data_6NEY # _entry.id 6NEY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NEY pdb_00006ney 10.2210/pdb6ney/pdb WWPDB D_1000238646 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NEY _pdbx_database_status.recvd_initial_deposition_date 2018-12-18 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Loppnau, P.' 1 ? 'Dong, A.' 2 ? 'Tempel, W.' 3 ? 'Lin, Y.H.' 4 ? 'Bountra, C.' 5 ? 'Arrowsmith, C.H.' 6 ? 'Edwards, A.M.' 7 ? 'Hui, R.' 8 ? 'Vedadi, M.' 9 ? 'Harding, R.J.' 10 ? 'Structural Genomics Consortium (SGC)' 11 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of TcBDF5, a bromodomain containing protein from Trypanosoma cruzi' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Loppnau, P.' 1 ? primary 'Dong, A.' 2 ? primary 'Tempel, W.' 3 ? primary 'Lin, Y.H.' 4 ? primary 'Bountra, C.' 5 ? primary 'Arrowsmith, C.H.' 6 ? primary 'Edwards, A.M.' 7 ? primary 'Hui, R.' 8 ? primary 'Vedadi, M.' 9 ? primary 'Harding, R.J.' 10 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6NEY _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.887 _cell.length_a_esd ? _cell.length_b 70.428 _cell.length_b_esd ? _cell.length_c 26.644 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NEY _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 15047.116 1 ? ? ? ? 2 water nat water 18.015 34 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMEERRQKFYPEEELVALVRSLDRPQDEGLFSMDVLVVYPHLEQEYTRVCPKRCDLATAAEKAANEAYSYDVNLTALRED IKLMVNNCYRFNGTKGPLANIAERFEAFAKEQIDAYVTKKAGGRRLSSLRL ; _entity_poly.pdbx_seq_one_letter_code_can ;GMEERRQKFYPEEELVALVRSLDRPQDEGLFSMDVLVVYPHLEQEYTRVCPKRCDLATAAEKAANEAYSYDVNLTALRED IKLMVNNCYRFNGTKGPLANIAERFEAFAKEQIDAYVTKKAGGRRLSSLRL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 GLU n 1 4 GLU n 1 5 ARG n 1 6 ARG n 1 7 GLN n 1 8 LYS n 1 9 PHE n 1 10 TYR n 1 11 PRO n 1 12 GLU n 1 13 GLU n 1 14 GLU n 1 15 LEU n 1 16 VAL n 1 17 ALA n 1 18 LEU n 1 19 VAL n 1 20 ARG n 1 21 SER n 1 22 LEU n 1 23 ASP n 1 24 ARG n 1 25 PRO n 1 26 GLN n 1 27 ASP n 1 28 GLU n 1 29 GLY n 1 30 LEU n 1 31 PHE n 1 32 SER n 1 33 MET n 1 34 ASP n 1 35 VAL n 1 36 LEU n 1 37 VAL n 1 38 VAL n 1 39 TYR n 1 40 PRO n 1 41 HIS n 1 42 LEU n 1 43 GLU n 1 44 GLN n 1 45 GLU n 1 46 TYR n 1 47 THR n 1 48 ARG n 1 49 VAL n 1 50 CYS n 1 51 PRO n 1 52 LYS n 1 53 ARG n 1 54 CYS n 1 55 ASP n 1 56 LEU n 1 57 ALA n 1 58 THR n 1 59 ALA n 1 60 ALA n 1 61 GLU n 1 62 LYS n 1 63 ALA n 1 64 ALA n 1 65 ASN n 1 66 GLU n 1 67 ALA n 1 68 TYR n 1 69 SER n 1 70 TYR n 1 71 ASP n 1 72 VAL n 1 73 ASN n 1 74 LEU n 1 75 THR n 1 76 ALA n 1 77 LEU n 1 78 ARG n 1 79 GLU n 1 80 ASP n 1 81 ILE n 1 82 LYS n 1 83 LEU n 1 84 MET n 1 85 VAL n 1 86 ASN n 1 87 ASN n 1 88 CYS n 1 89 TYR n 1 90 ARG n 1 91 PHE n 1 92 ASN n 1 93 GLY n 1 94 THR n 1 95 LYS n 1 96 GLY n 1 97 PRO n 1 98 LEU n 1 99 ALA n 1 100 ASN n 1 101 ILE n 1 102 ALA n 1 103 GLU n 1 104 ARG n 1 105 PHE n 1 106 GLU n 1 107 ALA n 1 108 PHE n 1 109 ALA n 1 110 LYS n 1 111 GLU n 1 112 GLN n 1 113 ILE n 1 114 ASP n 1 115 ALA n 1 116 TYR n 1 117 VAL n 1 118 THR n 1 119 LYS n 1 120 LYS n 1 121 ALA n 1 122 GLY n 1 123 GLY n 1 124 ARG n 1 125 ARG n 1 126 LEU n 1 127 SER n 1 128 SER n 1 129 LEU n 1 130 ARG n 1 131 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 131 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene C4B63_1g51 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trypanosoma cruzi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5693 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-pRARE2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15-MHL _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A2V2W6E9_TRYCR _struct_ref.pdbx_db_accession A0A2V2W6E9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEERRQKFYPEEELVALVRSLDRPQDEGLFSMDVLVVYPHLEQEYTRVCPKRCDLATAAEKAANEAYSYDVNLTALREDI KLMVNNCYRFNGTKGPLANIAERFEAFAKEQIDAYVTKKAGGRRLSSLRL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NEY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A2V2W6E9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 130 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6NEY _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A2V2W6E9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NEY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.25 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.502 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.8 M NH4SO4, 0.2 M Na Acetate and 0.1M Hepes pH7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-12-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NEY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.680 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13782 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.800 _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.951 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.087 _reflns.pdbx_Rpim_I_all 0.030 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.680 1.710 ? ? ? ? ? ? 555 83.700 ? ? ? ? 0.732 ? ? ? ? ? ? ? ? 6.000 ? 0.469 ? ? 0.789 0.283 ? 1 1 0.749 ? 1.710 1.740 ? ? ? ? ? ? 636 90.500 ? ? ? ? 0.620 ? ? ? ? ? ? ? ? 6.200 ? 0.447 ? ? 0.669 0.240 ? 2 1 0.814 ? 1.740 1.770 ? ? ? ? ? ? 670 95.300 ? ? ? ? 0.550 ? ? ? ? ? ? ? ? 6.400 ? 0.448 ? ? 0.594 0.216 ? 3 1 0.886 ? 1.770 1.810 ? ? ? ? ? ? 647 97.000 ? ? ? ? 0.534 ? ? ? ? ? ? ? ? 6.500 ? 0.461 ? ? 0.578 0.213 ? 4 1 0.878 ? 1.810 1.850 ? ? ? ? ? ? 659 98.900 ? ? ? ? 0.409 ? ? ? ? ? ? ? ? 7.000 ? 0.474 ? ? 0.439 0.157 ? 5 1 0.958 ? 1.850 1.890 ? ? ? ? ? ? 700 99.700 ? ? ? ? 0.381 ? ? ? ? ? ? ? ? 8.000 ? 0.493 ? ? 0.406 0.137 ? 6 1 0.950 ? 1.890 1.940 ? ? ? ? ? ? 685 99.900 ? ? ? ? 0.334 ? ? ? ? ? ? ? ? 8.200 ? 0.498 ? ? 0.355 0.119 ? 7 1 0.960 ? 1.940 1.990 ? ? ? ? ? ? 695 99.400 ? ? ? ? 0.276 ? ? ? ? ? ? ? ? 8.300 ? 0.509 ? ? 0.293 0.099 ? 8 1 0.973 ? 1.990 2.050 ? ? ? ? ? ? 684 100.000 ? ? ? ? 0.229 ? ? ? ? ? ? ? ? 8.200 ? 0.691 ? ? 0.243 0.082 ? 9 1 0.979 ? 2.050 2.120 ? ? ? ? ? ? 687 99.900 ? ? ? ? 0.185 ? ? ? ? ? ? ? ? 8.200 ? 0.672 ? ? 0.197 0.067 ? 10 1 0.984 ? 2.120 2.190 ? ? ? ? ? ? 683 99.700 ? ? ? ? 0.149 ? ? ? ? ? ? ? ? 7.500 ? 0.684 ? ? 0.160 0.057 ? 11 1 0.987 ? 2.190 2.280 ? ? ? ? ? ? 698 99.900 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 8.500 ? 0.757 ? ? 0.148 0.049 ? 12 1 0.991 ? 2.280 2.380 ? ? ? ? ? ? 708 99.900 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 8.700 ? 0.850 ? ? 0.115 0.038 ? 13 1 0.995 ? 2.380 2.510 ? ? ? ? ? ? 695 100.000 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 8.500 ? 0.858 ? ? 0.098 0.033 ? 14 1 0.997 ? 2.510 2.670 ? ? ? ? ? ? 709 99.600 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 8.400 ? 1.019 ? ? 0.094 0.031 ? 15 1 0.995 ? 2.670 2.870 ? ? ? ? ? ? 695 99.400 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 7.800 ? 1.218 ? ? 0.086 0.030 ? 16 1 0.996 ? 2.870 3.160 ? ? ? ? ? ? 717 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 8.700 ? 1.466 ? ? 0.077 0.026 ? 17 1 0.997 ? 3.160 3.620 ? ? ? ? ? ? 723 100.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 8.400 ? 1.915 ? ? 0.069 0.023 ? 18 1 0.997 ? 3.620 4.560 ? ? ? ? ? ? 736 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 7.700 ? 2.086 ? ? 0.062 0.021 ? 19 1 0.998 ? 4.560 50.000 ? ? ? ? ? ? 800 99.600 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 7.500 ? 2.071 ? ? 0.065 0.024 ? 20 1 0.995 ? # _refine.aniso_B[1][1] -2.08 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 2.46 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -0.38 _refine.B_iso_max ? _refine.B_iso_mean 26.064 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.925 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NEY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.68 _refine.ls_d_res_low 46.49 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13004 _refine.ls_number_reflns_R_free 675 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.38 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22603 _refine.ls_R_factor_R_free 0.26702 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22374 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5TCM _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.127 _refine.pdbx_overall_ESU_R_Free 0.126 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.902 _refine.overall_SU_ML 0.095 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 951 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 985 _refine_hist.d_res_high 1.68 _refine_hist.d_res_low 46.49 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 968 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 880 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.502 1.651 1312 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.388 1.574 2031 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.292 5.000 124 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.278 22.292 48 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.085 15.000 155 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.422 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.073 0.200 128 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1101 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 205 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.865 2.772 499 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.865 2.768 498 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.782 4.144 622 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.780 4.149 623 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.382 3.018 469 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.380 3.022 470 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.532 4.453 690 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.414 32.888 1080 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.412 32.909 1079 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.680 _refine_ls_shell.d_res_low 1.724 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 51 _refine_ls_shell.number_reflns_R_work 806 _refine_ls_shell.percent_reflns_obs 87.36 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.322 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.294 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6NEY _struct.title 'Crystal structure of TcBDF5, a bromodomain containing protein from Trypanosoma cruzi' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NEY _struct_keywords.text 'TcBDF5, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 11 ? LEU A 22 ? PRO A 10 LEU A 21 1 ? 12 HELX_P HELX_P2 AA2 ASP A 23 ? GLU A 28 ? ASP A 22 GLU A 27 5 ? 6 HELX_P HELX_P3 AA3 ASP A 34 ? TYR A 39 ? ASP A 33 TYR A 38 1 ? 6 HELX_P HELX_P4 AA4 LEU A 42 ? CYS A 50 ? LEU A 41 CYS A 49 1 ? 9 HELX_P HELX_P5 AA5 ASP A 55 ? ASN A 65 ? ASP A 54 ASN A 64 1 ? 11 HELX_P HELX_P6 AA6 LEU A 74 ? GLY A 93 ? LEU A 73 GLY A 92 1 ? 20 HELX_P HELX_P7 AA7 GLY A 96 ? ARG A 125 ? GLY A 95 ARG A 124 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6NEY _atom_sites.fract_transf_matrix[1][1] 0.016158 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014199 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.037532 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 GLU 3 2 ? ? ? A . n A 1 4 GLU 4 3 ? ? ? A . n A 1 5 ARG 5 4 ? ? ? A . n A 1 6 ARG 6 5 5 ARG ARG A . n A 1 7 GLN 7 6 6 GLN GLN A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 TYR 10 9 9 TYR TYR A . n A 1 11 PRO 11 10 10 PRO PRO A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 GLU 13 12 12 GLU GLU A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 VAL 19 18 18 VAL VAL A . n A 1 20 ARG 20 19 19 ARG ARG A . n A 1 21 SER 21 20 20 SER SER A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 ASP 23 22 22 ASP ASP A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 PRO 25 24 24 PRO PRO A . n A 1 26 GLN 26 25 25 GLN GLN A . n A 1 27 ASP 27 26 26 ASP ASP A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 GLY 29 28 28 GLY GLY A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 PHE 31 30 30 PHE PHE A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 MET 33 32 32 MET MET A . n A 1 34 ASP 34 33 33 ASP ASP A . n A 1 35 VAL 35 34 34 VAL VAL A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 TYR 39 38 38 TYR TYR A . n A 1 40 PRO 40 39 39 PRO PRO A . n A 1 41 HIS 41 40 40 HIS HIS A . n A 1 42 LEU 42 41 41 LEU LEU A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 GLN 44 43 43 GLN GLN A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 TYR 46 45 45 TYR TYR A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 ARG 48 47 47 ARG ARG A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 CYS 50 49 49 CYS CYS A . n A 1 51 PRO 51 50 50 PRO PRO A . n A 1 52 LYS 52 51 51 LYS LYS A . n A 1 53 ARG 53 52 52 ARG ARG A . n A 1 54 CYS 54 53 53 CYS CYS A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 LEU 56 55 55 LEU LEU A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 THR 58 57 57 THR THR A . n A 1 59 ALA 59 58 58 ALA ALA A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 ALA 63 62 62 ALA ALA A . n A 1 64 ALA 64 63 63 ALA ALA A . n A 1 65 ASN 65 64 64 ASN ASN A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 TYR 68 67 67 TYR TYR A . n A 1 69 SER 69 68 68 SER SER A . n A 1 70 TYR 70 69 69 TYR TYR A . n A 1 71 ASP 71 70 70 ASP ASP A . n A 1 72 VAL 72 71 71 VAL VAL A . n A 1 73 ASN 73 72 72 ASN ASN A . n A 1 74 LEU 74 73 73 LEU LEU A . n A 1 75 THR 75 74 74 THR THR A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 ARG 78 77 77 ARG ARG A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 ASP 80 79 79 ASP ASP A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 MET 84 83 83 MET MET A . n A 1 85 VAL 85 84 84 VAL VAL A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 ASN 87 86 86 ASN ASN A . n A 1 88 CYS 88 87 87 CYS CYS A . n A 1 89 TYR 89 88 88 TYR TYR A . n A 1 90 ARG 90 89 89 ARG ARG A . n A 1 91 PHE 91 90 90 PHE PHE A . n A 1 92 ASN 92 91 91 ASN ASN A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 THR 94 93 93 THR THR A . n A 1 95 LYS 95 94 94 LYS LYS A . n A 1 96 GLY 96 95 95 GLY GLY A . n A 1 97 PRO 97 96 96 PRO PRO A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 ALA 99 98 98 ALA ALA A . n A 1 100 ASN 100 99 99 ASN ASN A . n A 1 101 ILE 101 100 100 ILE ILE A . n A 1 102 ALA 102 101 101 ALA ALA A . n A 1 103 GLU 103 102 102 GLU GLU A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 PHE 105 104 104 PHE PHE A . n A 1 106 GLU 106 105 105 GLU GLU A . n A 1 107 ALA 107 106 106 ALA ALA A . n A 1 108 PHE 108 107 107 PHE PHE A . n A 1 109 ALA 109 108 108 ALA ALA A . n A 1 110 LYS 110 109 109 LYS LYS A . n A 1 111 GLU 111 110 110 GLU GLU A . n A 1 112 GLN 112 111 111 GLN GLN A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 ALA 115 114 114 ALA ALA A . n A 1 116 TYR 116 115 115 TYR TYR A . n A 1 117 VAL 117 116 116 VAL VAL A . n A 1 118 THR 118 117 117 THR THR A . n A 1 119 LYS 119 118 118 LYS LYS A . n A 1 120 LYS 120 119 119 LYS LYS A . n A 1 121 ALA 121 120 120 ALA ALA A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 GLY 123 122 122 GLY GLY A . n A 1 124 ARG 124 123 123 ARG ARG A . n A 1 125 ARG 125 124 124 ARG ARG A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 SER 127 126 126 SER SER A . n A 1 128 SER 128 127 127 SER SER A . n A 1 129 LEU 129 128 128 LEU LEU A . n A 1 130 ARG 130 129 129 ARG ARG A . n A 1 131 LEU 131 130 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 21 HOH HOH A . B 2 HOH 2 202 31 HOH HOH A . B 2 HOH 3 203 15 HOH HOH A . B 2 HOH 4 204 32 HOH HOH A . B 2 HOH 5 205 22 HOH HOH A . B 2 HOH 6 206 24 HOH HOH A . B 2 HOH 7 207 5 HOH HOH A . B 2 HOH 8 208 1 HOH HOH A . B 2 HOH 9 209 2 HOH HOH A . B 2 HOH 10 210 19 HOH HOH A . B 2 HOH 11 211 25 HOH HOH A . B 2 HOH 12 212 13 HOH HOH A . B 2 HOH 13 213 34 HOH HOH A . B 2 HOH 14 214 11 HOH HOH A . B 2 HOH 15 215 16 HOH HOH A . B 2 HOH 16 216 9 HOH HOH A . B 2 HOH 17 217 7 HOH HOH A . B 2 HOH 18 218 8 HOH HOH A . B 2 HOH 19 219 4 HOH HOH A . B 2 HOH 20 220 28 HOH HOH A . B 2 HOH 21 221 14 HOH HOH A . B 2 HOH 22 222 10 HOH HOH A . B 2 HOH 23 223 6 HOH HOH A . B 2 HOH 24 224 30 HOH HOH A . B 2 HOH 25 225 33 HOH HOH A . B 2 HOH 26 226 29 HOH HOH A . B 2 HOH 27 227 17 HOH HOH A . B 2 HOH 28 228 26 HOH HOH A . B 2 HOH 29 229 3 HOH HOH A . B 2 HOH 30 230 12 HOH HOH A . B 2 HOH 31 231 18 HOH HOH A . B 2 HOH 32 232 20 HOH HOH A . B 2 HOH 33 233 23 HOH HOH A . B 2 HOH 34 234 27 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7350 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-03-20 2 'Structure model' 1 1 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 6NEY _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.880 _pdbx_phasing_MR.d_res_low_rotation 39.520 _pdbx_phasing_MR.d_res_high_translation 3.880 _pdbx_phasing_MR.d_res_low_translation 39.520 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 105 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.08 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 5 ? CG ? A ARG 6 CG 2 1 Y 1 A ARG 5 ? CD ? A ARG 6 CD 3 1 Y 1 A ARG 5 ? NE ? A ARG 6 NE 4 1 Y 1 A ARG 5 ? CZ ? A ARG 6 CZ 5 1 Y 1 A ARG 5 ? NH1 ? A ARG 6 NH1 6 1 Y 1 A ARG 5 ? NH2 ? A ARG 6 NH2 7 1 Y 1 A ARG 19 ? NH1 ? A ARG 20 NH1 8 1 Y 1 A ARG 19 ? NH2 ? A ARG 20 NH2 9 1 Y 1 A GLN 43 ? CD ? A GLN 44 CD 10 1 Y 1 A GLN 43 ? OE1 ? A GLN 44 OE1 11 1 Y 1 A GLN 43 ? NE2 ? A GLN 44 NE2 12 1 Y 1 A ARG 47 ? CG ? A ARG 48 CG 13 1 Y 1 A ARG 47 ? CD ? A ARG 48 CD 14 1 Y 1 A ARG 47 ? NE ? A ARG 48 NE 15 1 Y 1 A ARG 47 ? CZ ? A ARG 48 CZ 16 1 Y 1 A ARG 47 ? NH1 ? A ARG 48 NH1 17 1 Y 1 A ARG 47 ? NH2 ? A ARG 48 NH2 18 1 Y 1 A VAL 48 ? CG1 ? A VAL 49 CG1 19 1 Y 1 A VAL 48 ? CG2 ? A VAL 49 CG2 20 1 Y 1 A LYS 51 ? CD ? A LYS 52 CD 21 1 Y 1 A LYS 51 ? CE ? A LYS 52 CE 22 1 Y 1 A LYS 51 ? NZ ? A LYS 52 NZ 23 1 Y 1 A GLU 60 ? CD ? A GLU 61 CD 24 1 Y 1 A GLU 60 ? OE1 ? A GLU 61 OE1 25 1 Y 1 A GLU 60 ? OE2 ? A GLU 61 OE2 26 1 Y 1 A ASN 64 ? OD1 ? A ASN 65 OD1 27 1 Y 1 A ASN 64 ? ND2 ? A ASN 65 ND2 28 1 Y 1 A GLU 78 ? CG ? A GLU 79 CG 29 1 Y 1 A GLU 78 ? CD ? A GLU 79 CD 30 1 Y 1 A GLU 78 ? OE1 ? A GLU 79 OE1 31 1 Y 1 A GLU 78 ? OE2 ? A GLU 79 OE2 32 1 Y 1 A LYS 81 ? CD ? A LYS 82 CD 33 1 Y 1 A LYS 81 ? CE ? A LYS 82 CE 34 1 Y 1 A LYS 81 ? NZ ? A LYS 82 NZ 35 1 Y 1 A ASN 85 ? OD1 ? A ASN 86 OD1 36 1 Y 1 A ASN 85 ? ND2 ? A ASN 86 ND2 37 1 Y 1 A ARG 89 ? CD ? A ARG 90 CD 38 1 Y 1 A ARG 89 ? NE ? A ARG 90 NE 39 1 Y 1 A ARG 89 ? CZ ? A ARG 90 CZ 40 1 Y 1 A ARG 89 ? NH1 ? A ARG 90 NH1 41 1 Y 1 A ARG 89 ? NH2 ? A ARG 90 NH2 42 1 Y 1 A LYS 94 ? CG ? A LYS 95 CG 43 1 Y 1 A LYS 94 ? CD ? A LYS 95 CD 44 1 Y 1 A LYS 94 ? CE ? A LYS 95 CE 45 1 Y 1 A LYS 94 ? NZ ? A LYS 95 NZ 46 1 Y 1 A GLU 110 ? CD ? A GLU 111 CD 47 1 Y 1 A GLU 110 ? OE1 ? A GLU 111 OE1 48 1 Y 1 A GLU 110 ? OE2 ? A GLU 111 OE2 49 1 Y 1 A ARG 129 ? CG ? A ARG 130 CG 50 1 Y 1 A ARG 129 ? CD ? A ARG 130 CD 51 1 Y 1 A ARG 129 ? NE ? A ARG 130 NE 52 1 Y 1 A ARG 129 ? CZ ? A ARG 130 CZ 53 1 Y 1 A ARG 129 ? NH1 ? A ARG 130 NH1 54 1 Y 1 A ARG 129 ? NH2 ? A ARG 130 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A GLU 2 ? A GLU 3 4 1 Y 1 A GLU 3 ? A GLU 4 5 1 Y 1 A ARG 4 ? A ARG 5 6 1 Y 1 A LEU 130 ? A LEU 131 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5TCM _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #