data_6M8U # _entry.id 6M8U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6M8U pdb_00006m8u 10.2210/pdb6m8u/pdb WWPDB D_1000236370 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 6M8T PDB . unspecified 6M8V PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6M8U _pdbx_database_status.recvd_initial_deposition_date 2018-08-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Stogios, P.J.' 1 ? 'Skarina, T.' 2 ? 'Khusnutidinova, A.' 3 ? 'Wawrzak, Z.' 4 ? 'Yakunin, A.F.' 5 ? 'Savchenko, A.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of UbiX-like FMN prenyltransferase AF1214 from Archaeoglobus fulgidus, prenylated-FMN complex' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Stogios, P.J.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6M8U _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.720 _cell.length_a_esd ? _cell.length_b 98.720 _cell.length_b_esd ? _cell.length_c 98.720 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6M8U _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Flavin prenyltransferase UbiX' 20846.891 1 2.5.1.129 ? ? ? 2 non-polymer syn ;1-deoxy-5-O-phosphono-1-(3,3,4,5-tetramethyl-9,11-dioxo-2,3,8,9,10,11-hexahydro-7H-quinolino[1,8-fg]pteridin-12-ium-7-y l)-D-ribitol ; 525.469 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 water nat water 18.015 120 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ENLYFQGMRFVVALTGASGQILGIRLIEKLTELGAEVYAVASRAAKITLKAETDYDEGYVREIATKYYDEDEIAAPFASG SFRHDGMAVVPCSIKTASSIAYGIADNLIARAADVTLKEKRRLVLAIREAPLHSGHLKTLARLAEMGAVIFPPVLSFYTR PKSVDDLIEHTVSRIAEQLGVEVDYRRWG ; _entity_poly.pdbx_seq_one_letter_code_can ;ENLYFQGMRFVVALTGASGQILGIRLIEKLTELGAEVYAVASRAAKITLKAETDYDEGYVREIATKYYDEDEIAAPFASG SFRHDGMAVVPCSIKTASSIAYGIADNLIARAADVTLKEKRRLVLAIREAPLHSGHLKTLARLAEMGAVIFPPVLSFYTR PKSVDDLIEHTVSRIAEQLGVEVDYRRWG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASN n 1 3 LEU n 1 4 TYR n 1 5 PHE n 1 6 GLN n 1 7 GLY n 1 8 MET n 1 9 ARG n 1 10 PHE n 1 11 VAL n 1 12 VAL n 1 13 ALA n 1 14 LEU n 1 15 THR n 1 16 GLY n 1 17 ALA n 1 18 SER n 1 19 GLY n 1 20 GLN n 1 21 ILE n 1 22 LEU n 1 23 GLY n 1 24 ILE n 1 25 ARG n 1 26 LEU n 1 27 ILE n 1 28 GLU n 1 29 LYS n 1 30 LEU n 1 31 THR n 1 32 GLU n 1 33 LEU n 1 34 GLY n 1 35 ALA n 1 36 GLU n 1 37 VAL n 1 38 TYR n 1 39 ALA n 1 40 VAL n 1 41 ALA n 1 42 SER n 1 43 ARG n 1 44 ALA n 1 45 ALA n 1 46 LYS n 1 47 ILE n 1 48 THR n 1 49 LEU n 1 50 LYS n 1 51 ALA n 1 52 GLU n 1 53 THR n 1 54 ASP n 1 55 TYR n 1 56 ASP n 1 57 GLU n 1 58 GLY n 1 59 TYR n 1 60 VAL n 1 61 ARG n 1 62 GLU n 1 63 ILE n 1 64 ALA n 1 65 THR n 1 66 LYS n 1 67 TYR n 1 68 TYR n 1 69 ASP n 1 70 GLU n 1 71 ASP n 1 72 GLU n 1 73 ILE n 1 74 ALA n 1 75 ALA n 1 76 PRO n 1 77 PHE n 1 78 ALA n 1 79 SER n 1 80 GLY n 1 81 SER n 1 82 PHE n 1 83 ARG n 1 84 HIS n 1 85 ASP n 1 86 GLY n 1 87 MET n 1 88 ALA n 1 89 VAL n 1 90 VAL n 1 91 PRO n 1 92 CYS n 1 93 SER n 1 94 ILE n 1 95 LYS n 1 96 THR n 1 97 ALA n 1 98 SER n 1 99 SER n 1 100 ILE n 1 101 ALA n 1 102 TYR n 1 103 GLY n 1 104 ILE n 1 105 ALA n 1 106 ASP n 1 107 ASN n 1 108 LEU n 1 109 ILE n 1 110 ALA n 1 111 ARG n 1 112 ALA n 1 113 ALA n 1 114 ASP n 1 115 VAL n 1 116 THR n 1 117 LEU n 1 118 LYS n 1 119 GLU n 1 120 LYS n 1 121 ARG n 1 122 ARG n 1 123 LEU n 1 124 VAL n 1 125 LEU n 1 126 ALA n 1 127 ILE n 1 128 ARG n 1 129 GLU n 1 130 ALA n 1 131 PRO n 1 132 LEU n 1 133 HIS n 1 134 SER n 1 135 GLY n 1 136 HIS n 1 137 LEU n 1 138 LYS n 1 139 THR n 1 140 LEU n 1 141 ALA n 1 142 ARG n 1 143 LEU n 1 144 ALA n 1 145 GLU n 1 146 MET n 1 147 GLY n 1 148 ALA n 1 149 VAL n 1 150 ILE n 1 151 PHE n 1 152 PRO n 1 153 PRO n 1 154 VAL n 1 155 LEU n 1 156 SER n 1 157 PHE n 1 158 TYR n 1 159 THR n 1 160 ARG n 1 161 PRO n 1 162 LYS n 1 163 SER n 1 164 VAL n 1 165 ASP n 1 166 ASP n 1 167 LEU n 1 168 ILE n 1 169 GLU n 1 170 HIS n 1 171 THR n 1 172 VAL n 1 173 SER n 1 174 ARG n 1 175 ILE n 1 176 ALA n 1 177 GLU n 1 178 GLN n 1 179 LEU n 1 180 GLY n 1 181 VAL n 1 182 GLU n 1 183 VAL n 1 184 ASP n 1 185 TYR n 1 186 ARG n 1 187 ARG n 1 188 TRP n 1 189 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ubiX, AF_1214' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224325 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) Gold' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'p15Tv lic' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBIX_ARCFU _struct_ref.pdbx_db_accession O29054 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRFVVALTGASGQILGIRLIEKLTELGAEVYAVASRAAKITLKAETDYDEGYVREIATKYYDEDEIAAPFASGSFRHDGM AVVPCSIKTASSIAYGIADNLIARAADVTLKEKRRLVLAIREAPLHSGHLKTLARLAEMGAVIFPPVLSFYTRPKSVDDL IEHTVSRIAEQLGVEVDYRRWG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6M8U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O29054 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6M8U GLU A 1 ? UNP O29054 ? ? 'expression tag' -6 1 1 6M8U ASN A 2 ? UNP O29054 ? ? 'expression tag' -5 2 1 6M8U LEU A 3 ? UNP O29054 ? ? 'expression tag' -4 3 1 6M8U TYR A 4 ? UNP O29054 ? ? 'expression tag' -3 4 1 6M8U PHE A 5 ? UNP O29054 ? ? 'expression tag' -2 5 1 6M8U GLN A 6 ? UNP O29054 ? ? 'expression tag' -1 6 1 6M8U GLY A 7 ? UNP O29054 ? ? 'expression tag' 0 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4LU non-polymer . ;1-deoxy-5-O-phosphono-1-(3,3,4,5-tetramethyl-9,11-dioxo-2,3,8,9,10,11-hexahydro-7H-quinolino[1,8-fg]pteridin-12-ium-7-y l)-D-ribitol ; 'prenylated-FMN iminium form' 'C22 H30 N4 O9 P 1' 525.469 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6M8U _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.00 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Hepes pH 7.5, 0.2 M calcium chloride, 28% (w/v) PEG400 Cryoprotectant paratone ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6M8U _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.77 _reflns.d_resolution_low 30.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15752 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.3 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 38.26 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.77 _reflns_shell.d_res_low 1.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.32 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 799 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.829 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.332 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.937 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6M8U _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.221 _refine.ls_d_res_low 28.498 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14662 _refine.ls_number_reflns_R_free 748 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.27 _refine.ls_percent_reflns_R_free 5.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1591 _refine.ls_R_factor_R_free 0.1916 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1573 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2EJB _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.37 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.15 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1410 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.number_atoms_solvent 120 _refine_hist.number_atoms_total 1571 _refine_hist.d_res_high 2.221 _refine_hist.d_res_low 28.498 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.017 ? 1484 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.410 ? 2020 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.806 ? 551 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.063 ? 230 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.023 ? 250 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2208 2.3922 . . 128 2541 86.00 . . . 0.2517 . 0.1957 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3922 2.6328 . . 145 2852 97.00 . . . 0.1961 . 0.1593 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6328 3.0134 . . 160 2820 98.00 . . . 0.2029 . 0.1614 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0134 3.7951 . . 153 2825 97.00 . . . 0.2001 . 0.1517 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7951 28.5003 . . 162 2876 99.00 . . . 0.1631 . 0.1470 . . . . . . . . . . # _struct.entry_id 6M8U _struct.title 'Crystal structure of UbiX-like FMN prenyltransferase AF1214 from Archaeoglobus fulgidus, prenylated-FMN complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6M8U _struct_keywords.text 'FMN BINDING, UBIX, PRENYL TRANSFERASE, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 19 ? LEU A 33 ? GLY A 12 LEU A 26 1 ? 15 HELX_P HELX_P2 AA2 SER A 42 ? THR A 53 ? SER A 35 THR A 46 1 ? 12 HELX_P HELX_P3 AA3 GLY A 58 ? ALA A 64 ? GLY A 51 ALA A 57 1 ? 7 HELX_P HELX_P4 AA4 ALA A 75 ? SER A 79 ? ALA A 68 SER A 72 5 ? 5 HELX_P HELX_P5 AA5 SER A 93 ? GLY A 103 ? SER A 86 GLY A 96 1 ? 11 HELX_P HELX_P6 AA6 ASN A 107 ? GLU A 119 ? ASN A 100 GLU A 112 1 ? 13 HELX_P HELX_P7 AA7 HIS A 133 ? GLY A 147 ? HIS A 126 GLY A 140 1 ? 15 HELX_P HELX_P8 AA8 SER A 163 ? LEU A 179 ? SER A 156 LEU A 172 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 90 A . ? VAL 83 A PRO 91 A ? PRO 84 A 1 -3.88 2 ALA 130 A . ? ALA 123 A PRO 131 A ? PRO 124 A 1 -9.10 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 66 ? ASP A 69 ? LYS A 59 ASP A 62 AA1 2 GLU A 36 ? ALA A 41 ? GLU A 29 ALA A 34 AA1 3 ARG A 9 ? LEU A 14 ? ARG A 2 LEU A 7 AA1 4 MET A 87 ? CYS A 92 ? MET A 80 CYS A 85 AA1 5 LEU A 123 ? ILE A 127 ? LEU A 116 ILE A 120 AA1 6 VAL A 149 ? ILE A 150 ? VAL A 142 ILE A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 66 ? O LYS A 59 N ALA A 39 ? N ALA A 32 AA1 2 3 O VAL A 40 ? O VAL A 33 N LEU A 14 ? N LEU A 7 AA1 3 4 N ALA A 13 ? N ALA A 6 O ALA A 88 ? O ALA A 81 AA1 4 5 N CYS A 92 ? N CYS A 85 O ALA A 126 ? O ALA A 119 AA1 5 6 N LEU A 123 ? N LEU A 116 O VAL A 149 ? O VAL A 142 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 4LU 201 ? 24 'binding site for residue 4LU A 201' AC2 Software A PO4 202 ? 9 'binding site for residue PO4 A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 24 THR A 15 ? THR A 8 . ? 1_555 ? 2 AC1 24 GLY A 16 ? GLY A 9 . ? 1_555 ? 3 AC1 24 ALA A 17 ? ALA A 10 . ? 1_555 ? 4 AC1 24 SER A 18 ? SER A 11 . ? 1_555 ? 5 AC1 24 SER A 42 ? SER A 35 . ? 1_555 ? 6 AC1 24 ALA A 44 ? ALA A 37 . ? 1_555 ? 7 AC1 24 ILE A 73 ? ILE A 66 . ? 5_555 ? 8 AC1 24 SER A 93 ? SER A 86 . ? 1_555 ? 9 AC1 24 ILE A 94 ? ILE A 87 . ? 1_555 ? 10 AC1 24 LYS A 95 ? LYS A 88 . ? 1_555 ? 11 AC1 24 THR A 96 ? THR A 89 . ? 1_555 ? 12 AC1 24 ALA A 105 ? ALA A 98 . ? 5_555 ? 13 AC1 24 ASP A 106 ? ASP A 99 . ? 5_555 ? 14 AC1 24 ARG A 111 ? ARG A 104 . ? 5_555 ? 15 AC1 24 ARG A 128 ? ARG A 121 . ? 1_555 ? 16 AC1 24 GLU A 129 ? GLU A 122 . ? 1_555 ? 17 AC1 24 TYR A 158 ? TYR A 151 . ? 3_555 ? 18 AC1 24 TRP A 188 ? TRP A 181 . ? 3_555 ? 19 AC1 24 PO4 C . ? PO4 A 202 . ? 1_555 ? 20 AC1 24 HOH D . ? HOH A 320 . ? 1_555 ? 21 AC1 24 HOH D . ? HOH A 331 . ? 1_555 ? 22 AC1 24 HOH D . ? HOH A 363 . ? 1_555 ? 23 AC1 24 HOH D . ? HOH A 371 . ? 1_555 ? 24 AC1 24 HOH D . ? HOH A 382 . ? 1_555 ? 25 AC2 9 SER A 79 ? SER A 72 . ? 5_555 ? 26 AC2 9 GLY A 80 ? GLY A 73 . ? 5_555 ? 27 AC2 9 ARG A 111 ? ARG A 104 . ? 5_555 ? 28 AC2 9 LYS A 118 ? LYS A 111 . ? 5_555 ? 29 AC2 9 ARG A 128 ? ARG A 121 . ? 1_555 ? 30 AC2 9 GLU A 129 ? GLU A 122 . ? 1_555 ? 31 AC2 9 TYR A 158 ? TYR A 151 . ? 3_555 ? 32 AC2 9 4LU B . ? 4LU A 201 . ? 1_555 ? 33 AC2 9 HOH D . ? HOH A 327 . ? 1_555 ? # _atom_sites.entry_id 6M8U _atom_sites.fract_transf_matrix[1][1] 0.010130 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010130 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010130 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 -6 ? ? ? A . n A 1 2 ASN 2 -5 ? ? ? A . n A 1 3 LEU 3 -4 ? ? ? A . n A 1 4 TYR 4 -3 ? ? ? A . n A 1 5 PHE 5 -2 ? ? ? A . n A 1 6 GLN 6 -1 ? ? ? A . n A 1 7 GLY 7 0 0 GLY GLY A . n A 1 8 MET 8 1 1 MET MET A . n A 1 9 ARG 9 2 2 ARG ARG A . n A 1 10 PHE 10 3 3 PHE PHE A . n A 1 11 VAL 11 4 4 VAL VAL A . n A 1 12 VAL 12 5 5 VAL VAL A . n A 1 13 ALA 13 6 6 ALA ALA A . n A 1 14 LEU 14 7 7 LEU LEU A . n A 1 15 THR 15 8 8 THR THR A . n A 1 16 GLY 16 9 9 GLY GLY A . n A 1 17 ALA 17 10 10 ALA ALA A . n A 1 18 SER 18 11 11 SER SER A . n A 1 19 GLY 19 12 12 GLY GLY A . n A 1 20 GLN 20 13 13 GLN GLN A . n A 1 21 ILE 21 14 14 ILE ILE A . n A 1 22 LEU 22 15 15 LEU LEU A . n A 1 23 GLY 23 16 16 GLY GLY A . n A 1 24 ILE 24 17 17 ILE ILE A . n A 1 25 ARG 25 18 18 ARG ARG A . n A 1 26 LEU 26 19 19 LEU LEU A . n A 1 27 ILE 27 20 20 ILE ILE A . n A 1 28 GLU 28 21 21 GLU GLU A . n A 1 29 LYS 29 22 22 LYS LYS A . n A 1 30 LEU 30 23 23 LEU LEU A . n A 1 31 THR 31 24 24 THR THR A . n A 1 32 GLU 32 25 25 GLU GLU A . n A 1 33 LEU 33 26 26 LEU LEU A . n A 1 34 GLY 34 27 27 GLY GLY A . n A 1 35 ALA 35 28 28 ALA ALA A . n A 1 36 GLU 36 29 29 GLU GLU A . n A 1 37 VAL 37 30 30 VAL VAL A . n A 1 38 TYR 38 31 31 TYR TYR A . n A 1 39 ALA 39 32 32 ALA ALA A . n A 1 40 VAL 40 33 33 VAL VAL A . n A 1 41 ALA 41 34 34 ALA ALA A . n A 1 42 SER 42 35 35 SER SER A . n A 1 43 ARG 43 36 36 ARG ARG A . n A 1 44 ALA 44 37 37 ALA ALA A . n A 1 45 ALA 45 38 38 ALA ALA A . n A 1 46 LYS 46 39 39 LYS LYS A . n A 1 47 ILE 47 40 40 ILE ILE A . n A 1 48 THR 48 41 41 THR THR A . n A 1 49 LEU 49 42 42 LEU LEU A . n A 1 50 LYS 50 43 43 LYS LYS A . n A 1 51 ALA 51 44 44 ALA ALA A . n A 1 52 GLU 52 45 45 GLU GLU A . n A 1 53 THR 53 46 46 THR THR A . n A 1 54 ASP 54 47 47 ASP ASP A . n A 1 55 TYR 55 48 48 TYR TYR A . n A 1 56 ASP 56 49 49 ASP ASP A . n A 1 57 GLU 57 50 50 GLU GLU A . n A 1 58 GLY 58 51 51 GLY GLY A . n A 1 59 TYR 59 52 52 TYR TYR A . n A 1 60 VAL 60 53 53 VAL VAL A . n A 1 61 ARG 61 54 54 ARG ARG A . n A 1 62 GLU 62 55 55 GLU GLU A . n A 1 63 ILE 63 56 56 ILE ILE A . n A 1 64 ALA 64 57 57 ALA ALA A . n A 1 65 THR 65 58 58 THR THR A . n A 1 66 LYS 66 59 59 LYS LYS A . n A 1 67 TYR 67 60 60 TYR TYR A . n A 1 68 TYR 68 61 61 TYR TYR A . n A 1 69 ASP 69 62 62 ASP ASP A . n A 1 70 GLU 70 63 63 GLU GLU A . n A 1 71 ASP 71 64 64 ASP ASP A . n A 1 72 GLU 72 65 65 GLU GLU A . n A 1 73 ILE 73 66 66 ILE ILE A . n A 1 74 ALA 74 67 67 ALA ALA A . n A 1 75 ALA 75 68 68 ALA ALA A . n A 1 76 PRO 76 69 69 PRO PRO A . n A 1 77 PHE 77 70 70 PHE PHE A . n A 1 78 ALA 78 71 71 ALA ALA A . n A 1 79 SER 79 72 72 SER SER A . n A 1 80 GLY 80 73 73 GLY GLY A . n A 1 81 SER 81 74 74 SER SER A . n A 1 82 PHE 82 75 75 PHE PHE A . n A 1 83 ARG 83 76 76 ARG ARG A . n A 1 84 HIS 84 77 77 HIS HIS A . n A 1 85 ASP 85 78 78 ASP ASP A . n A 1 86 GLY 86 79 79 GLY GLY A . n A 1 87 MET 87 80 80 MET MET A . n A 1 88 ALA 88 81 81 ALA ALA A . n A 1 89 VAL 89 82 82 VAL VAL A . n A 1 90 VAL 90 83 83 VAL VAL A . n A 1 91 PRO 91 84 84 PRO PRO A . n A 1 92 CYS 92 85 85 CYS CYS A . n A 1 93 SER 93 86 86 SER SER A . n A 1 94 ILE 94 87 87 ILE ILE A . n A 1 95 LYS 95 88 88 LYS LYS A . n A 1 96 THR 96 89 89 THR THR A . n A 1 97 ALA 97 90 90 ALA ALA A . n A 1 98 SER 98 91 91 SER SER A . n A 1 99 SER 99 92 92 SER SER A . n A 1 100 ILE 100 93 93 ILE ILE A . n A 1 101 ALA 101 94 94 ALA ALA A . n A 1 102 TYR 102 95 95 TYR TYR A . n A 1 103 GLY 103 96 96 GLY GLY A . n A 1 104 ILE 104 97 97 ILE ILE A . n A 1 105 ALA 105 98 98 ALA ALA A . n A 1 106 ASP 106 99 99 ASP ASP A . n A 1 107 ASN 107 100 100 ASN ASN A . n A 1 108 LEU 108 101 101 LEU LEU A . n A 1 109 ILE 109 102 102 ILE ILE A . n A 1 110 ALA 110 103 103 ALA ALA A . n A 1 111 ARG 111 104 104 ARG ARG A . n A 1 112 ALA 112 105 105 ALA ALA A . n A 1 113 ALA 113 106 106 ALA ALA A . n A 1 114 ASP 114 107 107 ASP ASP A . n A 1 115 VAL 115 108 108 VAL VAL A . n A 1 116 THR 116 109 109 THR THR A . n A 1 117 LEU 117 110 110 LEU LEU A . n A 1 118 LYS 118 111 111 LYS LYS A . n A 1 119 GLU 119 112 112 GLU GLU A . n A 1 120 LYS 120 113 113 LYS LYS A . n A 1 121 ARG 121 114 114 ARG ARG A . n A 1 122 ARG 122 115 115 ARG ARG A . n A 1 123 LEU 123 116 116 LEU LEU A . n A 1 124 VAL 124 117 117 VAL VAL A . n A 1 125 LEU 125 118 118 LEU LEU A . n A 1 126 ALA 126 119 119 ALA ALA A . n A 1 127 ILE 127 120 120 ILE ILE A . n A 1 128 ARG 128 121 121 ARG ARG A . n A 1 129 GLU 129 122 122 GLU GLU A . n A 1 130 ALA 130 123 123 ALA ALA A . n A 1 131 PRO 131 124 124 PRO PRO A . n A 1 132 LEU 132 125 125 LEU LEU A . n A 1 133 HIS 133 126 126 HIS HIS A . n A 1 134 SER 134 127 127 SER SER A . n A 1 135 GLY 135 128 128 GLY GLY A . n A 1 136 HIS 136 129 129 HIS HIS A . n A 1 137 LEU 137 130 130 LEU LEU A . n A 1 138 LYS 138 131 131 LYS LYS A . n A 1 139 THR 139 132 132 THR THR A . n A 1 140 LEU 140 133 133 LEU LEU A . n A 1 141 ALA 141 134 134 ALA ALA A . n A 1 142 ARG 142 135 135 ARG ARG A . n A 1 143 LEU 143 136 136 LEU LEU A . n A 1 144 ALA 144 137 137 ALA ALA A . n A 1 145 GLU 145 138 138 GLU GLU A . n A 1 146 MET 146 139 139 MET MET A . n A 1 147 GLY 147 140 140 GLY GLY A . n A 1 148 ALA 148 141 141 ALA ALA A . n A 1 149 VAL 149 142 142 VAL VAL A . n A 1 150 ILE 150 143 143 ILE ILE A . n A 1 151 PHE 151 144 144 PHE PHE A . n A 1 152 PRO 152 145 145 PRO PRO A . n A 1 153 PRO 153 146 146 PRO PRO A . n A 1 154 VAL 154 147 147 VAL VAL A . n A 1 155 LEU 155 148 148 LEU LEU A . n A 1 156 SER 156 149 149 SER SER A . n A 1 157 PHE 157 150 150 PHE PHE A . n A 1 158 TYR 158 151 151 TYR TYR A . n A 1 159 THR 159 152 152 THR THR A . n A 1 160 ARG 160 153 153 ARG ARG A . n A 1 161 PRO 161 154 154 PRO PRO A . n A 1 162 LYS 162 155 155 LYS LYS A . n A 1 163 SER 163 156 156 SER SER A . n A 1 164 VAL 164 157 157 VAL VAL A . n A 1 165 ASP 165 158 158 ASP ASP A . n A 1 166 ASP 166 159 159 ASP ASP A . n A 1 167 LEU 167 160 160 LEU LEU A . n A 1 168 ILE 168 161 161 ILE ILE A . n A 1 169 GLU 169 162 162 GLU GLU A . n A 1 170 HIS 170 163 163 HIS HIS A . n A 1 171 THR 171 164 164 THR THR A . n A 1 172 VAL 172 165 165 VAL VAL A . n A 1 173 SER 173 166 166 SER SER A . n A 1 174 ARG 174 167 167 ARG ARG A . n A 1 175 ILE 175 168 168 ILE ILE A . n A 1 176 ALA 176 169 169 ALA ALA A . n A 1 177 GLU 177 170 170 GLU GLU A . n A 1 178 GLN 178 171 171 GLN GLN A . n A 1 179 LEU 179 172 172 LEU LEU A . n A 1 180 GLY 180 173 173 GLY GLY A . n A 1 181 VAL 181 174 174 VAL VAL A . n A 1 182 GLU 182 175 175 GLU GLU A . n A 1 183 VAL 183 176 176 VAL VAL A . n A 1 184 ASP 184 177 177 ASP ASP A . n A 1 185 TYR 185 178 178 TYR TYR A . n A 1 186 ARG 186 179 179 ARG ARG A . n A 1 187 ARG 187 180 180 ARG ARG A . n A 1 188 TRP 188 181 181 TRP TRP A . n A 1 189 GLY 189 182 182 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 4LU 1 201 201 4LU 4LU A . C 3 PO4 1 202 202 PO4 PO4 A . D 4 HOH 1 301 301 HOH HOH A . D 4 HOH 2 302 302 HOH HOH A . D 4 HOH 3 303 303 HOH HOH A . D 4 HOH 4 304 304 HOH HOH A . D 4 HOH 5 305 305 HOH HOH A . D 4 HOH 6 306 306 HOH HOH A . D 4 HOH 7 307 307 HOH HOH A . D 4 HOH 8 308 308 HOH HOH A . D 4 HOH 9 309 309 HOH HOH A . D 4 HOH 10 310 310 HOH HOH A . D 4 HOH 11 311 311 HOH HOH A . D 4 HOH 12 312 312 HOH HOH A . D 4 HOH 13 313 313 HOH HOH A . D 4 HOH 14 314 314 HOH HOH A . D 4 HOH 15 315 315 HOH HOH A . D 4 HOH 16 316 316 HOH HOH A . D 4 HOH 17 317 317 HOH HOH A . D 4 HOH 18 318 318 HOH HOH A . D 4 HOH 19 319 319 HOH HOH A . D 4 HOH 20 320 320 HOH HOH A . D 4 HOH 21 321 321 HOH HOH A . D 4 HOH 22 322 322 HOH HOH A . D 4 HOH 23 323 323 HOH HOH A . D 4 HOH 24 324 325 HOH HOH A . D 4 HOH 25 325 326 HOH HOH A . D 4 HOH 26 326 327 HOH HOH A . D 4 HOH 27 327 328 HOH HOH A . D 4 HOH 28 328 329 HOH HOH A . D 4 HOH 29 329 330 HOH HOH A . D 4 HOH 30 330 331 HOH HOH A . D 4 HOH 31 331 332 HOH HOH A . D 4 HOH 32 332 333 HOH HOH A . D 4 HOH 33 333 334 HOH HOH A . D 4 HOH 34 334 336 HOH HOH A . D 4 HOH 35 335 337 HOH HOH A . D 4 HOH 36 336 338 HOH HOH A . D 4 HOH 37 337 339 HOH HOH A . D 4 HOH 38 338 340 HOH HOH A . D 4 HOH 39 339 341 HOH HOH A . D 4 HOH 40 340 342 HOH HOH A . D 4 HOH 41 341 343 HOH HOH A . D 4 HOH 42 342 344 HOH HOH A . D 4 HOH 43 343 345 HOH HOH A . D 4 HOH 44 344 346 HOH HOH A . D 4 HOH 45 345 347 HOH HOH A . D 4 HOH 46 346 348 HOH HOH A . D 4 HOH 47 347 349 HOH HOH A . D 4 HOH 48 348 350 HOH HOH A . D 4 HOH 49 349 352 HOH HOH A . D 4 HOH 50 350 353 HOH HOH A . D 4 HOH 51 351 354 HOH HOH A . D 4 HOH 52 352 355 HOH HOH A . D 4 HOH 53 353 356 HOH HOH A . D 4 HOH 54 354 357 HOH HOH A . D 4 HOH 55 355 358 HOH HOH A . D 4 HOH 56 356 359 HOH HOH A . D 4 HOH 57 357 360 HOH HOH A . D 4 HOH 58 358 361 HOH HOH A . D 4 HOH 59 359 362 HOH HOH A . D 4 HOH 60 360 364 HOH HOH A . D 4 HOH 61 361 365 HOH HOH A . D 4 HOH 62 362 366 HOH HOH A . D 4 HOH 63 363 324 HOH HOH A . D 4 HOH 64 364 367 HOH HOH A . D 4 HOH 65 365 368 HOH HOH A . D 4 HOH 66 366 369 HOH HOH A . D 4 HOH 67 367 370 HOH HOH A . D 4 HOH 68 368 371 HOH HOH A . D 4 HOH 69 369 372 HOH HOH A . D 4 HOH 70 370 373 HOH HOH A . D 4 HOH 71 371 351 HOH HOH A . D 4 HOH 72 372 363 HOH HOH A . D 4 HOH 73 373 374 HOH HOH A . D 4 HOH 74 374 375 HOH HOH A . D 4 HOH 75 375 376 HOH HOH A . D 4 HOH 76 376 377 HOH HOH A . D 4 HOH 77 377 378 HOH HOH A . D 4 HOH 78 378 379 HOH HOH A . D 4 HOH 79 379 380 HOH HOH A . D 4 HOH 80 380 381 HOH HOH A . D 4 HOH 81 381 382 HOH HOH A . D 4 HOH 82 382 383 HOH HOH A . D 4 HOH 83 383 384 HOH HOH A . D 4 HOH 84 384 385 HOH HOH A . D 4 HOH 85 385 386 HOH HOH A . D 4 HOH 86 386 387 HOH HOH A . D 4 HOH 87 387 388 HOH HOH A . D 4 HOH 88 388 389 HOH HOH A . D 4 HOH 89 389 390 HOH HOH A . D 4 HOH 90 390 391 HOH HOH A . D 4 HOH 91 391 392 HOH HOH A . D 4 HOH 92 392 393 HOH HOH A . D 4 HOH 93 393 394 HOH HOH A . D 4 HOH 94 394 395 HOH HOH A . D 4 HOH 95 395 396 HOH HOH A . D 4 HOH 96 396 397 HOH HOH A . D 4 HOH 97 397 398 HOH HOH A . D 4 HOH 98 398 399 HOH HOH A . D 4 HOH 99 399 400 HOH HOH A . D 4 HOH 100 400 401 HOH HOH A . D 4 HOH 101 401 402 HOH HOH A . D 4 HOH 102 402 403 HOH HOH A . D 4 HOH 103 403 404 HOH HOH A . D 4 HOH 104 404 405 HOH HOH A . D 4 HOH 105 405 406 HOH HOH A . D 4 HOH 106 406 407 HOH HOH A . D 4 HOH 107 407 408 HOH HOH A . D 4 HOH 108 408 409 HOH HOH A . D 4 HOH 109 409 410 HOH HOH A . D 4 HOH 110 410 411 HOH HOH A . D 4 HOH 111 411 412 HOH HOH A . D 4 HOH 112 412 413 HOH HOH A . D 4 HOH 113 413 414 HOH HOH A . D 4 HOH 114 414 415 HOH HOH A . D 4 HOH 115 415 416 HOH HOH A . D 4 HOH 116 416 417 HOH HOH A . D 4 HOH 117 417 418 HOH HOH A . D 4 HOH 118 418 419 HOH HOH A . D 4 HOH 119 419 420 HOH HOH A . D 4 HOH 120 420 421 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 52540 ? 1 MORE -350 ? 1 'SSA (A^2)' 62170 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 408 ? D HOH . 2 1 A HOH 416 ? D HOH . 3 1 A HOH 418 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-26 2 'Structure model' 1 1 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' 5 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' chem_comp_atom 3 2 'Structure model' chem_comp_bond 4 2 'Structure model' database_2 5 2 'Structure model' entity 6 2 'Structure model' pdbx_entity_nonpoly 7 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.name' 2 2 'Structure model' '_database_2.pdbx_DOI' 3 2 'Structure model' '_database_2.pdbx_database_accession' 4 2 'Structure model' '_entity.pdbx_description' 5 2 'Structure model' '_pdbx_entity_nonpoly.name' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -18.7137 -33.3163 1.3349 0.3148 0.1435 0.3840 -0.3339 -0.0694 0.0532 1.4258 0.3778 0.8665 -0.3214 0.2608 -0.1120 0.3462 -0.6060 -0.7410 0.3651 -0.1658 0.4675 0.5241 -0.3517 0.3067 'X-RAY DIFFRACTION' 2 ? refined -14.9702 -37.8241 -12.4177 0.5215 0.2862 0.6801 0.0668 -0.2491 -0.1731 1.7872 8.1982 4.0123 -1.5197 -2.2882 -0.7870 0.3981 0.4327 -1.2786 -0.5126 0.1273 0.9902 1.2009 -0.2090 -0.2569 'X-RAY DIFFRACTION' 3 ? refined -20.3692 -23.2206 -2.5531 0.1199 0.1954 0.2055 -0.1285 0.0131 -0.0576 1.7244 1.6451 0.8558 -0.1690 0.0763 -0.4440 0.1272 0.0321 -0.2593 -0.0596 -0.2234 0.4169 0.3246 -0.5075 -0.0666 'X-RAY DIFFRACTION' 4 ? refined -3.4420 -20.1352 -0.4898 0.0741 0.0493 0.1052 -0.0370 -0.0165 0.0024 2.3466 0.1377 2.0142 0.3630 -0.5367 0.2524 0.2224 -0.0533 -0.0248 0.0007 -0.1067 0.0160 -0.0204 -0.0195 -0.1177 'X-RAY DIFFRACTION' 5 ? refined -6.0829 -36.6727 10.3019 0.4772 0.2438 0.5831 -0.1883 -0.1267 0.2298 4.1756 8.3601 1.6374 -3.6527 2.2385 -0.4633 0.1018 -0.9234 -0.8987 0.9342 0.1049 -0.2069 0.6855 -0.2443 0.2091 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 1:35)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 36:50)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(chain A and resid 51:121)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(chain A and resid 122:150)' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(chain A and resid 151:182)' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_3092: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU -6 ? A GLU 1 2 1 Y 1 A ASN -5 ? A ASN 2 3 1 Y 1 A LEU -4 ? A LEU 3 4 1 Y 1 A TYR -3 ? A TYR 4 5 1 Y 1 A PHE -2 ? A PHE 5 6 1 Y 1 A GLN -1 ? A GLN 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 4LU C9 C Y N 1 4LU C8 C Y N 2 4LU C7 C Y N 3 4LU C10 C N N 4 4LU C6 C Y N 5 4LU N3 N N N 6 4LU C2 C N N 7 4LU C13 C N N 8 4LU C5 C N N 9 4LU C1 C N N 10 4LU O2 O N N 11 4LU N1 N N N 12 4LU C4 C N N 13 4LU O4 O N N 14 4LU C4A C N N 15 4LU N5 N N N 16 4LU C3 C N N 17 4LU C12 C N N 18 4LU C5A C Y N 19 4LU C7M C N N 20 4LU C8M C N N 21 4LU C9A C Y N 22 4LU N10 N N N 23 4LU "C1'" C N N 24 4LU "C2'" C N S 25 4LU "O2'" O N N 26 4LU "C3'" C N S 27 4LU "O3'" O N N 28 4LU "C4'" C N R 29 4LU "O4'" O N N 30 4LU "C5'" C N N 31 4LU "O5'" O N N 32 4LU P P N N 33 4LU O2P O N N 34 4LU O3P O N N 35 4LU O1P O N N 36 4LU H1 H N N 37 4LU H2 H N N 38 4LU H3 H N N 39 4LU H4 H N N 40 4LU H5 H N N 41 4LU H6 H N N 42 4LU H9 H N N 43 4LU H10 H N N 44 4LU H11 H N N 45 4LU H12 H N N 46 4LU H13 H N N 47 4LU H14 H N N 48 4LU H15 H N N 49 4LU H16 H N N 50 4LU H17 H N N 51 4LU H18 H N N 52 4LU H19 H N N 53 4LU H20 H N N 54 4LU H21 H N N 55 4LU H22 H N N 56 4LU H23 H N N 57 4LU H24 H N N 58 4LU H25 H N N 59 4LU H26 H N N 60 4LU H27 H N N 61 4LU H28 H N N 62 4LU H29 H N N 63 4LU H30 H N N 64 4LU H31 H N N 65 4LU H7 H N N 66 ALA N N N N 67 ALA CA C N S 68 ALA C C N N 69 ALA O O N N 70 ALA CB C N N 71 ALA OXT O N N 72 ALA H H N N 73 ALA H2 H N N 74 ALA HA H N N 75 ALA HB1 H N N 76 ALA HB2 H N N 77 ALA HB3 H N N 78 ALA HXT H N N 79 ARG N N N N 80 ARG CA C N S 81 ARG C C N N 82 ARG O O N N 83 ARG CB C N N 84 ARG CG C N N 85 ARG CD C N N 86 ARG NE N N N 87 ARG CZ C N N 88 ARG NH1 N N N 89 ARG NH2 N N N 90 ARG OXT O N N 91 ARG H H N N 92 ARG H2 H N N 93 ARG HA H N N 94 ARG HB2 H N N 95 ARG HB3 H N N 96 ARG HG2 H N N 97 ARG HG3 H N N 98 ARG HD2 H N N 99 ARG HD3 H N N 100 ARG HE H N N 101 ARG HH11 H N N 102 ARG HH12 H N N 103 ARG HH21 H N N 104 ARG HH22 H N N 105 ARG HXT H N N 106 ASN N N N N 107 ASN CA C N S 108 ASN C C N N 109 ASN O O N N 110 ASN CB C N N 111 ASN CG C N N 112 ASN OD1 O N N 113 ASN ND2 N N N 114 ASN OXT O N N 115 ASN H H N N 116 ASN H2 H N N 117 ASN HA H N N 118 ASN HB2 H N N 119 ASN HB3 H N N 120 ASN HD21 H N N 121 ASN HD22 H N N 122 ASN HXT H N N 123 ASP N N N N 124 ASP CA C N S 125 ASP C C N N 126 ASP O O N N 127 ASP CB C N N 128 ASP CG C N N 129 ASP OD1 O N N 130 ASP OD2 O N N 131 ASP OXT O N N 132 ASP H H N N 133 ASP H2 H N N 134 ASP HA H N N 135 ASP HB2 H N N 136 ASP HB3 H N N 137 ASP HD2 H N N 138 ASP HXT H N N 139 CYS N N N N 140 CYS CA C N R 141 CYS C C N N 142 CYS O O N N 143 CYS CB C N N 144 CYS SG S N N 145 CYS OXT O N N 146 CYS H H N N 147 CYS H2 H N N 148 CYS HA H N N 149 CYS HB2 H N N 150 CYS HB3 H N N 151 CYS HG H N N 152 CYS HXT H N N 153 GLN N N N N 154 GLN CA C N S 155 GLN C C N N 156 GLN O O N N 157 GLN CB C N N 158 GLN CG C N N 159 GLN CD C N N 160 GLN OE1 O N N 161 GLN NE2 N N N 162 GLN OXT O N N 163 GLN H H N N 164 GLN H2 H N N 165 GLN HA H N N 166 GLN HB2 H N N 167 GLN HB3 H N N 168 GLN HG2 H N N 169 GLN HG3 H N N 170 GLN HE21 H N N 171 GLN HE22 H N N 172 GLN HXT H N N 173 GLU N N N N 174 GLU CA C N S 175 GLU C C N N 176 GLU O O N N 177 GLU CB C N N 178 GLU CG C N N 179 GLU CD C N N 180 GLU OE1 O N N 181 GLU OE2 O N N 182 GLU OXT O N N 183 GLU H H N N 184 GLU H2 H N N 185 GLU HA H N N 186 GLU HB2 H N N 187 GLU HB3 H N N 188 GLU HG2 H N N 189 GLU HG3 H N N 190 GLU HE2 H N N 191 GLU HXT H N N 192 GLY N N N N 193 GLY CA C N N 194 GLY C C N N 195 GLY O O N N 196 GLY OXT O N N 197 GLY H H N N 198 GLY H2 H N N 199 GLY HA2 H N N 200 GLY HA3 H N N 201 GLY HXT H N N 202 HIS N N N N 203 HIS CA C N S 204 HIS C C N N 205 HIS O O N N 206 HIS CB C N N 207 HIS CG C Y N 208 HIS ND1 N Y N 209 HIS CD2 C Y N 210 HIS CE1 C Y N 211 HIS NE2 N Y N 212 HIS OXT O N N 213 HIS H H N N 214 HIS H2 H N N 215 HIS HA H N N 216 HIS HB2 H N N 217 HIS HB3 H N N 218 HIS HD1 H N N 219 HIS HD2 H N N 220 HIS HE1 H N N 221 HIS HE2 H N N 222 HIS HXT H N N 223 HOH O O N N 224 HOH H1 H N N 225 HOH H2 H N N 226 ILE N N N N 227 ILE CA C N S 228 ILE C C N N 229 ILE O O N N 230 ILE CB C N S 231 ILE CG1 C N N 232 ILE CG2 C N N 233 ILE CD1 C N N 234 ILE OXT O N N 235 ILE H H N N 236 ILE H2 H N N 237 ILE HA H N N 238 ILE HB H N N 239 ILE HG12 H N N 240 ILE HG13 H N N 241 ILE HG21 H N N 242 ILE HG22 H N N 243 ILE HG23 H N N 244 ILE HD11 H N N 245 ILE HD12 H N N 246 ILE HD13 H N N 247 ILE HXT H N N 248 LEU N N N N 249 LEU CA C N S 250 LEU C C N N 251 LEU O O N N 252 LEU CB C N N 253 LEU CG C N N 254 LEU CD1 C N N 255 LEU CD2 C N N 256 LEU OXT O N N 257 LEU H H N N 258 LEU H2 H N N 259 LEU HA H N N 260 LEU HB2 H N N 261 LEU HB3 H N N 262 LEU HG H N N 263 LEU HD11 H N N 264 LEU HD12 H N N 265 LEU HD13 H N N 266 LEU HD21 H N N 267 LEU HD22 H N N 268 LEU HD23 H N N 269 LEU HXT H N N 270 LYS N N N N 271 LYS CA C N S 272 LYS C C N N 273 LYS O O N N 274 LYS CB C N N 275 LYS CG C N N 276 LYS CD C N N 277 LYS CE C N N 278 LYS NZ N N N 279 LYS OXT O N N 280 LYS H H N N 281 LYS H2 H N N 282 LYS HA H N N 283 LYS HB2 H N N 284 LYS HB3 H N N 285 LYS HG2 H N N 286 LYS HG3 H N N 287 LYS HD2 H N N 288 LYS HD3 H N N 289 LYS HE2 H N N 290 LYS HE3 H N N 291 LYS HZ1 H N N 292 LYS HZ2 H N N 293 LYS HZ3 H N N 294 LYS HXT H N N 295 MET N N N N 296 MET CA C N S 297 MET C C N N 298 MET O O N N 299 MET CB C N N 300 MET CG C N N 301 MET SD S N N 302 MET CE C N N 303 MET OXT O N N 304 MET H H N N 305 MET H2 H N N 306 MET HA H N N 307 MET HB2 H N N 308 MET HB3 H N N 309 MET HG2 H N N 310 MET HG3 H N N 311 MET HE1 H N N 312 MET HE2 H N N 313 MET HE3 H N N 314 MET HXT H N N 315 PHE N N N N 316 PHE CA C N S 317 PHE C C N N 318 PHE O O N N 319 PHE CB C N N 320 PHE CG C Y N 321 PHE CD1 C Y N 322 PHE CD2 C Y N 323 PHE CE1 C Y N 324 PHE CE2 C Y N 325 PHE CZ C Y N 326 PHE OXT O N N 327 PHE H H N N 328 PHE H2 H N N 329 PHE HA H N N 330 PHE HB2 H N N 331 PHE HB3 H N N 332 PHE HD1 H N N 333 PHE HD2 H N N 334 PHE HE1 H N N 335 PHE HE2 H N N 336 PHE HZ H N N 337 PHE HXT H N N 338 PO4 P P N N 339 PO4 O1 O N N 340 PO4 O2 O N N 341 PO4 O3 O N N 342 PO4 O4 O N N 343 PRO N N N N 344 PRO CA C N S 345 PRO C C N N 346 PRO O O N N 347 PRO CB C N N 348 PRO CG C N N 349 PRO CD C N N 350 PRO OXT O N N 351 PRO H H N N 352 PRO HA H N N 353 PRO HB2 H N N 354 PRO HB3 H N N 355 PRO HG2 H N N 356 PRO HG3 H N N 357 PRO HD2 H N N 358 PRO HD3 H N N 359 PRO HXT H N N 360 SER N N N N 361 SER CA C N S 362 SER C C N N 363 SER O O N N 364 SER CB C N N 365 SER OG O N N 366 SER OXT O N N 367 SER H H N N 368 SER H2 H N N 369 SER HA H N N 370 SER HB2 H N N 371 SER HB3 H N N 372 SER HG H N N 373 SER HXT H N N 374 THR N N N N 375 THR CA C N S 376 THR C C N N 377 THR O O N N 378 THR CB C N R 379 THR OG1 O N N 380 THR CG2 C N N 381 THR OXT O N N 382 THR H H N N 383 THR H2 H N N 384 THR HA H N N 385 THR HB H N N 386 THR HG1 H N N 387 THR HG21 H N N 388 THR HG22 H N N 389 THR HG23 H N N 390 THR HXT H N N 391 TRP N N N N 392 TRP CA C N S 393 TRP C C N N 394 TRP O O N N 395 TRP CB C N N 396 TRP CG C Y N 397 TRP CD1 C Y N 398 TRP CD2 C Y N 399 TRP NE1 N Y N 400 TRP CE2 C Y N 401 TRP CE3 C Y N 402 TRP CZ2 C Y N 403 TRP CZ3 C Y N 404 TRP CH2 C Y N 405 TRP OXT O N N 406 TRP H H N N 407 TRP H2 H N N 408 TRP HA H N N 409 TRP HB2 H N N 410 TRP HB3 H N N 411 TRP HD1 H N N 412 TRP HE1 H N N 413 TRP HE3 H N N 414 TRP HZ2 H N N 415 TRP HZ3 H N N 416 TRP HH2 H N N 417 TRP HXT H N N 418 TYR N N N N 419 TYR CA C N S 420 TYR C C N N 421 TYR O O N N 422 TYR CB C N N 423 TYR CG C Y N 424 TYR CD1 C Y N 425 TYR CD2 C Y N 426 TYR CE1 C Y N 427 TYR CE2 C Y N 428 TYR CZ C Y N 429 TYR OH O N N 430 TYR OXT O N N 431 TYR H H N N 432 TYR H2 H N N 433 TYR HA H N N 434 TYR HB2 H N N 435 TYR HB3 H N N 436 TYR HD1 H N N 437 TYR HD2 H N N 438 TYR HE1 H N N 439 TYR HE2 H N N 440 TYR HH H N N 441 TYR HXT H N N 442 VAL N N N N 443 VAL CA C N S 444 VAL C C N N 445 VAL O O N N 446 VAL CB C N N 447 VAL CG1 C N N 448 VAL CG2 C N N 449 VAL OXT O N N 450 VAL H H N N 451 VAL H2 H N N 452 VAL HA H N N 453 VAL HB H N N 454 VAL HG11 H N N 455 VAL HG12 H N N 456 VAL HG13 H N N 457 VAL HG21 H N N 458 VAL HG22 H N N 459 VAL HG23 H N N 460 VAL HXT H N N 461 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 4LU C7M C7 sing N N 1 4LU C12 C5 sing N N 2 4LU C8M C8 sing N N 3 4LU C7 C8 doub Y N 4 4LU C7 C6 sing Y N 5 4LU C8 C9 sing Y N 6 4LU C13 C5 sing N N 7 4LU C5 C6 sing N N 8 4LU C5 C3 sing N N 9 4LU C6 C5A doub Y N 10 4LU C9 C9A doub Y N 11 4LU C3 C1 sing N N 12 4LU C5A C9A sing Y N 13 4LU C5A N5 sing N N 14 4LU C9A N10 sing N N 15 4LU C1 N5 doub N N 16 4LU N5 C4A sing N N 17 4LU "O2'" "C2'" sing N N 18 4LU N10 "C1'" sing N N 19 4LU N10 C10 sing N N 20 4LU C4A C10 doub N N 21 4LU C4A C4 sing N N 22 4LU "C1'" "C2'" sing N N 23 4LU C10 N1 sing N N 24 4LU "C2'" "C3'" sing N N 25 4LU O4 C4 doub N N 26 4LU "C3'" "C4'" sing N N 27 4LU "C3'" "O3'" sing N N 28 4LU C4 N3 sing N N 29 4LU "C4'" "O4'" sing N N 30 4LU "C4'" "C5'" sing N N 31 4LU "O5'" "C5'" sing N N 32 4LU "O5'" P sing N N 33 4LU N1 C2 sing N N 34 4LU N3 C2 sing N N 35 4LU O2P P doub N N 36 4LU C2 O2 doub N N 37 4LU P O3P sing N N 38 4LU P O1P sing N N 39 4LU C9 H1 sing N N 40 4LU N3 H2 sing N N 41 4LU C13 H3 sing N N 42 4LU C13 H4 sing N N 43 4LU C13 H5 sing N N 44 4LU C1 H6 sing N N 45 4LU C3 H9 sing N N 46 4LU C3 H10 sing N N 47 4LU C12 H11 sing N N 48 4LU C12 H12 sing N N 49 4LU C12 H13 sing N N 50 4LU C7M H14 sing N N 51 4LU C7M H15 sing N N 52 4LU C7M H16 sing N N 53 4LU C8M H17 sing N N 54 4LU C8M H18 sing N N 55 4LU C8M H19 sing N N 56 4LU "C1'" H20 sing N N 57 4LU "C1'" H21 sing N N 58 4LU "C2'" H22 sing N N 59 4LU "O2'" H23 sing N N 60 4LU "C3'" H24 sing N N 61 4LU "O3'" H25 sing N N 62 4LU "C4'" H26 sing N N 63 4LU "O4'" H27 sing N N 64 4LU "C5'" H28 sing N N 65 4LU "C5'" H29 sing N N 66 4LU O3P H30 sing N N 67 4LU O1P H31 sing N N 68 4LU N1 H7 sing N N 69 ALA N CA sing N N 70 ALA N H sing N N 71 ALA N H2 sing N N 72 ALA CA C sing N N 73 ALA CA CB sing N N 74 ALA CA HA sing N N 75 ALA C O doub N N 76 ALA C OXT sing N N 77 ALA CB HB1 sing N N 78 ALA CB HB2 sing N N 79 ALA CB HB3 sing N N 80 ALA OXT HXT sing N N 81 ARG N CA sing N N 82 ARG N H sing N N 83 ARG N H2 sing N N 84 ARG CA C sing N N 85 ARG CA CB sing N N 86 ARG CA HA sing N N 87 ARG C O doub N N 88 ARG C OXT sing N N 89 ARG CB CG sing N N 90 ARG CB HB2 sing N N 91 ARG CB HB3 sing N N 92 ARG CG CD sing N N 93 ARG CG HG2 sing N N 94 ARG CG HG3 sing N N 95 ARG CD NE sing N N 96 ARG CD HD2 sing N N 97 ARG CD HD3 sing N N 98 ARG NE CZ sing N N 99 ARG NE HE sing N N 100 ARG CZ NH1 sing N N 101 ARG CZ NH2 doub N N 102 ARG NH1 HH11 sing N N 103 ARG NH1 HH12 sing N N 104 ARG NH2 HH21 sing N N 105 ARG NH2 HH22 sing N N 106 ARG OXT HXT sing N N 107 ASN N CA sing N N 108 ASN N H sing N N 109 ASN N H2 sing N N 110 ASN CA C sing N N 111 ASN CA CB sing N N 112 ASN CA HA sing N N 113 ASN C O doub N N 114 ASN C OXT sing N N 115 ASN CB CG sing N N 116 ASN CB HB2 sing N N 117 ASN CB HB3 sing N N 118 ASN CG OD1 doub N N 119 ASN CG ND2 sing N N 120 ASN ND2 HD21 sing N N 121 ASN ND2 HD22 sing N N 122 ASN OXT HXT sing N N 123 ASP N CA sing N N 124 ASP N H sing N N 125 ASP N H2 sing N N 126 ASP CA C sing N N 127 ASP CA CB sing N N 128 ASP CA HA sing N N 129 ASP C O doub N N 130 ASP C OXT sing N N 131 ASP CB CG sing N N 132 ASP CB HB2 sing N N 133 ASP CB HB3 sing N N 134 ASP CG OD1 doub N N 135 ASP CG OD2 sing N N 136 ASP OD2 HD2 sing N N 137 ASP OXT HXT sing N N 138 CYS N CA sing N N 139 CYS N H sing N N 140 CYS N H2 sing N N 141 CYS CA C sing N N 142 CYS CA CB sing N N 143 CYS CA HA sing N N 144 CYS C O doub N N 145 CYS C OXT sing N N 146 CYS CB SG sing N N 147 CYS CB HB2 sing N N 148 CYS CB HB3 sing N N 149 CYS SG HG sing N N 150 CYS OXT HXT sing N N 151 GLN N CA sing N N 152 GLN N H sing N N 153 GLN N H2 sing N N 154 GLN CA C sing N N 155 GLN CA CB sing N N 156 GLN CA HA sing N N 157 GLN C O doub N N 158 GLN C OXT sing N N 159 GLN CB CG sing N N 160 GLN CB HB2 sing N N 161 GLN CB HB3 sing N N 162 GLN CG CD sing N N 163 GLN CG HG2 sing N N 164 GLN CG HG3 sing N N 165 GLN CD OE1 doub N N 166 GLN CD NE2 sing N N 167 GLN NE2 HE21 sing N N 168 GLN NE2 HE22 sing N N 169 GLN OXT HXT sing N N 170 GLU N CA sing N N 171 GLU N H sing N N 172 GLU N H2 sing N N 173 GLU CA C sing N N 174 GLU CA CB sing N N 175 GLU CA HA sing N N 176 GLU C O doub N N 177 GLU C OXT sing N N 178 GLU CB CG sing N N 179 GLU CB HB2 sing N N 180 GLU CB HB3 sing N N 181 GLU CG CD sing N N 182 GLU CG HG2 sing N N 183 GLU CG HG3 sing N N 184 GLU CD OE1 doub N N 185 GLU CD OE2 sing N N 186 GLU OE2 HE2 sing N N 187 GLU OXT HXT sing N N 188 GLY N CA sing N N 189 GLY N H sing N N 190 GLY N H2 sing N N 191 GLY CA C sing N N 192 GLY CA HA2 sing N N 193 GLY CA HA3 sing N N 194 GLY C O doub N N 195 GLY C OXT sing N N 196 GLY OXT HXT sing N N 197 HIS N CA sing N N 198 HIS N H sing N N 199 HIS N H2 sing N N 200 HIS CA C sing N N 201 HIS CA CB sing N N 202 HIS CA HA sing N N 203 HIS C O doub N N 204 HIS C OXT sing N N 205 HIS CB CG sing N N 206 HIS CB HB2 sing N N 207 HIS CB HB3 sing N N 208 HIS CG ND1 sing Y N 209 HIS CG CD2 doub Y N 210 HIS ND1 CE1 doub Y N 211 HIS ND1 HD1 sing N N 212 HIS CD2 NE2 sing Y N 213 HIS CD2 HD2 sing N N 214 HIS CE1 NE2 sing Y N 215 HIS CE1 HE1 sing N N 216 HIS NE2 HE2 sing N N 217 HIS OXT HXT sing N N 218 HOH O H1 sing N N 219 HOH O H2 sing N N 220 ILE N CA sing N N 221 ILE N H sing N N 222 ILE N H2 sing N N 223 ILE CA C sing N N 224 ILE CA CB sing N N 225 ILE CA HA sing N N 226 ILE C O doub N N 227 ILE C OXT sing N N 228 ILE CB CG1 sing N N 229 ILE CB CG2 sing N N 230 ILE CB HB sing N N 231 ILE CG1 CD1 sing N N 232 ILE CG1 HG12 sing N N 233 ILE CG1 HG13 sing N N 234 ILE CG2 HG21 sing N N 235 ILE CG2 HG22 sing N N 236 ILE CG2 HG23 sing N N 237 ILE CD1 HD11 sing N N 238 ILE CD1 HD12 sing N N 239 ILE CD1 HD13 sing N N 240 ILE OXT HXT sing N N 241 LEU N CA sing N N 242 LEU N H sing N N 243 LEU N H2 sing N N 244 LEU CA C sing N N 245 LEU CA CB sing N N 246 LEU CA HA sing N N 247 LEU C O doub N N 248 LEU C OXT sing N N 249 LEU CB CG sing N N 250 LEU CB HB2 sing N N 251 LEU CB HB3 sing N N 252 LEU CG CD1 sing N N 253 LEU CG CD2 sing N N 254 LEU CG HG sing N N 255 LEU CD1 HD11 sing N N 256 LEU CD1 HD12 sing N N 257 LEU CD1 HD13 sing N N 258 LEU CD2 HD21 sing N N 259 LEU CD2 HD22 sing N N 260 LEU CD2 HD23 sing N N 261 LEU OXT HXT sing N N 262 LYS N CA sing N N 263 LYS N H sing N N 264 LYS N H2 sing N N 265 LYS CA C sing N N 266 LYS CA CB sing N N 267 LYS CA HA sing N N 268 LYS C O doub N N 269 LYS C OXT sing N N 270 LYS CB CG sing N N 271 LYS CB HB2 sing N N 272 LYS CB HB3 sing N N 273 LYS CG CD sing N N 274 LYS CG HG2 sing N N 275 LYS CG HG3 sing N N 276 LYS CD CE sing N N 277 LYS CD HD2 sing N N 278 LYS CD HD3 sing N N 279 LYS CE NZ sing N N 280 LYS CE HE2 sing N N 281 LYS CE HE3 sing N N 282 LYS NZ HZ1 sing N N 283 LYS NZ HZ2 sing N N 284 LYS NZ HZ3 sing N N 285 LYS OXT HXT sing N N 286 MET N CA sing N N 287 MET N H sing N N 288 MET N H2 sing N N 289 MET CA C sing N N 290 MET CA CB sing N N 291 MET CA HA sing N N 292 MET C O doub N N 293 MET C OXT sing N N 294 MET CB CG sing N N 295 MET CB HB2 sing N N 296 MET CB HB3 sing N N 297 MET CG SD sing N N 298 MET CG HG2 sing N N 299 MET CG HG3 sing N N 300 MET SD CE sing N N 301 MET CE HE1 sing N N 302 MET CE HE2 sing N N 303 MET CE HE3 sing N N 304 MET OXT HXT sing N N 305 PHE N CA sing N N 306 PHE N H sing N N 307 PHE N H2 sing N N 308 PHE CA C sing N N 309 PHE CA CB sing N N 310 PHE CA HA sing N N 311 PHE C O doub N N 312 PHE C OXT sing N N 313 PHE CB CG sing N N 314 PHE CB HB2 sing N N 315 PHE CB HB3 sing N N 316 PHE CG CD1 doub Y N 317 PHE CG CD2 sing Y N 318 PHE CD1 CE1 sing Y N 319 PHE CD1 HD1 sing N N 320 PHE CD2 CE2 doub Y N 321 PHE CD2 HD2 sing N N 322 PHE CE1 CZ doub Y N 323 PHE CE1 HE1 sing N N 324 PHE CE2 CZ sing Y N 325 PHE CE2 HE2 sing N N 326 PHE CZ HZ sing N N 327 PHE OXT HXT sing N N 328 PO4 P O1 doub N N 329 PO4 P O2 sing N N 330 PO4 P O3 sing N N 331 PO4 P O4 sing N N 332 PRO N CA sing N N 333 PRO N CD sing N N 334 PRO N H sing N N 335 PRO CA C sing N N 336 PRO CA CB sing N N 337 PRO CA HA sing N N 338 PRO C O doub N N 339 PRO C OXT sing N N 340 PRO CB CG sing N N 341 PRO CB HB2 sing N N 342 PRO CB HB3 sing N N 343 PRO CG CD sing N N 344 PRO CG HG2 sing N N 345 PRO CG HG3 sing N N 346 PRO CD HD2 sing N N 347 PRO CD HD3 sing N N 348 PRO OXT HXT sing N N 349 SER N CA sing N N 350 SER N H sing N N 351 SER N H2 sing N N 352 SER CA C sing N N 353 SER CA CB sing N N 354 SER CA HA sing N N 355 SER C O doub N N 356 SER C OXT sing N N 357 SER CB OG sing N N 358 SER CB HB2 sing N N 359 SER CB HB3 sing N N 360 SER OG HG sing N N 361 SER OXT HXT sing N N 362 THR N CA sing N N 363 THR N H sing N N 364 THR N H2 sing N N 365 THR CA C sing N N 366 THR CA CB sing N N 367 THR CA HA sing N N 368 THR C O doub N N 369 THR C OXT sing N N 370 THR CB OG1 sing N N 371 THR CB CG2 sing N N 372 THR CB HB sing N N 373 THR OG1 HG1 sing N N 374 THR CG2 HG21 sing N N 375 THR CG2 HG22 sing N N 376 THR CG2 HG23 sing N N 377 THR OXT HXT sing N N 378 TRP N CA sing N N 379 TRP N H sing N N 380 TRP N H2 sing N N 381 TRP CA C sing N N 382 TRP CA CB sing N N 383 TRP CA HA sing N N 384 TRP C O doub N N 385 TRP C OXT sing N N 386 TRP CB CG sing N N 387 TRP CB HB2 sing N N 388 TRP CB HB3 sing N N 389 TRP CG CD1 doub Y N 390 TRP CG CD2 sing Y N 391 TRP CD1 NE1 sing Y N 392 TRP CD1 HD1 sing N N 393 TRP CD2 CE2 doub Y N 394 TRP CD2 CE3 sing Y N 395 TRP NE1 CE2 sing Y N 396 TRP NE1 HE1 sing N N 397 TRP CE2 CZ2 sing Y N 398 TRP CE3 CZ3 doub Y N 399 TRP CE3 HE3 sing N N 400 TRP CZ2 CH2 doub Y N 401 TRP CZ2 HZ2 sing N N 402 TRP CZ3 CH2 sing Y N 403 TRP CZ3 HZ3 sing N N 404 TRP CH2 HH2 sing N N 405 TRP OXT HXT sing N N 406 TYR N CA sing N N 407 TYR N H sing N N 408 TYR N H2 sing N N 409 TYR CA C sing N N 410 TYR CA CB sing N N 411 TYR CA HA sing N N 412 TYR C O doub N N 413 TYR C OXT sing N N 414 TYR CB CG sing N N 415 TYR CB HB2 sing N N 416 TYR CB HB3 sing N N 417 TYR CG CD1 doub Y N 418 TYR CG CD2 sing Y N 419 TYR CD1 CE1 sing Y N 420 TYR CD1 HD1 sing N N 421 TYR CD2 CE2 doub Y N 422 TYR CD2 HD2 sing N N 423 TYR CE1 CZ doub Y N 424 TYR CE1 HE1 sing N N 425 TYR CE2 CZ sing Y N 426 TYR CE2 HE2 sing N N 427 TYR CZ OH sing N N 428 TYR OH HH sing N N 429 TYR OXT HXT sing N N 430 VAL N CA sing N N 431 VAL N H sing N N 432 VAL N H2 sing N N 433 VAL CA C sing N N 434 VAL CA CB sing N N 435 VAL CA HA sing N N 436 VAL C O doub N N 437 VAL C OXT sing N N 438 VAL CB CG1 sing N N 439 VAL CB CG2 sing N N 440 VAL CB HB sing N N 441 VAL CG1 HG11 sing N N 442 VAL CG1 HG12 sing N N 443 VAL CG1 HG13 sing N N 444 VAL CG2 HG21 sing N N 445 VAL CG2 HG22 sing N N 446 VAL CG2 HG23 sing N N 447 VAL OXT HXT sing N N 448 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;1-deoxy-5-O-phosphono-1-(3,3,4,5-tetramethyl-9,11-dioxo-2,3,8,9,10,11-hexahydro-7H-quinolino[1,8-fg]pteridin-12-ium-7-y l)-D-ribitol ; 4LU 3 'PHOSPHATE ION' PO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2EJB _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #