data_6NFK # _entry.id 6NFK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NFK pdb_00006nfk 10.2210/pdb6nfk/pdb WWPDB D_1000238712 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-25 2 'Structure model' 1 1 2020-01-29 3 'Structure model' 1 2 2023-10-11 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_database_2.pdbx_DOI' 12 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NFK _pdbx_database_status.recvd_initial_deposition_date 2018-12-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shi, K.' 1 0000-0003-4175-3714 'Orellana, K.' 2 ? 'Aihara, H.' 3 0000-0001-7508-6230 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Faseb Bioadv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2573-9832 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 2 _citation.language ? _citation.page_first 49 _citation.page_last 58 _citation.title 'Active site plasticity and possible modes of chemical inhibition of the human DNA deaminase APOBEC3B' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1096/fba.2019-00068 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shi, K.' 1 0000-0003-4175-3714 primary 'Demir, O.' 2 ? primary 'Carpenter, M.A.' 3 ? primary 'Banerjee, S.' 4 ? primary 'Harki, D.A.' 5 ? primary 'Amaro, R.E.' 6 ? primary 'Harris, R.S.' 7 ? primary 'Aihara, H.' 8 0000-0001-7508-6230 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA dC->dU-editing enzyme APOBEC-3B' 22843.818 1 3.5.4.38 'F200S, W228S, L230K, A242S, Y250S, E255Q, F308K, Y315D, D316Q, P317G, L318R, Y319C, K320Q' ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 3 non-polymer syn 'IODIDE ION' 126.904 1 ? ? ? ? 4 water nat water 18.015 74 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'A3B,Phorbolin-1-related protein,Phorbolin-2/3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEILRYLMDPDTFTSNFNNDPLVLRRRQTYLCYEVERLDNGTSVKMDQHMGFLCNESGRHAQLRFLDLVPSLQLDPAQIY RVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIKAARIYDDQGRCQEALQMLRDAGAQVSIMTYDEFEYCWDTFVYRQG CPFQPWDGLEEHSQALSGRLRAILQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEILRYLMDPDTFTSNFNNDPLVLRRRQTYLCYEVERLDNGTSVKMDQHMGFLCNESGRHAQLRFLDLVPSLQLDPAQIY RVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIKAARIYDDQGRCQEALQMLRDAGAQVSIMTYDEFEYCWDTFVYRQG CPFQPWDGLEEHSQALSGRLRAILQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 'IODIDE ION' IOD 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ILE n 1 4 LEU n 1 5 ARG n 1 6 TYR n 1 7 LEU n 1 8 MET n 1 9 ASP n 1 10 PRO n 1 11 ASP n 1 12 THR n 1 13 PHE n 1 14 THR n 1 15 SER n 1 16 ASN n 1 17 PHE n 1 18 ASN n 1 19 ASN n 1 20 ASP n 1 21 PRO n 1 22 LEU n 1 23 VAL n 1 24 LEU n 1 25 ARG n 1 26 ARG n 1 27 ARG n 1 28 GLN n 1 29 THR n 1 30 TYR n 1 31 LEU n 1 32 CYS n 1 33 TYR n 1 34 GLU n 1 35 VAL n 1 36 GLU n 1 37 ARG n 1 38 LEU n 1 39 ASP n 1 40 ASN n 1 41 GLY n 1 42 THR n 1 43 SER n 1 44 VAL n 1 45 LYS n 1 46 MET n 1 47 ASP n 1 48 GLN n 1 49 HIS n 1 50 MET n 1 51 GLY n 1 52 PHE n 1 53 LEU n 1 54 CYS n 1 55 ASN n 1 56 GLU n 1 57 SER n 1 58 GLY n 1 59 ARG n 1 60 HIS n 1 61 ALA n 1 62 GLN n 1 63 LEU n 1 64 ARG n 1 65 PHE n 1 66 LEU n 1 67 ASP n 1 68 LEU n 1 69 VAL n 1 70 PRO n 1 71 SER n 1 72 LEU n 1 73 GLN n 1 74 LEU n 1 75 ASP n 1 76 PRO n 1 77 ALA n 1 78 GLN n 1 79 ILE n 1 80 TYR n 1 81 ARG n 1 82 VAL n 1 83 THR n 1 84 TRP n 1 85 PHE n 1 86 ILE n 1 87 SER n 1 88 TRP n 1 89 SER n 1 90 PRO n 1 91 CYS n 1 92 PHE n 1 93 SER n 1 94 TRP n 1 95 GLY n 1 96 CYS n 1 97 ALA n 1 98 GLY n 1 99 GLU n 1 100 VAL n 1 101 ARG n 1 102 ALA n 1 103 PHE n 1 104 LEU n 1 105 GLN n 1 106 GLU n 1 107 ASN n 1 108 THR n 1 109 HIS n 1 110 VAL n 1 111 ARG n 1 112 LEU n 1 113 ARG n 1 114 ILE n 1 115 LYS n 1 116 ALA n 1 117 ALA n 1 118 ARG n 1 119 ILE n 1 120 TYR n 1 121 ASP n 1 122 ASP n 1 123 GLN n 1 124 GLY n 1 125 ARG n 1 126 CYS n 1 127 GLN n 1 128 GLU n 1 129 ALA n 1 130 LEU n 1 131 GLN n 1 132 MET n 1 133 LEU n 1 134 ARG n 1 135 ASP n 1 136 ALA n 1 137 GLY n 1 138 ALA n 1 139 GLN n 1 140 VAL n 1 141 SER n 1 142 ILE n 1 143 MET n 1 144 THR n 1 145 TYR n 1 146 ASP n 1 147 GLU n 1 148 PHE n 1 149 GLU n 1 150 TYR n 1 151 CYS n 1 152 TRP n 1 153 ASP n 1 154 THR n 1 155 PHE n 1 156 VAL n 1 157 TYR n 1 158 ARG n 1 159 GLN n 1 160 GLY n 1 161 CYS n 1 162 PRO n 1 163 PHE n 1 164 GLN n 1 165 PRO n 1 166 TRP n 1 167 ASP n 1 168 GLY n 1 169 LEU n 1 170 GLU n 1 171 GLU n 1 172 HIS n 1 173 SER n 1 174 GLN n 1 175 ALA n 1 176 LEU n 1 177 SER n 1 178 GLY n 1 179 ARG n 1 180 LEU n 1 181 ARG n 1 182 ALA n 1 183 ILE n 1 184 LEU n 1 185 GLN n 1 186 LEU n 1 187 GLU n 1 188 HIS n 1 189 HIS n 1 190 HIS n 1 191 HIS n 1 192 HIS n 1 193 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 193 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene APOBEC3B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 186 ? ? ? A . n A 1 2 GLU 2 187 ? ? ? A . n A 1 3 ILE 3 188 ? ? ? A . n A 1 4 LEU 4 189 ? ? ? A . n A 1 5 ARG 5 190 190 ARG ARG A . n A 1 6 TYR 6 191 191 TYR TYR A . n A 1 7 LEU 7 192 192 LEU LEU A . n A 1 8 MET 8 193 193 MET MET A . n A 1 9 ASP 9 194 194 ASP ASP A . n A 1 10 PRO 10 195 195 PRO PRO A . n A 1 11 ASP 11 196 196 ASP ASP A . n A 1 12 THR 12 197 197 THR THR A . n A 1 13 PHE 13 198 198 PHE PHE A . n A 1 14 THR 14 199 199 THR THR A . n A 1 15 SER 15 200 200 SER SER A . n A 1 16 ASN 16 201 201 ASN ASN A . n A 1 17 PHE 17 202 202 PHE PHE A . n A 1 18 ASN 18 203 203 ASN ASN A . n A 1 19 ASN 19 204 204 ASN ASN A . n A 1 20 ASP 20 205 205 ASP ASP A . n A 1 21 PRO 21 206 206 PRO PRO A . n A 1 22 LEU 22 207 207 LEU LEU A . n A 1 23 VAL 23 208 208 VAL VAL A . n A 1 24 LEU 24 209 209 LEU LEU A . n A 1 25 ARG 25 210 210 ARG ARG A . n A 1 26 ARG 26 211 211 ARG ARG A . n A 1 27 ARG 27 212 212 ARG ARG A . n A 1 28 GLN 28 213 213 GLN GLN A . n A 1 29 THR 29 214 214 THR THR A . n A 1 30 TYR 30 215 215 TYR TYR A . n A 1 31 LEU 31 216 216 LEU LEU A . n A 1 32 CYS 32 217 217 CYS CYS A . n A 1 33 TYR 33 218 218 TYR TYR A . n A 1 34 GLU 34 219 219 GLU GLU A . n A 1 35 VAL 35 220 220 VAL VAL A . n A 1 36 GLU 36 221 221 GLU GLU A . n A 1 37 ARG 37 222 222 ARG ARG A . n A 1 38 LEU 38 223 223 LEU LEU A . n A 1 39 ASP 39 224 224 ASP ASP A . n A 1 40 ASN 40 225 225 ASN ASN A . n A 1 41 GLY 41 226 226 GLY GLY A . n A 1 42 THR 42 227 227 THR THR A . n A 1 43 SER 43 228 228 SER SER A . n A 1 44 VAL 44 229 229 VAL VAL A . n A 1 45 LYS 45 230 230 LYS LYS A . n A 1 46 MET 46 231 231 MET MET A . n A 1 47 ASP 47 232 232 ASP ASP A . n A 1 48 GLN 48 233 233 GLN GLN A . n A 1 49 HIS 49 234 234 HIS HIS A . n A 1 50 MET 50 235 235 MET MET A . n A 1 51 GLY 51 236 236 GLY GLY A . n A 1 52 PHE 52 237 237 PHE PHE A . n A 1 53 LEU 53 238 238 LEU LEU A . n A 1 54 CYS 54 239 239 CYS CYS A . n A 1 55 ASN 55 240 240 ASN ASN A . n A 1 56 GLU 56 241 241 GLU GLU A . n A 1 57 SER 57 250 250 SER SER A . n A 1 58 GLY 58 251 251 GLY GLY A . n A 1 59 ARG 59 252 252 ARG ARG A . n A 1 60 HIS 60 253 253 HIS HIS A . n A 1 61 ALA 61 254 254 ALA ALA A . n A 1 62 GLN 62 255 255 GLN GLN A . n A 1 63 LEU 63 256 256 LEU LEU A . n A 1 64 ARG 64 257 257 ARG ARG A . n A 1 65 PHE 65 258 258 PHE PHE A . n A 1 66 LEU 66 259 259 LEU LEU A . n A 1 67 ASP 67 260 260 ASP ASP A . n A 1 68 LEU 68 261 261 LEU LEU A . n A 1 69 VAL 69 262 262 VAL VAL A . n A 1 70 PRO 70 263 263 PRO PRO A . n A 1 71 SER 71 264 264 SER SER A . n A 1 72 LEU 72 265 265 LEU LEU A . n A 1 73 GLN 73 266 266 GLN GLN A . n A 1 74 LEU 74 267 267 LEU LEU A . n A 1 75 ASP 75 268 268 ASP ASP A . n A 1 76 PRO 76 269 269 PRO PRO A . n A 1 77 ALA 77 270 270 ALA ALA A . n A 1 78 GLN 78 271 271 GLN GLN A . n A 1 79 ILE 79 272 272 ILE ILE A . n A 1 80 TYR 80 273 273 TYR TYR A . n A 1 81 ARG 81 274 274 ARG ARG A . n A 1 82 VAL 82 275 275 VAL VAL A . n A 1 83 THR 83 276 276 THR THR A . n A 1 84 TRP 84 277 277 TRP TRP A . n A 1 85 PHE 85 278 278 PHE PHE A . n A 1 86 ILE 86 279 279 ILE ILE A . n A 1 87 SER 87 280 280 SER SER A . n A 1 88 TRP 88 281 281 TRP TRP A . n A 1 89 SER 89 282 282 SER SER A . n A 1 90 PRO 90 283 283 PRO PRO A . n A 1 91 CYS 91 284 284 CYS CYS A . n A 1 92 PHE 92 285 285 PHE PHE A . n A 1 93 SER 93 286 286 SER SER A . n A 1 94 TRP 94 287 287 TRP TRP A . n A 1 95 GLY 95 288 288 GLY GLY A . n A 1 96 CYS 96 289 289 CYS CYS A . n A 1 97 ALA 97 290 290 ALA ALA A . n A 1 98 GLY 98 291 291 GLY GLY A . n A 1 99 GLU 99 292 292 GLU GLU A . n A 1 100 VAL 100 293 293 VAL VAL A . n A 1 101 ARG 101 294 294 ARG ARG A . n A 1 102 ALA 102 295 295 ALA ALA A . n A 1 103 PHE 103 296 296 PHE PHE A . n A 1 104 LEU 104 297 297 LEU LEU A . n A 1 105 GLN 105 298 298 GLN GLN A . n A 1 106 GLU 106 299 299 GLU GLU A . n A 1 107 ASN 107 300 300 ASN ASN A . n A 1 108 THR 108 301 301 THR THR A . n A 1 109 HIS 109 302 302 HIS HIS A . n A 1 110 VAL 110 303 303 VAL VAL A . n A 1 111 ARG 111 304 304 ARG ARG A . n A 1 112 LEU 112 305 305 LEU LEU A . n A 1 113 ARG 113 306 306 ARG ARG A . n A 1 114 ILE 114 307 307 ILE ILE A . n A 1 115 LYS 115 308 308 LYS LYS A . n A 1 116 ALA 116 309 309 ALA ALA A . n A 1 117 ALA 117 310 310 ALA ALA A . n A 1 118 ARG 118 311 311 ARG ARG A . n A 1 119 ILE 119 312 312 ILE ILE A . n A 1 120 TYR 120 313 313 TYR TYR A . n A 1 121 ASP 121 314 314 ASP ASP A . n A 1 122 ASP 122 315 315 ASP ASP A . n A 1 123 GLN 123 316 316 GLN GLN A . n A 1 124 GLY 124 317 317 GLY GLY A . n A 1 125 ARG 125 318 318 ARG ARG A . n A 1 126 CYS 126 319 319 CYS CYS A . n A 1 127 GLN 127 320 320 GLN GLN A . n A 1 128 GLU 128 321 321 GLU GLU A . n A 1 129 ALA 129 322 322 ALA ALA A . n A 1 130 LEU 130 323 323 LEU LEU A . n A 1 131 GLN 131 324 324 GLN GLN A . n A 1 132 MET 132 325 325 MET MET A . n A 1 133 LEU 133 326 326 LEU LEU A . n A 1 134 ARG 134 327 327 ARG ARG A . n A 1 135 ASP 135 328 328 ASP ASP A . n A 1 136 ALA 136 329 329 ALA ALA A . n A 1 137 GLY 137 330 330 GLY GLY A . n A 1 138 ALA 138 331 331 ALA ALA A . n A 1 139 GLN 139 332 332 GLN GLN A . n A 1 140 VAL 140 333 333 VAL VAL A . n A 1 141 SER 141 334 334 SER SER A . n A 1 142 ILE 142 335 335 ILE ILE A . n A 1 143 MET 143 336 336 MET MET A . n A 1 144 THR 144 337 337 THR THR A . n A 1 145 TYR 145 338 338 TYR TYR A . n A 1 146 ASP 146 339 339 ASP ASP A . n A 1 147 GLU 147 340 340 GLU GLU A . n A 1 148 PHE 148 341 341 PHE PHE A . n A 1 149 GLU 149 342 342 GLU GLU A . n A 1 150 TYR 150 343 343 TYR TYR A . n A 1 151 CYS 151 344 344 CYS CYS A . n A 1 152 TRP 152 345 345 TRP TRP A . n A 1 153 ASP 153 346 346 ASP ASP A . n A 1 154 THR 154 347 347 THR THR A . n A 1 155 PHE 155 348 348 PHE PHE A . n A 1 156 VAL 156 349 349 VAL VAL A . n A 1 157 TYR 157 350 350 TYR TYR A . n A 1 158 ARG 158 351 351 ARG ARG A . n A 1 159 GLN 159 352 352 GLN GLN A . n A 1 160 GLY 160 353 353 GLY GLY A . n A 1 161 CYS 161 354 354 CYS CYS A . n A 1 162 PRO 162 355 355 PRO PRO A . n A 1 163 PHE 163 356 356 PHE PHE A . n A 1 164 GLN 164 357 357 GLN GLN A . n A 1 165 PRO 165 358 358 PRO PRO A . n A 1 166 TRP 166 359 359 TRP TRP A . n A 1 167 ASP 167 360 360 ASP ASP A . n A 1 168 GLY 168 361 361 GLY GLY A . n A 1 169 LEU 169 362 362 LEU LEU A . n A 1 170 GLU 170 363 363 GLU GLU A . n A 1 171 GLU 171 364 364 GLU GLU A . n A 1 172 HIS 172 365 365 HIS HIS A . n A 1 173 SER 173 366 366 SER SER A . n A 1 174 GLN 174 367 367 GLN GLN A . n A 1 175 ALA 175 368 368 ALA ALA A . n A 1 176 LEU 176 369 369 LEU LEU A . n A 1 177 SER 177 370 370 SER SER A . n A 1 178 GLY 178 371 371 GLY GLY A . n A 1 179 ARG 179 372 372 ARG ARG A . n A 1 180 LEU 180 373 373 LEU LEU A . n A 1 181 ARG 181 374 374 ARG ARG A . n A 1 182 ALA 182 375 375 ALA ALA A . n A 1 183 ILE 183 376 376 ILE ILE A . n A 1 184 LEU 184 377 377 LEU LEU A . n A 1 185 GLN 185 378 378 GLN GLN A . n A 1 186 LEU 186 379 379 LEU LEU A . n A 1 187 GLU 187 380 ? ? ? A . n A 1 188 HIS 188 381 ? ? ? A . n A 1 189 HIS 189 382 ? ? ? A . n A 1 190 HIS 190 383 ? ? ? A . n A 1 191 HIS 191 384 ? ? ? A . n A 1 192 HIS 192 385 ? ? ? A . n A 1 193 HIS 193 386 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 401 401 EDO EDO A . C 2 EDO 1 402 402 EDO EDO A . D 2 EDO 1 403 403 EDO EDO A . E 3 IOD 1 404 404 IOD IOD A . F 4 HOH 1 501 502 HOH HOH A . F 4 HOH 2 502 501 HOH HOH A . F 4 HOH 3 503 503 HOH HOH A . F 4 HOH 4 504 505 HOH HOH A . F 4 HOH 5 505 506 HOH HOH A . F 4 HOH 6 506 508 HOH HOH A . F 4 HOH 7 507 513 HOH HOH A . F 4 HOH 8 508 509 HOH HOH A . F 4 HOH 9 509 507 HOH HOH A . F 4 HOH 10 510 504 HOH HOH A . F 4 HOH 11 511 512 HOH HOH A . F 4 HOH 12 512 514 HOH HOH A . F 4 HOH 13 513 524 HOH HOH A . F 4 HOH 14 514 525 HOH HOH A . F 4 HOH 15 515 519 HOH HOH A . F 4 HOH 16 516 522 HOH HOH A . F 4 HOH 17 517 510 HOH HOH A . F 4 HOH 18 518 520 HOH HOH A . F 4 HOH 19 519 511 HOH HOH A . F 4 HOH 20 520 521 HOH HOH A . F 4 HOH 21 521 517 HOH HOH A . F 4 HOH 22 522 516 HOH HOH A . F 4 HOH 23 523 523 HOH HOH A . F 4 HOH 24 524 534 HOH HOH A . F 4 HOH 25 525 538 HOH HOH A . F 4 HOH 26 526 529 HOH HOH A . F 4 HOH 27 527 515 HOH HOH A . F 4 HOH 28 528 518 HOH HOH A . F 4 HOH 29 529 533 HOH HOH A . F 4 HOH 30 530 532 HOH HOH A . F 4 HOH 31 531 527 HOH HOH A . F 4 HOH 32 532 526 HOH HOH A . F 4 HOH 33 533 530 HOH HOH A . F 4 HOH 34 534 536 HOH HOH A . F 4 HOH 35 535 528 HOH HOH A . F 4 HOH 36 536 535 HOH HOH A . F 4 HOH 37 537 531 HOH HOH A . F 4 HOH 38 538 543 HOH HOH A . F 4 HOH 39 539 539 HOH HOH A . F 4 HOH 40 540 540 HOH HOH A . F 4 HOH 41 541 545 HOH HOH A . F 4 HOH 42 542 537 HOH HOH A . F 4 HOH 43 543 542 HOH HOH A . F 4 HOH 44 544 548 HOH HOH A . F 4 HOH 45 545 544 HOH HOH A . F 4 HOH 46 546 547 HOH HOH A . F 4 HOH 47 547 558 HOH HOH A . F 4 HOH 48 548 550 HOH HOH A . F 4 HOH 49 549 546 HOH HOH A . F 4 HOH 50 550 541 HOH HOH A . F 4 HOH 51 551 556 HOH HOH A . F 4 HOH 52 552 555 HOH HOH A . F 4 HOH 53 553 557 HOH HOH A . F 4 HOH 54 554 551 HOH HOH A . F 4 HOH 55 555 552 HOH HOH A . F 4 HOH 56 556 553 HOH HOH A . F 4 HOH 57 557 554 HOH HOH A . F 4 HOH 58 558 549 HOH HOH A . F 4 HOH 59 559 559 HOH HOH A . F 4 HOH 60 560 562 HOH HOH A . F 4 HOH 61 561 560 HOH HOH A . F 4 HOH 62 562 565 HOH HOH A . F 4 HOH 63 563 564 HOH HOH A . F 4 HOH 64 564 561 HOH HOH A . F 4 HOH 65 565 563 HOH HOH A . F 4 HOH 66 566 566 HOH HOH A . F 4 HOH 67 567 568 HOH HOH A . F 4 HOH 68 568 569 HOH HOH A . F 4 HOH 69 569 567 HOH HOH A . F 4 HOH 70 570 571 HOH HOH A . F 4 HOH 71 571 570 HOH HOH A . F 4 HOH 72 572 572 HOH HOH A . F 4 HOH 73 573 573 HOH HOH A . F 4 HOH 74 574 574 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_3366: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6NFK _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.600 _cell.length_a_esd ? _cell.length_b 50.600 _cell.length_b_esd ? _cell.length_c 149.300 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NFK _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NFK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Sodium Iodide, PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NFK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.86 _reflns.d_resolution_low 35.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17023 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.37 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.057 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.062 _reflns.pdbx_Rpim_I_all 0.024 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.86 _reflns_shell.d_res_low 1.92 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1631 _reflns_shell.percent_possible_all 98.43 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.30 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.4 _reflns_shell.pdbx_Rsym_value 1.30 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.41 _reflns_shell.pdbx_Rpim_I_all 0.54 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.54 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NFK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.860 _refine.ls_d_res_low 35.780 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17020 _refine.ls_number_reflns_R_free 873 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.39 _refine.ls_percent_reflns_R_free 5.13 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1914 _refine.ls_R_factor_R_free 0.2379 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1888 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5CQD _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.02 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1502 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 1589 _refine_hist.d_res_high 1.860 _refine_hist.d_res_low 35.780 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 ? 1569 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.220 ? 2124 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 20.907 ? 930 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.076 ? 217 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 280 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8600 1.9766 . . 142 2595 99.00 . . . 0.3523 . 0.2645 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9766 2.1291 . . 133 2659 100.00 . . . 0.2735 . 0.1991 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1291 2.3434 . . 141 2632 99.00 . . . 0.2435 . 0.1805 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3434 2.6824 . . 153 2674 100.00 . . . 0.2110 . 0.1753 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6824 3.3791 . . 136 2732 100.00 . . . 0.2242 . 0.1992 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3791 35.7862 . . 168 2855 99.00 . . . 0.2389 . 0.1826 . . . . . . . . . . # _struct.entry_id 6NFK _struct.title 'Crystal Structure of the Cancer Genomic DNA Mutator APOBEC3B with loop 7 from APOBEC3G bound to iodide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NFK _struct_keywords.text 'APOBEC, deaminase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABC3B_HUMAN _struct_ref.pdbx_db_accession Q9UH17 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSLQ LDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWD TFVYRQGCPFQPWDGLEEHSQALSGRLRAILQ ; _struct_ref.pdbx_align_begin 187 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NFK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UH17 _struct_ref_seq.db_align_beg 187 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 378 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 187 _struct_ref_seq.pdbx_auth_seq_align_end 378 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NFK MET A 1 ? UNP Q9UH17 ? ? 'initiating methionine' 186 1 1 6NFK SER A 15 ? UNP Q9UH17 PHE 200 'engineered mutation' 200 2 1 6NFK SER A 43 ? UNP Q9UH17 TRP 228 'engineered mutation' 228 3 1 6NFK LYS A 45 ? UNP Q9UH17 LEU 230 'engineered mutation' 230 4 1 6NFK SER A 57 ? UNP Q9UH17 ALA 242 'engineered mutation' 250 5 1 6NFK ? A ? ? UNP Q9UH17 LYS 243 deletion ? 6 1 6NFK ? A ? ? UNP Q9UH17 ASN 244 deletion ? 7 1 6NFK ? A ? ? UNP Q9UH17 LEU 245 deletion ? 8 1 6NFK ? A ? ? UNP Q9UH17 LEU 246 deletion ? 9 1 6NFK ? A ? ? UNP Q9UH17 CYS 247 deletion ? 10 1 6NFK ? A ? ? UNP Q9UH17 GLY 248 deletion ? 11 1 6NFK ? A ? ? UNP Q9UH17 PHE 249 deletion ? 12 1 6NFK ? A ? ? UNP Q9UH17 TYR 250 deletion ? 13 1 6NFK GLN A 62 ? UNP Q9UH17 GLU 255 'engineered mutation' 255 14 1 6NFK LYS A 115 ? UNP Q9UH17 PHE 308 'engineered mutation' 308 15 1 6NFK ASP A 122 ? UNP Q9UH17 TYR 315 'engineered mutation' 315 16 1 6NFK GLN A 123 ? UNP Q9UH17 ASP 316 'engineered mutation' 316 17 1 6NFK GLY A 124 ? UNP Q9UH17 PRO 317 'engineered mutation' 317 18 1 6NFK ARG A 125 ? UNP Q9UH17 LEU 318 'engineered mutation' 318 19 1 6NFK CYS A 126 ? UNP Q9UH17 TYR 319 'engineered mutation' 319 20 1 6NFK GLN A 127 ? UNP Q9UH17 LYS 320 'engineered mutation' 320 21 1 6NFK LEU A 186 ? UNP Q9UH17 ? ? 'expression tag' 379 22 1 6NFK GLU A 187 ? UNP Q9UH17 ? ? 'expression tag' 380 23 1 6NFK HIS A 188 ? UNP Q9UH17 ? ? 'expression tag' 381 24 1 6NFK HIS A 189 ? UNP Q9UH17 ? ? 'expression tag' 382 25 1 6NFK HIS A 190 ? UNP Q9UH17 ? ? 'expression tag' 383 26 1 6NFK HIS A 191 ? UNP Q9UH17 ? ? 'expression tag' 384 27 1 6NFK HIS A 192 ? UNP Q9UH17 ? ? 'expression tag' 385 28 1 6NFK HIS A 193 ? UNP Q9UH17 ? ? 'expression tag' 386 29 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 9 ? ASN A 18 ? ASP A 194 ASN A 203 1 ? 10 HELX_P HELX_P2 AA2 HIS A 60 ? VAL A 69 ? HIS A 253 VAL A 262 1 ? 10 HELX_P HELX_P3 AA3 PRO A 70 ? GLN A 73 ? PRO A 263 GLN A 266 5 ? 4 HELX_P HELX_P4 AA4 GLY A 95 ? ASN A 107 ? GLY A 288 ASN A 300 1 ? 13 HELX_P HELX_P5 AA5 GLY A 124 ? ALA A 136 ? GLY A 317 ALA A 329 1 ? 13 HELX_P HELX_P6 AA6 THR A 144 ? VAL A 156 ? THR A 337 VAL A 349 1 ? 13 HELX_P HELX_P7 AA7 GLY A 168 ? GLN A 185 ? GLY A 361 GLN A 378 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 91 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 96 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 284 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 289 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.440 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 91 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 96 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 284 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 289 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 89 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 282 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 90 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 283 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.85 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 42 ? CYS A 54 ? THR A 227 CYS A 239 AA1 2 TYR A 30 ? ASP A 39 ? TYR A 215 ASP A 224 AA1 3 TYR A 80 ? ILE A 86 ? TYR A 273 ILE A 279 AA1 4 VAL A 110 ? ALA A 116 ? VAL A 303 ALA A 309 AA1 5 GLN A 139 ? ILE A 142 ? GLN A 332 ILE A 335 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 51 ? O GLY A 236 N TYR A 33 ? N TYR A 218 AA1 2 3 N CYS A 32 ? N CYS A 217 O PHE A 85 ? O PHE A 278 AA1 3 4 N TRP A 84 ? N TRP A 277 O LYS A 115 ? O LYS A 308 AA1 4 5 N ALA A 116 ? N ALA A 309 O SER A 141 ? O SER A 334 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 401 ? 1 'binding site for residue EDO A 401' AC2 Software A EDO 402 ? 6 'binding site for residue EDO A 402' AC3 Software A EDO 403 ? 4 'binding site for residue EDO A 403' AC4 Software A IOD 404 ? 2 'binding site for residue IOD A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 LEU A 186 ? LEU A 379 . ? 1_555 ? 2 AC2 6 ARG A 27 ? ARG A 212 . ? 6_544 ? 3 AC2 6 GLN A 28 ? GLN A 213 . ? 6_544 ? 4 AC2 6 ASP A 146 ? ASP A 339 . ? 1_555 ? 5 AC2 6 GLU A 149 ? GLU A 342 . ? 1_555 ? 6 AC2 6 TYR A 150 ? TYR A 343 . ? 1_555 ? 7 AC2 6 HOH F . ? HOH A 505 . ? 6_544 ? 8 AC3 4 TYR A 6 ? TYR A 191 . ? 1_555 ? 9 AC3 4 GLY A 51 ? GLY A 236 . ? 1_555 ? 10 AC3 4 PHE A 52 ? PHE A 237 . ? 1_555 ? 11 AC3 4 GLN A 174 ? GLN A 367 . ? 6_444 ? 12 AC4 2 GLN A 62 ? GLN A 255 . ? 1_555 ? 13 AC4 2 SER A 89 ? SER A 282 . ? 1_555 ? # _pdbx_entry_details.entry_id 6NFK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 203 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 501 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 538 ? ? 1_555 O A HOH 561 ? ? 6_544 2.09 2 1 OG A SER 250 ? ? 1_555 OH A TYR 338 ? B 6_444 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 250 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 62.04 _pdbx_validate_torsion.psi 62.81 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -16.2486 -10.6300 -21.7658 0.3345 0.4938 0.4268 -0.0095 -0.0210 0.0101 0.0850 0.0655 0.0930 0.1239 -0.1564 -0.0984 0.0092 0.3191 0.2354 -0.0908 0.1707 0.4208 -0.0575 -0.6170 0.0003 'X-RAY DIFFRACTION' 2 ? refined -16.2666 -12.3485 -7.2828 0.4710 0.5276 0.4680 -0.0103 0.0509 0.0155 -0.0370 0.1878 -0.0205 0.1005 0.0380 0.0166 0.1382 0.0948 -0.0094 0.3808 -0.0515 0.2985 0.4238 -0.4103 -0.0000 'X-RAY DIFFRACTION' 3 ? refined -5.5499 -23.0781 -27.9435 0.5121 0.4407 0.2548 -0.0368 0.0908 -0.0309 0.6771 1.1864 0.6426 0.8120 -0.2452 -0.0722 -0.1550 0.6414 -0.0466 -0.6286 0.1816 -0.0185 0.1057 -0.1277 0.1331 'X-RAY DIFFRACTION' 4 ? refined -13.3639 -30.4420 -22.7453 0.4110 0.3767 0.4582 -0.0734 -0.0127 -0.0204 0.6073 1.1894 1.1732 0.0030 0.4081 -1.0634 -0.1828 -0.2434 -0.8131 -0.0520 0.3104 0.5955 0.7524 -0.2769 0.0057 'X-RAY DIFFRACTION' 5 ? refined -9.6243 -28.5859 -13.6982 0.5359 0.4362 0.5061 0.0241 0.0288 0.0951 0.7313 0.2642 0.2351 -0.1833 -0.1753 -0.0376 -0.0502 -0.4237 -0.3480 0.1716 0.1554 0.2183 0.4864 -0.2750 -0.0000 'X-RAY DIFFRACTION' 6 ? refined -5.4700 -24.3530 -11.3821 0.4252 0.3781 0.4145 0.0864 0.0145 0.0238 0.9325 0.9008 1.1066 0.9452 -0.8019 -1.0462 0.1352 -0.0434 -0.3187 -0.1387 -0.1058 0.1374 0.1362 0.2008 -0.0001 'X-RAY DIFFRACTION' 7 ? refined -5.3671 -28.7029 -3.7481 0.5495 0.3940 0.4979 -0.0024 0.0737 0.1061 1.1647 0.1975 0.4929 -0.4382 0.7190 -0.2647 0.0189 -1.7977 -1.0352 0.8861 -0.0459 0.4184 0.6588 -0.3745 -0.0148 'X-RAY DIFFRACTION' 8 ? refined -4.2052 -11.1338 -14.9567 0.2828 0.3941 0.3625 0.0041 0.0223 0.0380 1.9455 1.0439 2.0749 1.2472 0.0832 0.4110 -0.0875 0.2471 0.2544 0.0149 -0.0909 0.0482 -0.0962 0.3569 0.0001 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 190 through 202 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 203 through 214 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 215 through 239 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 240 through 272 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 273 through 299 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 300 through 317 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 318 through 328 ) ; 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 329 through 379 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 186 ? A MET 1 2 1 Y 1 A GLU 187 ? A GLU 2 3 1 Y 1 A ILE 188 ? A ILE 3 4 1 Y 1 A LEU 189 ? A LEU 4 5 1 Y 1 A GLU 380 ? A GLU 187 6 1 Y 1 A HIS 381 ? A HIS 188 7 1 Y 1 A HIS 382 ? A HIS 189 8 1 Y 1 A HIS 383 ? A HIS 190 9 1 Y 1 A HIS 384 ? A HIS 191 10 1 Y 1 A HIS 385 ? A HIS 192 11 1 Y 1 A HIS 386 ? A HIS 193 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 IOD I I N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PRO N N N N 284 PRO CA C N S 285 PRO C C N N 286 PRO O O N N 287 PRO CB C N N 288 PRO CG C N N 289 PRO CD C N N 290 PRO OXT O N N 291 PRO H H N N 292 PRO HA H N N 293 PRO HB2 H N N 294 PRO HB3 H N N 295 PRO HG2 H N N 296 PRO HG3 H N N 297 PRO HD2 H N N 298 PRO HD3 H N N 299 PRO HXT H N N 300 SER N N N N 301 SER CA C N S 302 SER C C N N 303 SER O O N N 304 SER CB C N N 305 SER OG O N N 306 SER OXT O N N 307 SER H H N N 308 SER H2 H N N 309 SER HA H N N 310 SER HB2 H N N 311 SER HB3 H N N 312 SER HG H N N 313 SER HXT H N N 314 THR N N N N 315 THR CA C N S 316 THR C C N N 317 THR O O N N 318 THR CB C N R 319 THR OG1 O N N 320 THR CG2 C N N 321 THR OXT O N N 322 THR H H N N 323 THR H2 H N N 324 THR HA H N N 325 THR HB H N N 326 THR HG1 H N N 327 THR HG21 H N N 328 THR HG22 H N N 329 THR HG23 H N N 330 THR HXT H N N 331 TRP N N N N 332 TRP CA C N S 333 TRP C C N N 334 TRP O O N N 335 TRP CB C N N 336 TRP CG C Y N 337 TRP CD1 C Y N 338 TRP CD2 C Y N 339 TRP NE1 N Y N 340 TRP CE2 C Y N 341 TRP CE3 C Y N 342 TRP CZ2 C Y N 343 TRP CZ3 C Y N 344 TRP CH2 C Y N 345 TRP OXT O N N 346 TRP H H N N 347 TRP H2 H N N 348 TRP HA H N N 349 TRP HB2 H N N 350 TRP HB3 H N N 351 TRP HD1 H N N 352 TRP HE1 H N N 353 TRP HE3 H N N 354 TRP HZ2 H N N 355 TRP HZ3 H N N 356 TRP HH2 H N N 357 TRP HXT H N N 358 TYR N N N N 359 TYR CA C N S 360 TYR C C N N 361 TYR O O N N 362 TYR CB C N N 363 TYR CG C Y N 364 TYR CD1 C Y N 365 TYR CD2 C Y N 366 TYR CE1 C Y N 367 TYR CE2 C Y N 368 TYR CZ C Y N 369 TYR OH O N N 370 TYR OXT O N N 371 TYR H H N N 372 TYR H2 H N N 373 TYR HA H N N 374 TYR HB2 H N N 375 TYR HB3 H N N 376 TYR HD1 H N N 377 TYR HD2 H N N 378 TYR HE1 H N N 379 TYR HE2 H N N 380 TYR HH H N N 381 TYR HXT H N N 382 VAL N N N N 383 VAL CA C N S 384 VAL C C N N 385 VAL O O N N 386 VAL CB C N N 387 VAL CG1 C N N 388 VAL CG2 C N N 389 VAL OXT O N N 390 VAL H H N N 391 VAL H2 H N N 392 VAL HA H N N 393 VAL HB H N N 394 VAL HG11 H N N 395 VAL HG12 H N N 396 VAL HG13 H N N 397 VAL HG21 H N N 398 VAL HG22 H N N 399 VAL HG23 H N N 400 VAL HXT H N N 401 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM118047 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5CQD _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6NFK _atom_sites.fract_transf_matrix[1][1] 0.019763 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019763 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006698 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H I N O S # loop_