . n A 1 121 ALA 121 316 316 ALA ALA A . n A 1 122 ILE 122 317 317 ILE ILE A . n A 1 123 PHE 123 318 318 PHE PHE A . n A 1 124 ALA 124 319 319 ALA ALA A . n A 1 125 MET 125 320 320 MET MET A . n A 1 126 LEU 126 321 321 LEU LEU A . n A 1 127 SER 127 322 322 SER SER A . n A 1 128 SER 128 323 323 SER SER A . n A 1 129 VAL 129 324 324 VAL VAL A . n A 1 130 MET 130 325 325 MET MET A . n A 1 131 ASN 131 326 326 ASN ASN A . n A 1 132 LYS 132 327 327 LYS LYS A . n A 1 133 ASP 133 328 328 ASP ASP A . n A 1 134 GLY 134 329 329 GLY GLY A . n A 1 135 MET 135 330 330 MET MET A . n A 1 136 LEU 136 331 331 LEU LEU A . n A 1 137 VAL 137 332 332 VAL VAL A . n A 1 138 ALA 138 333 333 ALA ALA A . n A 1 139 TYR 139 334 334 TYR TYR A . n A 1 140 GLY 140 335 335 GLY GLY A . n A 1 141 ASN 141 336 336 ASN ASN A . n A 1 142 GLY 142 337 337 GLY GLY A . n A 1 143 PHE 143 338 338 PHE PHE A . n A 1 144 ILE 144 339 339 ILE ILE A . n A 1 145 THR 145 340 340 THR THR A . n A 1 146 ARG 146 341 341 ARG ARG A . n A 1 147 GLU 147 342 342 GLU GLU A . n A 1 148 PHE 148 343 343 PHE PHE A . n A 1 149 LEU 149 344 344 LEU LEU A . n A 1 150 LYS 150 345 345 LYS LYS A . n A 1 151 SER 151 346 346 SER SER A . n A 1 152 LEU 152 347 347 LEU LEU A . n A 1 153 ARG 153 348 348 ARG ARG A . n A 1 154 LYS 154 349 349 LYS LYS A . n A 1 155 PRO 155 350 350 PRO PRO A . n A 1 156 PHE 156 351 351 PHE PHE A . n A 1 157 CYS 157 352 352 CYS CYS A . n A 1 158 ASP 158 353 353 ASP ASP A . n A 1 159 ILE 159 354 354 ILE ILE A . n A 1 160 MET 160 355 355 MET MET A . n A 1 161 GLU 161 356 356 GLU GLU A . n A 1 162 PRO 162 357 357 PRO PRO A . n A 1 163 LYS 163 358 358 LYS LYS A . n A 1 164 PHE 164 359 359 PHE PHE A . n A 1 165 ASP 165 360 360 ASP ASP A . n A 1 166 PHE 166 361 361 PHE PHE A . n A 1 167 ALA 167 362 362 ALA ALA A . n A 1 168 MET 168 363 363 MET MET A . n A 1 169 LYS 169 364 364 LYS LYS A . n A 1 170 PHE 170 365 365 PHE PHE A . n A 1 171 ASN 171 366 366 ASN ASN A . n A 1 172 ALA 172 367 367 ALA ALA A . n A 1 173 LEU 173 368 368 LEU LEU A . n A 1 174 GLU 174 369 369 GLU GLU A . n A 1 175 LEU 175 370 370 LEU LEU A . n A 1 176 ASP 176 371 371 ASP ASP A . n A 1 177 ASP 177 372 372 ASP ASP A . n A 1 178 SER 178 373 373 SER SER A . n A 1 179 ASP 179 374 374 ASP ASP A . n A 1 180 ILE 180 375 375 ILE ILE A . n A 1 181 SER 181 376 376 SER SER A . n A 1 182 LEU 182 377 377 LEU LEU A . n A 1 183 PHE 183 378 378 PHE PHE A . n A 1 184 VAL 184 379 379 VAL VAL A . n A 1 185 ALA 185 380 380 ALA ALA A . n A 1 186 ALA 186 381 381 ALA ALA A . n A 1 187 ILE 187 382 382 ILE ILE A . n A 1 188 ILE 188 383 383 ILE ILE A . n A 1 189 CYS 189 384 384 CYS CYS A . n A 1 190 CYS 190 385 385 CYS CYS A . n A 1 191 GLY 191 386 386 GLY GLY A . n A 1 192 ASP 192 387 387 ASP ASP A . n A 1 193 ARG 193 388 388 ARG ARG A . n A 1 194 PRO 194 389 389 PRO PRO A . n A 1 195 GLY 195 390 390 GLY GLY A . n A 1 196 LEU 196 391 391 LEU LEU A . n A 1 197 LEU 197 392 392 LEU LEU A . n A 1 198 ASN 198 393 393 ASN ASN A . n A 1 199 VAL 199 394 394 VAL VAL A . n A 1 200 GLY 200 395 395 GLY GLY A . n A 1 201 HIS 201 396 396 HIS HIS A . n A 1 202 ILE 202 397 397 ILE ILE A . n A 1 203 GLU 203 398 398 GLU GLU A . n A 1 204 LYS 204 399 399 LYS LYS A . n A 1 205 MET 205 400 400 MET MET A . n A 1 206 GLN 206 401 401 GLN GLN A . n A 1 207 GLU 207 402 402 GLU GLU A . n A 1 208 GLY 208 403 403 GLY GLY A . n A 1 209 ILE 209 404 404 ILE ILE A . n A 1 210 VAL 210 405 405 VAL VAL A . n A 1 211 HIS 211 406 406 HIS HIS A . n A 1 212 VAL 212 407 407 VAL VAL A . n A 1 213 LEU 213 408 408 LEU LEU A . n A 1 214 ARG 214 409 409 ARG ARG A . n A 1 215 LEU 215 410 410 LEU LEU A . n A 1 216 HIS 216 411 411 HIS HIS A . n A 1 217 LEU 217 412 412 LEU LEU A . n A 1 218 GLN 218 413 413 GLN GLN A . n A 1 219 SER 219 414 414 SER SER A . n A 1 220 ASN 220 415 415 ASN ASN A . n A 1 221 HIS 221 416 416 HIS HIS A . n A 1 222 PRO 222 417 417 PRO PRO A . n A 1 223 ASP 223 418 418 ASP ASP A . n A 1 224 ASP 224 419 419 ASP ASP A . n A 1 225 ILE 225 420 420 ILE ILE A . n A 1 226 PHE 226 421 421 PHE PHE A . n A 1 227 LEU 227 422 422 LEU LEU A . n A 1 228 PHE 228 423 423 PHE PHE A . n A 1 229 PRO 229 424 424 PRO PRO A . n A 1 230 LYS 230 425 425 LYS LYS A . n A 1 231 LEU 231 426 426 LEU LEU A . n A 1 232 LEU 232 427 427 LEU LEU A . n A 1 233 GLN 233 428 428 GLN GLN A . n A 1 234 LYS 234 429 429 LYS LYS A . n A 1 235 MET 235 430 430 MET MET A . n A 1 236 ALA 236 431 431 ALA ALA A . n A 1 237 ASP 237 432 432 ASP ASP A . n A 1 238 LEU 238 433 433 LEU LEU A . n A 1 239 ARG 239 434 434 ARG ARG A . n A 1 240 GLN 240 435 435 GLN GLN A . n A 1 241 LEU 241 436 436 LEU LEU A . n A 1 242 VAL 242 437 437 VAL VAL A . n A 1 243 THR 243 438 438 THR THR A . n A 1 244 GLU 244 439 439 GLU GLU A . n A 1 245 HIS 245 440 440 HIS HIS A . n A 1 246 ALA 246 441 441 ALA ALA A . n A 1 247 GLN 247 442 442 GLN GLN A . n A 1 248 LEU 248 443 443 LEU LEU A . n A 1 249 VAL 249 444 444 VAL VAL A . n A 1 250 GLN 250 445 445 GLN GLN A . n A 1 251 ILE 251 446 446 ILE ILE A . n A 1 252 ILE 252 447 447 ILE ILE A . n A 1 253 LYS 253 448 448 LYS LYS A . n A 1 254 LYS 254 449 449 LYS LYS A . n A 1 255 THR 255 450 450 THR THR A . n A 1 256 GLU 256 451 451 GLU GLU A . n A 1 257 SER 257 452 452 SER SER A . n A 1 258 ASP 258 453 453 ASP ASP A . n A 1 259 ALA 259 454 454 ALA ALA A . n A 1 260 ALA 260 455 455 ALA ALA A . n A 1 261 LEU 261 456 456 LEU LEU A . n A 1 262 HIS 262 457 457 HIS HIS A . n A 1 263 PRO 263 458 458 PRO PRO A . n A 1 264 LEU 264 459 459 LEU LEU A . n A 1 265 LEU 265 460 460 LEU LEU A . n A 1 266 GLN 266 461 461 GLN GLN A . n A 1 267 GLU 267 462 462 GLU GLU A . n A 1 268 ILE 268 463 463 ILE ILE A . n A 1 269 TYR 269 464 464 TYR TYR A . n A 1 270 ARG 270 465 465 ARG ARG A . n A 1 271 ASP 271 466 466 ASP ASP A . n A 1 272 MET 272 467 467 MET MET A . n A 1 273 TYR 273 468 468 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EWR 1 501 1 EWR S0R A . C 3 HOH 1 601 8 HOH HOH A . C 3 HOH 2 602 1 HOH HOH A . C 3 HOH 3 603 7 HOH HOH A . C 3 HOH 4 604 4 HOH HOH A . C 3 HOH 5 605 10 HOH HOH A . C 3 HOH 6 606 3 HOH HOH A . C 3 HOH 7 607 6 HOH HOH A . C 3 HOH 8 608 2 HOH HOH A . C 3 HOH 9 609 5 HOH HOH A . C 3 HOH 10 610 9 HOH HOH A . C 3 HOH 11 611 11 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12680 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-11 2 'Structure model' 1 1 2020-12-02 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 6LXB _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.080 _pdbx_phasing_MR.d_res_low_rotation 39.600 _pdbx_phasing_MR.d_res_high_translation 2.080 _pdbx_phasing_MR.d_res_low_translation 39.600 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.21 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.7.16 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1-2575-000 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 5 # _pdbx_entry_details.entry_id 6LXB _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 230 ? ? -78.87 -84.64 2 1 GLU A 267 ? ? 146.80 130.52 3 1 CYS A 384 ? ? -92.22 33.47 4 1 THR A 450 ? ? -83.28 -159.46 5 1 GLU A 451 ? ? 40.32 76.54 6 1 MET A 467 ? ? -77.80 -94.80 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 196 ? A GLY 1 2 1 Y 1 A SER 197 ? A SER 2 3 1 Y 1 A HIS 198 ? A HIS 3 4 1 Y 1 A MET 199 ? A MET 4 5 1 Y 1 A LYS 232 ? A LYS 37 6 1 Y 1 A ALA 233 ? A ALA 38 7 1 Y 1 A SER 234 ? A SER 39 8 1 Y 1 A ASN 235 ? A ASN 40 9 1 Y 1 A ASN 236 ? A ASN 41 10 1 Y 1 A LEU 258 ? A LEU 63 11 1 Y 1 A VAL 259 ? A VAL 64 12 1 Y 1 A ALA 260 ? A ALA 65 13 1 Y 1 A ASN 261 ? A ASN 66 14 1 Y 1 A GLY 262 ? A GLY 67 15 1 Y 1 A ILE 263 ? A ILE 68 16 1 Y 1 A GLN 264 ? A GLN 69 17 1 Y 1 A ASN 265 ? A ASN 70 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EWR C07 C N N 88 EWR C08 C Y N 89 EWR C09 C Y N 90 EWR C10 C N N 91 EWR C11 C Y N 92 EWR C12 C Y N 93 EWR C13 C Y N 94 EWR C14 C N N 95 EWR C15 C N N 96 EWR C16 C Y N 97 EWR C17 C N S 98 EWR C18 C Y N 99 EWR C19 C Y N 100 EWR C20 C Y N 101 EWR C21 C Y N 102 EWR C22 C Y N 103 EWR C23 C Y N 104 EWR C24 C Y N 105 EWR C25 C Y N 106 EWR C26 C Y N 107 EWR C27 C Y N 108 EWR C28 C N N 109 EWR C29 C N N 110 EWR C30 C N N 111 EWR C31 C N N 112 EWR N06 N Y N 113 EWR O02 O N N 114 EWR O03 O N N 115 EWR O04 O N N 116 EWR O05 O N N 117 EWR S01 S N N 118 EWR H071 H N N 119 EWR H072 H N N 120 EWR H101 H N N 121 EWR H102 H N N 122 EWR H111 H N N 123 EWR H121 H N N 124 EWR H142 H N N 125 EWR H141 H N N 126 EWR H143 H N N 127 EWR H151 H N N 128 EWR H152 H N N 129 EWR H171 H N N 130 EWR H191 H N N 131 EWR H201 H N N 132 EWR H211 H N N 133 EWR H221 H N N 134 EWR H231 H N N 135 EWR H241 H N N 136 EWR H251 H N N 137 EWR H261 H N N 138 EWR H292 H N N 139 EWR H291 H N N 140 EWR H303 H N N 141 EWR H302 H N N 142 EWR H301 H N N 143 EWR H313 H N N 144 EWR H312 H N N 145 EWR H311 H N N 146 EWR H1 H N N 147 GLN N N N N 148 GLN CA C N S 149 GLN C C N N 150 GLN O O N N 151 GLN CB C N N 152 GLN CG C N N 153 GLN CD C N N 154 GLN OE1 O N N 155 GLN NE2 N N N 156 GLN OXT O N N 157 GLN H H N N 158 GLN H2 H N N 159 GLN HA H N N 160 GLN HB2 H N N 161 GLN HB3 H N N 162 GLN HG2 H N N 163 GLN HG3 H N N 164 GLN HE21 H N N 165 GLN HE22 H N N 166 GLN HXT H N N 167 GLU N N N N 168 GLU CA C N S 169 GLU C C N N 170 GLU O O N N 171 GLU CB C N N 172 GLU CG C N N 173 GLU CD C N N 174 GLU OE1 O N N 175 GLU OE2 O N N 176 GLU OXT O N N 177 GLU H H N N 178 GLU H2 H N N 179 GLU HA H N N 180 GLU HB2 H N N 181 GLU HB3 H N N 182 GLU HG2 H N N 183 GLU HG3 H N N 184 GLU HE2 H N N 185 GLU HXT H N N 186 GLY N N N N 187 GLY CA C N N 188 GLY C C N N 189 GLY O O N N 190 GLY OXT O N N 191 GLY H H N N 192 GLY H2 H N N 193 GLY HA2 H N N 194 GLY HA3 H N N 195 GLY HXT H N N 196 HIS N N N N 197 HIS CA C N S 198 HIS C C N N 199 HIS O O N N 200 HIS CB C N N 201 HIS CG C Y N 202 HIS ND1 N Y N 203 HIS CD2 C Y N 204 HIS CE1 C Y N 205 HIS NE2 N Y N 206 HIS OXT O N N 207 HIS H H N N 208 HIS H2 H N N 209 HIS HA H N N 210 HIS HB2 H N N 211 HIS HB3 H N N 212 HIS HD1 H N N 213 HIS HD2 H N N 214 HIS HE1 H N N 215 HIS HE2 H N N 216 HIS HXT H N N 217 HOH O O N N 218 HOH H1 H N N 219 HOH H2 H N N 220 ILE N N N N 221 ILE CA C N S 222 ILE C C N N 223 ILE O O N N 224 ILE CB C N S 225 ILE CG1 C N N 226 ILE CG2 C N N 227 ILE CD1 C N N 228 ILE OXT O N N 229 ILE H H N N 230 ILE H2 H N N 231 ILE HA H N N 232 ILE HB H N N 233 ILE HG12 H N N 234 ILE HG13 H N N 235 ILE HG21 H N N 236 ILE HG22 H N N 237 ILE HG23 H N N 238 ILE HD11 H N N 239 ILE HD12 H N N 240 ILE HD13 H N N 241 ILE HXT H N N 242 LEU N N N N 243 LEU CA C N S 244 LEU C C N N 245 LEU O O N N 246 LEU CB C N N 247 LEU CG C N N 248 LEU CD1 C N N 249 LEU CD2 C N N 250 LEU OXT O N N 251 LEU H H N N 252 LEU H2 H N N 253 LEU HA H N N 254 LEU HB2 H N N 255 LEU HB3 H N N 256 LEU HG H N N 257 LEU HD11 H N N 258 LEU HD12 H N N 259 LEU HD13 H N N 260 LEU HD21 H N N 261 LEU HD22 H N N 262 LEU HD23 H N N 263 LEU HXT H N N 264 LYS N N N N 265 LYS CA C N S 266 LYS C C N N 267 LYS O O N N 268 LYS CB C N N 269 LYS CG C N N 270 LYS CD C N N 271 LYS CE C N N 272 LYS NZ N N N 273 LYS OXT O N N 274 LYS H H N N 275 LYS H2 H N N 276 LYS HA H N N 277 LYS HB2 H N N 278 LYS HB3 H N N 279 LYS HG2 H N N 280 LYS HG3 H N N 281 LYS HD2 H N N 282 LYS HD3 H N N 283 LYS HE2 H N N 284 LYS HE3 H N N 285 LYS HZ1 H N N 286 LYS HZ2 H N N 287 LYS HZ3 H N N 288 LYS HXT H N N 289 MET N N N N 290 MET CA C N S 291 MET C C N N 292 MET O O N N 293 MET CB C N N 294 MET CG C N N 295 MET SD S N N 296 MET CE C N N 297 MET OXT O N N 298 MET H H N N 299 MET H2 H N N 300 MET HA H N N 301 MET HB2 H N N 302 MET HB3 H N N 303 MET HG2 H N N 304 MET HG3 H N N 305 MET HE1 H N N 306 MET HE2 H N N 307 MET HE3 H N N 308 MET HXT H N N 309 PHE N N N N 310 PHE CA C N S 311 PHE C C N N 312 PHE O O N N 313 PHE CB C N N 314 PHE CG C Y N 315 PHE CD1 C Y N 316 PHE CD2 C Y N 317 PHE CE1 C Y N 318 PHE CE2 C Y N 319 PHE CZ C Y N 320 PHE OXT O N N 321 PHE H H N N 322 PHE H2 H N N 323 PHE HA H N N 324 PHE HB2 H N N 325 PHE HB3 H N N 326 PHE HD1 H N N 327 PHE HD2 H N N 328 PHE HE1 H N N 329 PHE HE2 H N N 330 PHE HZ H N N 331 PHE HXT H N N 332 PRO N N N N 333 PRO CA C N S 334 PRO C C N N 335 PRO O O N N 336 PRO CB C N N 337 PRO CG C N N 338 PRO CD C N N 339 PRO OXT O N N 340 PRO H H N N 341 PRO HA H N N 342 PRO HB2 H N N 343 PRO HB3 H N N 344 PRO HG2 H N N 345 PRO HG3 H N N 346 PRO HD2 H N N 347 PRO HD3 H N N 348 PRO HXT H N N 349 SER N N N N 350 SER CA C N S 351 SER C C N N 352 SER O O N N 353 SER CB C N N 354 SER OG O N N 355 SER OXT O N N 356 SER H H N N 357 SER H2 H N N 358 SER HA H N N 359 SER HB2 H N N 360 SER HB3 H N N 361 SER HG H N N 362 SER HXT H N N 363 THR N N N N 364 THR CA C N S 365 THR C C N N 366 THR O O N N 367 THR CB C N R 368 THR OG1 O N N 369 THR CG2 C N N 370 THR OXT O N N 371 THR H H N N 372 THR H2 H N N 373 THR HA H N N 374 THR HB H N N 375 THR HG1 H N N 376 THR HG21 H N N 377 THR HG22 H N N 378 THR HG23 H N N 379 THR HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EWR C19 C25 doub Y N 83 EWR C19 C13 sing Y N 84 EWR C11 C12 sing Y N 85 EWR C11 C08 doub Y N 86 EWR C12 C09 doub Y N 87 EWR C25 C27 sing Y N 88 EWR C08 C13 sing N N 89 EWR C08 N06 sing Y N 90 EWR C09 C14 sing N N 91 EWR C09 N06 sing Y N 92 EWR C13 C20 doub Y N 93 EWR N06 C07 sing N N 94 EWR C27 S01 sing N N 95 EWR C27 C26 doub Y N 96 EWR S01 C31 sing N N 97 EWR C07 C10 sing N N 98 EWR C20 C26 sing Y N 99 EWR C10 O02 sing N N 100 EWR O02 C18 sing N N 101 EWR C24 C18 doub Y N 102 EWR C24 C22 sing Y N 103 EWR C18 C23 sing Y N 104 EWR C30 C29 sing N N 105 EWR C22 C16 doub Y N 106 EWR C23 C21 doub Y N 107 EWR C29 O03 sing N N 108 EWR O03 C17 sing N N 109 EWR C16 C21 sing Y N 110 EWR C16 C15 sing N N 111 EWR C17 C15 sing N N 112 EWR C17 C28 sing N N 113 EWR C28 O04 doub N N 114 EWR C28 O05 sing N N 115 EWR C07 H071 sing N N 116 EWR C07 H072 sing N N 117 EWR C10 H101 sing N N 118 EWR C10 H102 sing N N 119 EWR C11 H111 sing N N 120 EWR C12 H121 sing N N 121 EWR C14 H142 sing N N 122 EWR C14 H141 sing N N 123 EWR C14 H143 sing N N 124 EWR C15 H151 sing N N 125 EWR C15 H152 sing N N 126 EWR C17 H171 sing N N 127 EWR C19 H191 sing N N 128 EWR C20 H201 sing N N 129 EWR C21 H211 sing N N 130 EWR C22 H221 sing N N 131 EWR C23 H231 sing N N 132 EWR C24 H241 sing N N 133 EWR C25 H251 sing N N 134 EWR C26 H261 sing N N 135 EWR C29 H292 sing N N 136 EWR C29 H291 sing N N 137 EWR C30 H303 sing N N 138 EWR C30 H302 sing N N 139 EWR C30 H301 sing N N 140 EWR C31 H313 sing N N 141 EWR C31 H312 sing N N 142 EWR C31 H311 sing N N 143 EWR O05 H1 sing N N 144 GLN N CA sing N N 145 GLN N H sing N N 146 GLN N H2 sing N N 147 GLN CA C sing N N 148 GLN CA CB sing N N 149 GLN CA HA sing N N 150 GLN C O doub N N 151 GLN C OXT sing N N 152 GLN CB CG sing N N 153 GLN CB HB2 sing N N 154 GLN CB HB3 sing N N 155 GLN CG CD sing N N 156 GLN CG HG2 sing N N 157 GLN CG HG3 sing N N 158 GLN CD OE1 doub N N 159 GLN CD NE2 sing N N 160 GLN NE2 HE21 sing N N 161 GLN NE2 HE22 sing N N 162 GLN OXT HXT sing N N 163 GLU N CA sing N N 164 GLU N H sing N N 165 GLU N H2 sing N N 166 GLU CA C sing N N 167 GLU CA CB sing N N 168 GLU CA HA sing N N 169 GLU C O doub N N 170 GLU C OXT sing N N 171 GLU CB CG sing N N 172 GLU CB HB2 sing N N 173 GLU CB HB3 sing N N 174 GLU CG CD sing N N 175 GLU CG HG2 sing N N 176 GLU CG HG3 sing N N 177 GLU CD OE1 doub N N 178 GLU CD OE2 sing N N 179 GLU OE2 HE2 sing N N 180 GLU OXT HXT sing N N 181 GLY N CA sing N N 182 GLY N H sing N N 183 GLY N H2 sing N N 184 GLY CA C sing N N 185 GLY CA HA2 sing N N 186 GLY CA HA3 sing N N 187 GLY C O doub N N 188 GLY C OXT sing N N 189 GLY OXT HXT sing N N 190 HIS N CA sing N N 191 HIS N H sing N N 192 HIS N H2 sing N N 193 HIS CA C sing N N 194 HIS CA CB sing N N 195 HIS CA HA sing N N 196 HIS C O doub N N 197 HIS C OXT sing N N 198 HIS CB CG sing N N 199 HIS CB HB2 sing N N 200 HIS CB HB3 sing N N 201 HIS CG ND1 sing Y N 202 HIS CG CD2 doub Y N 203 HIS ND1 CE1 doub Y N 204 HIS ND1 HD1 sing N N 205 HIS CD2 NE2 sing Y N 206 HIS CD2 HD2 sing N N 207 HIS CE1 NE2 sing Y N 208 HIS CE1 HE1 sing N N 209 HIS NE2 HE2 sing N N 210 HIS OXT HXT sing N N 211 HOH O H1 sing N N 212 HOH O H2 sing N N 213 ILE N CA sing N N 214 ILE N H sing N N 215 ILE N H2 sing N N 216 ILE CA C sing N N 217 ILE CA CB sing N N 218 ILE CA HA sing N N 219 ILE C O doub N N 220 ILE C OXT sing N N 221 ILE CB CG1 sing N N 222 ILE CB CG2 sing N N 223 ILE CB HB sing N N 224 ILE CG1 CD1 sing N N 225 ILE CG1 HG12 sing N N 226 ILE CG1 HG13 sing N N 227 ILE CG2 HG21 sing N N 228 ILE CG2 HG22 sing N N 229 ILE CG2 HG23 sing N N 230 ILE CD1 HD11 sing N N 231 ILE CD1 HD12 sing N N 232 ILE CD1 HD13 sing N N 233 ILE OXT HXT sing N N 234 LEU N CA sing N N 235 LEU N H sing N N 236 LEU N H2 sing N N 237 LEU CA C sing N N 238 LEU CA CB sing N N 239 LEU CA HA sing N N 240 LEU C O doub N N 241 LEU C OXT sing N N 242 LEU CB CG sing N N 243 LEU CB HB2 sing N N 244 LEU CB HB3 sing N N 245 LEU CG CD1 sing N N 246 LEU CG CD2 sing N N 247 LEU CG HG sing N N 248 LEU CD1 HD11 sing N N 249 LEU CD1 HD12 sing N N 250 LEU CD1 HD13 sing N N 251 LEU CD2 HD21 sing N N 252 LEU CD2 HD22 sing N N 253 LEU CD2 HD23 sing N N 254 LEU OXT HXT sing N N 255 LYS N CA sing N N 256 LYS N H sing N N 257 LYS N H2 sing N N 258 LYS CA C sing N N 259 LYS CA CB sing N N 260 LYS CA HA sing N N 261 LYS C O doub N N 262 LYS C OXT sing N N 263 LYS CB CG sing N N 264 LYS CB HB2 sing N N 265 LYS CB HB3 sing N N 266 LYS CG CD sing N N 267 LYS CG HG2 sing N N 268 LYS CG HG3 sing N N 269 LYS CD CE sing N N 270 LYS CD HD2 sing N N 271 LYS CD HD3 sing N N 272 LYS CE NZ sing N N 273 LYS CE HE2 sing N N 274 LYS CE HE3 sing N N 275 LYS NZ HZ1 sing N N 276 LYS NZ HZ2 sing N N 277 LYS NZ HZ3 sing N N 278 LYS OXT HXT sing N N 279 MET N CA sing N N 280 MET N H sing N N 281 MET N H2 sing N N 282 MET CA C sing N N 283 MET CA CB sing N N 284 MET CA HA sing N N 285 MET C O doub N N 286 MET C OXT sing N N 287 MET CB CG sing N N 288 MET CB HB2 sing N N 289 MET CB HB3 sing N N 290 MET CG SD sing N N 291 MET CG HG2 sing N N 292 MET CG HG3 sing N N 293 MET SD CE sing N N 294 MET CE HE1 sing N N 295 MET CE HE2 sing N N 296 MET CE HE3 sing N N 297 MET OXT HXT sing N N 298 PHE N CA sing N N 299 PHE N H sing N N 300 PHE N H2 sing N N 301 PHE CA C sing N N 302 PHE CA CB sing N N 303 PHE CA HA sing N N 304 PHE C O doub N N 305 PHE C OXT sing N N 306 PHE CB CG sing N N 307 PHE CB HB2 sing N N 308 PHE CB HB3 sing N N 309 PHE CG CD1 doub Y N 310 PHE CG CD2 sing Y N 311 PHE CD1 CE1 sing Y N 312 PHE CD1 HD1 sing N N 313 PHE CD2 CE2 doub Y N 314 PHE CD2 HD2 sing N N 315 PHE CE1 CZ doub Y N 316 PHE CE1 HE1 sing N N 317 PHE CE2 CZ sing Y N 318 PHE CE2 HE2 sing N N 319 PHE CZ HZ sing N N 320 PHE OXT HXT sing N N 321 PRO N CA sing N N 322 PRO N CD sing N N 323 PRO N H sing N N 324 PRO CA C sing N N 325 PRO CA CB sing N N 326 PRO CA HA sing N N 327 PRO C O doub N N 328 PRO C OXT sing N N 329 PRO CB CG sing N N 330 PRO CB HB2 sing N N 331 PRO CB HB3 sing N N 332 PRO CG CD sing N N 333 PRO CG HG2 sing N N 334 PRO CG HG3 sing N N 335 PRO CD HD2 sing N N 336 PRO CD HD3 sing N N 337 PRO OXT HXT sing N N 338 SER N CA sing N N 339 SER N H sing N N 340 SER N H2 sing N N 341 SER CA C sing N N 342 SER CA CB sing N N 343 SER CA HA sing N N 344 SER C O doub N N 345 SER C OXT sing N N 346 SER CB OG sing N N 347 SER CB HB2 sing N N 348 SER CB HB3 sing N N 349 SER OG HG sing N N 350 SER OXT HXT sing N N 351 THR N CA sing N N 352 THR N H sing N N 353 THR N H2 sing N N 354 THR CA C sing N N 355 THR CA CB sing N N 356 THR CA HA sing N N 357 THR C O doub N N 358 THR C OXT sing N N 359 THR CB OG1 sing N N 360 THR CB CG2 sing N N 361 THR CB HB sing N N 362 THR OG1 HG1 sing N N 363 THR CG2 HG21 sing N N 364 THR CG2 HG22 sing N N 365 THR CG2 HG23 sing N N 366 THR OXT HXT sing N N 367 TYR N CA sing N N 368 TYR N H sing N N 369 TYR N H2 sing N N 370 TYR CA C sing N N 371 TYR CA CB sing N N 372 TYR CA HA sing N N 373 TYR C O doub N N 374 TYR C OXT sing N N 375 TYR CB CG sing N N 376 TYR CB HB2 sing N N 377 TYR CB HB3 sing N N 378 TYR CG CD1 doub Y N 379 TYR CG CD2 sing Y N 380 TYR CD1 CE1 sing Y N 381 TYR CD1 HD1 sing N N 382 TYR CD2 CE2 doub Y N 383 TYR CD2 HD2 sing N N 384 TYR CE1 CZ doub Y N 385 TYR CE1 HE1 sing N N 386 TYR CE2 CZ sing Y N 387 TYR CE2 HE2 sing N N 388 TYR CZ OH sing N N 389 TYR OH HH sing N N 390 TYR OXT HXT sing N N 391 VAL N CA sing N N 392 VAL N H sing N N 393 VAL N H2 sing N N 394 VAL CA C sing N N 395 VAL CA CB sing N N 396 VAL CA HA sing N N 397 VAL C O doub N N 398 VAL C OXT sing N N 399 VAL CB CG1 sing N N 400 VAL CB CG2 sing N N 401 VAL CB HB sing N N 402 VAL CG1 HG11 sing N N 403 VAL CG1 HG12 sing N N 404 VAL CG1 HG13 sing N N 405 VAL CG2 HG21 sing N N 406 VAL CG2 HG22 sing N N 407 VAL CG2 HG23 sing N N 408 VAL OXT HXT sing N N 409 # _pdbx_audit_support.funding_organization 'Ministry of Education, Culture, Sports, Science and Technology (Japan)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 16H05107 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id EWR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id EWR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2S)-2-ethoxy-3-[4-[2-[2-methyl-5-(4-methylsulfanylphenyl)pyrrol-1-yl]ethoxy]phenyl]propanoic acid' EWR 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3VI8 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #