data_6NFK
# 
_entry.id   6NFK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6NFK         pdb_00006nfk 10.2210/pdb6nfk/pdb 
WWPDB D_1000238712 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-12-25 
2 'Structure model' 1 1 2020-01-29 
3 'Structure model' 1 2 2023-10-11 
4 'Structure model' 1 3 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
4 3 'Structure model' 'Refinement description' 
5 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' chem_comp_atom                
4 3 'Structure model' chem_comp_bond                
5 3 'Structure model' database_2                    
6 3 'Structure model' pdbx_initial_refinement_model 
7 4 'Structure model' pdbx_entry_details            
8 4 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                   
2  2 'Structure model' '_citation.journal_abbrev'            
3  2 'Structure model' '_citation.journal_id_CSD'            
4  2 'Structure model' '_citation.journal_id_ISSN'           
5  2 'Structure model' '_citation.journal_volume'            
6  2 'Structure model' '_citation.page_first'                
7  2 'Structure model' '_citation.page_last'                 
8  2 'Structure model' '_citation.pdbx_database_id_DOI'      
9  2 'Structure model' '_citation.title'                     
10 2 'Structure model' '_citation.year'                      
11 3 'Structure model' '_database_2.pdbx_DOI'                
12 3 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6NFK 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shi, K.'      1 0000-0003-4175-3714 
'Orellana, K.' 2 ?                   
'Aihara, H.'   3 0000-0001-7508-6230 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Faseb Bioadv' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2573-9832 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            2 
_citation.language                  ? 
_citation.page_first                49 
_citation.page_last                 58 
_citation.title                     
'Active site plasticity and possible modes of chemical inhibition of the human DNA deaminase APOBEC3B' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1096/fba.2019-00068 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shi, K.'         1 0000-0003-4175-3714 
primary 'Demir, O.'       2 ?                   
primary 'Carpenter, M.A.' 3 ?                   
primary 'Banerjee, S.'    4 ?                   
primary 'Harki, D.A.'     5 ?                   
primary 'Amaro, R.E.'     6 ?                   
primary 'Harris, R.S.'    7 ?                   
primary 'Aihara, H.'      8 0000-0001-7508-6230 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA dC->dU-editing enzyme APOBEC-3B' 22843.818 1  3.5.4.38 
'F200S, W228S, L230K, A242S, Y250S, E255Q, F308K, Y315D, D316Q, P317G, L318R, Y319C, K320Q' ? ? 
2 non-polymer syn 1,2-ETHANEDIOL                        62.068    3  ?        ? ? ? 
3 non-polymer syn 'IODIDE ION'                          126.904   1  ?        ? ? ? 
4 water       nat water                                 18.015    74 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'A3B,Phorbolin-1-related protein,Phorbolin-2/3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEILRYLMDPDTFTSNFNNDPLVLRRRQTYLCYEVERLDNGTSVKMDQHMGFLCNESGRHAQLRFLDLVPSLQLDPAQIY
RVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIKAARIYDDQGRCQEALQMLRDAGAQVSIMTYDEFEYCWDTFVYRQG
CPFQPWDGLEEHSQALSGRLRAILQLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEILRYLMDPDTFTSNFNNDPLVLRRRQTYLCYEVERLDNGTSVKMDQHMGFLCNESGRHAQLRFLDLVPSLQLDPAQIY
RVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIKAARIYDDQGRCQEALQMLRDAGAQVSIMTYDEFEYCWDTFVYRQG
CPFQPWDGLEEHSQALSGRLRAILQLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL EDO 
3 'IODIDE ION'   IOD 
4 water          HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ILE n 
1 4   LEU n 
1 5   ARG n 
1 6   TYR n 
1 7   LEU n 
1 8   MET n 
1 9   ASP n 
1 10  PRO n 
1 11  ASP n 
1 12  THR n 
1 13  PHE n 
1 14  THR n 
1 15  SER n 
1 16  ASN n 
1 17  PHE n 
1 18  ASN n 
1 19  ASN n 
1 20  ASP n 
1 21  PRO n 
1 22  LEU n 
1 23  VAL n 
1 24  LEU n 
1 25  ARG n 
1 26  ARG n 
1 27  ARG n 
1 28  GLN n 
1 29  THR n 
1 30  TYR n 
1 31  LEU n 
1 32  CYS n 
1 33  TYR n 
1 34  GLU n 
1 35  VAL n 
1 36  GLU n 
1 37  ARG n 
1 38  LEU n 
1 39  ASP n 
1 40  ASN n 
1 41  GLY n 
1 42  THR n 
1 43  SER n 
1 44  VAL n 
1 45  LYS n 
1 46  MET n 
1 47  ASP n 
1 48  GLN n 
1 49  HIS n 
1 50  MET n 
1 51  GLY n 
1 52  PHE n 
1 53  LEU n 
1 54  CYS n 
1 55  ASN n 
1 56  GLU n 
1 57  SER n 
1 58  GLY n 
1 59  ARG n 
1 60  HIS n 
1 61  ALA n 
1 62  GLN n 
1 63  LEU n 
1 64  ARG n 
1 65  PHE n 
1 66  LEU n 
1 67  ASP n 
1 68  LEU n 
1 69  VAL n 
1 70  PRO n 
1 71  SER n 
1 72  LEU n 
1 73  GLN n 
1 74  LEU n 
1 75  ASP n 
1 76  PRO n 
1 77  ALA n 
1 78  GLN n 
1 79  ILE n 
1 80  TYR n 
1 81  ARG n 
1 82  VAL n 
1 83  THR n 
1 84  TRP n 
1 85  PHE n 
1 86  ILE n 
1 87  SER n 
1 88  TRP n 
1 89  SER n 
1 90  PRO n 
1 91  CYS n 
1 92  PHE n 
1 93  SER n 
1 94  TRP n 
1 95  GLY n 
1 96  CYS n 
1 97  ALA n 
1 98  GLY n 
1 99  GLU n 
1 100 VAL n 
1 101 ARG n 
1 102 ALA n 
1 103 PHE n 
1 104 LEU n 
1 105 GLN n 
1 106 GLU n 
1 107 ASN n 
1 108 THR n 
1 109 HIS n 
1 110 VAL n 
1 111 ARG n 
1 112 LEU n 
1 113 ARG n 
1 114 ILE n 
1 115 LYS n 
1 116 ALA n 
1 117 ALA n 
1 118 ARG n 
1 119 ILE n 
1 120 TYR n 
1 121 ASP n 
1 122 ASP n 
1 123 GLN n 
1 124 GLY n 
1 125 ARG n 
1 126 CYS n 
1 127 GLN n 
1 128 GLU n 
1 129 ALA n 
1 130 LEU n 
1 131 GLN n 
1 132 MET n 
1 133 LEU n 
1 134 ARG n 
1 135 ASP n 
1 136 ALA n 
1 137 GLY n 
1 138 ALA n 
1 139 GLN n 
1 140 VAL n 
1 141 SER n 
1 142 ILE n 
1 143 MET n 
1 144 THR n 
1 145 TYR n 
1 146 ASP n 
1 147 GLU n 
1 148 PHE n 
1 149 GLU n 
1 150 TYR n 
1 151 CYS n 
1 152 TRP n 
1 153 ASP n 
1 154 THR n 
1 155 PHE n 
1 156 VAL n 
1 157 TYR n 
1 158 ARG n 
1 159 GLN n 
1 160 GLY n 
1 161 CYS n 
1 162 PRO n 
1 163 PHE n 
1 164 GLN n 
1 165 PRO n 
1 166 TRP n 
1 167 ASP n 
1 168 GLY n 
1 169 LEU n 
1 170 GLU n 
1 171 GLU n 
1 172 HIS n 
1 173 SER n 
1 174 GLN n 
1 175 ALA n 
1 176 LEU n 
1 177 SER n 
1 178 GLY n 
1 179 ARG n 
1 180 LEU n 
1 181 ARG n 
1 182 ALA n 
1 183 ILE n 
1 184 LEU n 
1 185 GLN n 
1 186 LEU n 
1 187 GLU n 
1 188 HIS n 
1 189 HIS n 
1 190 HIS n 
1 191 HIS n 
1 192 HIS n 
1 193 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   193 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 APOBEC3B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'    ?                 'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   186 ?   ?   ?   A . n 
A 1 2   GLU 2   187 ?   ?   ?   A . n 
A 1 3   ILE 3   188 ?   ?   ?   A . n 
A 1 4   LEU 4   189 ?   ?   ?   A . n 
A 1 5   ARG 5   190 190 ARG ARG A . n 
A 1 6   TYR 6   191 191 TYR TYR A . n 
A 1 7   LEU 7   192 192 LEU LEU A . n 
A 1 8   MET 8   193 193 MET MET A . n 
A 1 9   ASP 9   194 194 ASP ASP A . n 
A 1 10  PRO 10  195 195 PRO PRO A . n 
A 1 11  ASP 11  196 196 ASP ASP A . n 
A 1 12  THR 12  197 197 THR THR A . n 
A 1 13  PHE 13  198 198 PHE PHE A . n 
A 1 14  THR 14  199 199 THR THR A . n 
A 1 15  SER 15  200 200 SER SER A . n 
A 1 16  ASN 16  201 201 ASN ASN A . n 
A 1 17  PHE 17  202 202 PHE PHE A . n 
A 1 18  ASN 18  203 203 ASN ASN A . n 
A 1 19  ASN 19  204 204 ASN ASN A . n 
A 1 20  ASP 20  205 205 ASP ASP A . n 
A 1 21  PRO 21  206 206 PRO PRO A . n 
A 1 22  LEU 22  207 207 LEU LEU A . n 
A 1 23  VAL 23  208 208 VAL VAL A . n 
A 1 24  LEU 24  209 209 LEU LEU A . n 
A 1 25  ARG 25  210 210 ARG ARG A . n 
A 1 26  ARG 26  211 211 ARG ARG A . n 
A 1 27  ARG 27  212 212 ARG ARG A . n 
A 1 28  GLN 28  213 213 GLN GLN A . n 
A 1 29  THR 29  214 214 THR THR A . n 
A 1 30  TYR 30  215 215 TYR TYR A . n 
A 1 31  LEU 31  216 216 LEU LEU A . n 
A 1 32  CYS 32  217 217 CYS CYS A . n 
A 1 33  TYR 33  218 218 TYR TYR A . n 
A 1 34  GLU 34  219 219 GLU GLU A . n 
A 1 35  VAL 35  220 220 VAL VAL A . n 
A 1 36  GLU 36  221 221 GLU GLU A . n 
A 1 37  ARG 37  222 222 ARG ARG A . n 
A 1 38  LEU 38  223 223 LEU LEU A . n 
A 1 39  ASP 39  224 224 ASP ASP A . n 
A 1 40  ASN 40  225 225 ASN ASN A . n 
A 1 41  GLY 41  226 226 GLY GLY A . n 
A 1 42  THR 42  227 227 THR THR A . n 
A 1 43  SER 43  228 228 SER SER A . n 
A 1 44  VAL 44  229 229 VAL VAL A . n 
A 1 45  LYS 45  230 230 LYS LYS A . n 
A 1 46  MET 46  231 231 MET MET A . n 
A 1 47  ASP 47  232 232 ASP ASP A . n 
A 1 48  GLN 48  233 233 GLN GLN A . n 
A 1 49  HIS 49  234 234 HIS HIS A . n 
A 1 50  MET 50  235 235 MET MET A . n 
A 1 51  GLY 51  236 236 GLY GLY A . n 
A 1 52  PHE 52  237 237 PHE PHE A . n 
A 1 53  LEU 53  238 238 LEU LEU A . n 
A 1 54  CYS 54  239 239 CYS CYS A . n 
A 1 55  ASN 55  240 240 ASN ASN A . n 
A 1 56  GLU 56  241 241 GLU GLU A . n 
A 1 57  SER 57  250 250 SER SER A . n 
A 1 58  GLY 58  251 251 GLY GLY A . n 
A 1 59  ARG 59  252 252 ARG ARG A . n 
A 1 60  HIS 60  253 253 HIS HIS A . n 
A 1 61  ALA 61  254 254 ALA ALA A . n 
A 1 62  GLN 62  255 255 GLN GLN A . n 
A 1 63  LEU 63  256 256 LEU LEU A . n 
A 1 64  ARG 64  257 257 ARG ARG A . n 
A 1 65  PHE 65  258 258 PHE PHE A . n 
A 1 66  LEU 66  259 259 LEU LEU A . n 
A 1 67  ASP 67  260 260 ASP ASP A . n 
A 1 68  LEU 68  261 261 LEU LEU A . n 
A 1 69  VAL 69  262 262 VAL VAL A . n 
A 1 70  PRO 70  263 263 PRO PRO A . n 
A 1 71  SER 71  264 264 SER SER A . n 
A 1 72  LEU 72  265 265 LEU LEU A . n 
A 1 73  GLN 73  266 266 GLN GLN A . n 
A 1 74  LEU 74  267 267 LEU LEU A . n 
A 1 75  ASP 75  268 268 ASP ASP A . n 
A 1 76  PRO 76  269 269 PRO PRO A . n 
A 1 77  ALA 77  270 270 ALA ALA A . n 
A 1 78  GLN 78  271 271 GLN GLN A . n 
A 1 79  ILE 79  272 272 ILE ILE A . n 
A 1 80  TYR 80  273 273 TYR TYR A . n 
A 1 81  ARG 81  274 274 ARG ARG A . n 
A 1 82  VAL 82  275 275 VAL VAL A . n 
A 1 83  THR 83  276 276 THR THR A . n 
A 1 84  TRP 84  277 277 TRP TRP A . n 
A 1 85  PHE 85  278 278 PHE PHE A . n 
A 1 86  ILE 86  279 279 ILE ILE A . n 
A 1 87  SER 87  280 280 SER SER A . n 
A 1 88  TRP 88  281 281 TRP TRP A . n 
A 1 89  SER 89  282 282 SER SER A . n 
A 1 90  PRO 90  283 283 PRO PRO A . n 
A 1 91  CYS 91  284 284 CYS CYS A . n 
A 1 92  PHE 92  285 285 PHE PHE A . n 
A 1 93  SER 93  286 286 SER SER A . n 
A 1 94  TRP 94  287 287 TRP TRP A . n 
A 1 95  GLY 95  288 288 GLY GLY A . n 
A 1 96  CYS 96  289 289 CYS CYS A . n 
A 1 97  ALA 97  290 290 ALA ALA A . n 
A 1 98  GLY 98  291 291 GLY GLY A . n 
A 1 99  GLU 99  292 292 GLU GLU A . n 
A 1 100 VAL 100 293 293 VAL VAL A . n 
A 1 101 ARG 101 294 294 ARG ARG A . n 
A 1 102 ALA 102 295 295 ALA ALA A . n 
A 1 103 PHE 103 296 296 PHE PHE A . n 
A 1 104 LEU 104 297 297 LEU LEU A . n 
A 1 105 GLN 105 298 298 GLN GLN A . n 
A 1 106 GLU 106 299 299 GLU GLU A . n 
A 1 107 ASN 107 300 300 ASN ASN A . n 
A 1 108 THR 108 301 301 THR THR A . n 
A 1 109 HIS 109 302 302 HIS HIS A . n 
A 1 110 VAL 110 303 303 VAL VAL A . n 
A 1 111 ARG 111 304 304 ARG ARG A . n 
A 1 112 LEU 112 305 305 LEU LEU A . n 
A 1 113 ARG 113 306 306 ARG ARG A . n 
A 1 114 ILE 114 307 307 ILE ILE A . n 
A 1 115 LYS 115 308 308 LYS LYS A . n 
A 1 116 ALA 116 309 309 ALA ALA A . n 
A 1 117 ALA 117 310 310 ALA ALA A . n 
A 1 118 ARG 118 311 311 ARG ARG A . n 
A 1 119 ILE 119 312 312 ILE ILE A . n 
A 1 120 TYR 120 313 313 TYR TYR A . n 
A 1 121 ASP 121 314 314 ASP ASP A . n 
A 1 122 ASP 122 315 315 ASP ASP A . n 
A 1 123 GLN 123 316 316 GLN GLN A . n 
A 1 124 GLY 124 317 317 GLY GLY A . n 
A 1 125 ARG 125 318 318 ARG ARG A . n 
A 1 126 CYS 126 319 319 CYS CYS A . n 
A 1 127 GLN 127 320 320 GLN GLN A . n 
A 1 128 GLU 128 321 321 GLU GLU A . n 
A 1 129 ALA 129 322 322 ALA ALA A . n 
A 1 130 LEU 130 323 323 LEU LEU A . n 
A 1 131 GLN 131 324 324 GLN GLN A . n 
A 1 132 MET 132 325 325 MET MET A . n 
A 1 133 LEU 133 326 326 LEU LEU A . n 
A 1 134 ARG 134 327 327 ARG ARG A . n 
A 1 135 ASP 135 328 328 ASP ASP A . n 
A 1 136 ALA 136 329 329 ALA ALA A . n 
A 1 137 GLY 137 330 330 GLY GLY A . n 
A 1 138 ALA 138 331 331 ALA ALA A . n 
A 1 139 GLN 139 332 332 GLN GLN A . n 
A 1 140 VAL 140 333 333 VAL VAL A . n 
A 1 141 SER 141 334 334 SER SER A . n 
A 1 142 ILE 142 335 335 ILE ILE A . n 
A 1 143 MET 143 336 336 MET MET A . n 
A 1 144 THR 144 337 337 THR THR A . n 
A 1 145 TYR 145 338 338 TYR TYR A . n 
A 1 146 ASP 146 339 339 ASP ASP A . n 
A 1 147 GLU 147 340 340 GLU GLU A . n 
A 1 148 PHE 148 341 341 PHE PHE A . n 
A 1 149 GLU 149 342 342 GLU GLU A . n 
A 1 150 TYR 150 343 343 TYR TYR A . n 
A 1 151 CYS 151 344 344 CYS CYS A . n 
A 1 152 TRP 152 345 345 TRP TRP A . n 
A 1 153 ASP 153 346 346 ASP ASP A . n 
A 1 154 THR 154 347 347 THR THR A . n 
A 1 155 PHE 155 348 348 PHE PHE A . n 
A 1 156 VAL 156 349 349 VAL VAL A . n 
A 1 157 TYR 157 350 350 TYR TYR A . n 
A 1 158 ARG 158 351 351 ARG ARG A . n 
A 1 159 GLN 159 352 352 GLN GLN A . n 
A 1 160 GLY 160 353 353 GLY GLY A . n 
A 1 161 CYS 161 354 354 CYS CYS A . n 
A 1 162 PRO 162 355 355 PRO PRO A . n 
A 1 163 PHE 163 356 356 PHE PHE A . n 
A 1 164 GLN 164 357 357 GLN GLN A . n 
A 1 165 PRO 165 358 358 PRO PRO A . n 
A 1 166 TRP 166 359 359 TRP TRP A . n 
A 1 167 ASP 167 360 360 ASP ASP A . n 
A 1 168 GLY 168 361 361 GLY GLY A . n 
A 1 169 LEU 169 362 362 LEU LEU A . n 
A 1 170 GLU 170 363 363 GLU GLU A . n 
A 1 171 GLU 171 364 364 GLU GLU A . n 
A 1 172 HIS 172 365 365 HIS HIS A . n 
A 1 173 SER 173 366 366 SER SER A . n 
A 1 174 GLN 174 367 367 GLN GLN A . n 
A 1 175 ALA 175 368 368 ALA ALA A . n 
A 1 176 LEU 176 369 369 LEU LEU A . n 
A 1 177 SER 177 370 370 SER SER A . n 
A 1 178 GLY 178 371 371 GLY GLY A . n 
A 1 179 ARG 179 372 372 ARG ARG A . n 
A 1 180 LEU 180 373 373 LEU LEU A . n 
A 1 181 ARG 181 374 374 ARG ARG A . n 
A 1 182 ALA 182 375 375 ALA ALA A . n 
A 1 183 ILE 183 376 376 ILE ILE A . n 
A 1 184 LEU 184 377 377 LEU LEU A . n 
A 1 185 GLN 185 378 378 GLN GLN A . n 
A 1 186 LEU 186 379 379 LEU LEU A . n 
A 1 187 GLU 187 380 ?   ?   ?   A . n 
A 1 188 HIS 188 381 ?   ?   ?   A . n 
A 1 189 HIS 189 382 ?   ?   ?   A . n 
A 1 190 HIS 190 383 ?   ?   ?   A . n 
A 1 191 HIS 191 384 ?   ?   ?   A . n 
A 1 192 HIS 192 385 ?   ?   ?   A . n 
A 1 193 HIS 193 386 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EDO 1  401 401 EDO EDO A . 
C 2 EDO 1  402 402 EDO EDO A . 
D 2 EDO 1  403 403 EDO EDO A . 
E 3 IOD 1  404 404 IOD IOD A . 
F 4 HOH 1  501 502 HOH HOH A . 
F 4 HOH 2  502 501 HOH HOH A . 
F 4 HOH 3  503 503 HOH HOH A . 
F 4 HOH 4  504 505 HOH HOH A . 
F 4 HOH 5  505 506 HOH HOH A . 
F 4 HOH 6  506 508 HOH HOH A . 
F 4 HOH 7  507 513 HOH HOH A . 
F 4 HOH 8  508 509 HOH HOH A . 
F 4 HOH 9  509 507 HOH HOH A . 
F 4 HOH 10 510 504 HOH HOH A . 
F 4 HOH 11 511 512 HOH HOH A . 
F 4 HOH 12 512 514 HOH HOH A . 
F 4 HOH 13 513 524 HOH HOH A . 
F 4 HOH 14 514 525 HOH HOH A . 
F 4 HOH 15 515 519 HOH HOH A . 
F 4 HOH 16 516 522 HOH HOH A . 
F 4 HOH 17 517 510 HOH HOH A . 
F 4 HOH 18 518 520 HOH HOH A . 
F 4 HOH 19 519 511 HOH HOH A . 
F 4 HOH 20 520 521 HOH HOH A . 
F 4 HOH 21 521 517 HOH HOH A . 
F 4 HOH 22 522 516 HOH HOH A . 
F 4 HOH 23 523 523 HOH HOH A . 
F 4 HOH 24 524 534 HOH HOH A . 
F 4 HOH 25 525 538 HOH HOH A . 
F 4 HOH 26 526 529 HOH HOH A . 
F 4 HOH 27 527 515 HOH HOH A . 
F 4 HOH 28 528 518 HOH HOH A . 
F 4 HOH 29 529 533 HOH HOH A . 
F 4 HOH 30 530 532 HOH HOH A . 
F 4 HOH 31 531 527 HOH HOH A . 
F 4 HOH 32 532 526 HOH HOH A . 
F 4 HOH 33 533 530 HOH HOH A . 
F 4 HOH 34 534 536 HOH HOH A . 
F 4 HOH 35 535 528 HOH HOH A . 
F 4 HOH 36 536 535 HOH HOH A . 
F 4 HOH 37 537 531 HOH HOH A . 
F 4 HOH 38 538 543 HOH HOH A . 
F 4 HOH 39 539 539 HOH HOH A . 
F 4 HOH 40 540 540 HOH HOH A . 
F 4 HOH 41 541 545 HOH HOH A . 
F 4 HOH 42 542 537 HOH HOH A . 
F 4 HOH 43 543 542 HOH HOH A . 
F 4 HOH 44 544 548 HOH HOH A . 
F 4 HOH 45 545 544 HOH HOH A . 
F 4 HOH 46 546 547 HOH HOH A . 
F 4 HOH 47 547 558 HOH HOH A . 
F 4 HOH 48 548 550 HOH HOH A . 
F 4 HOH 49 549 546 HOH HOH A . 
F 4 HOH 50 550 541 HOH HOH A . 
F 4 HOH 51 551 556 HOH HOH A . 
F 4 HOH 52 552 555 HOH HOH A . 
F 4 HOH 53 553 557 HOH HOH A . 
F 4 HOH 54 554 551 HOH HOH A . 
F 4 HOH 55 555 552 HOH HOH A . 
F 4 HOH 56 556 553 HOH HOH A . 
F 4 HOH 57 557 554 HOH HOH A . 
F 4 HOH 58 558 549 HOH HOH A . 
F 4 HOH 59 559 559 HOH HOH A . 
F 4 HOH 60 560 562 HOH HOH A . 
F 4 HOH 61 561 560 HOH HOH A . 
F 4 HOH 62 562 565 HOH HOH A . 
F 4 HOH 63 563 564 HOH HOH A . 
F 4 HOH 64 564 561 HOH HOH A . 
F 4 HOH 65 565 563 HOH HOH A . 
F 4 HOH 66 566 566 HOH HOH A . 
F 4 HOH 67 567 568 HOH HOH A . 
F 4 HOH 68 568 569 HOH HOH A . 
F 4 HOH 69 569 567 HOH HOH A . 
F 4 HOH 70 570 571 HOH HOH A . 
F 4 HOH 71 571 570 HOH HOH A . 
F 4 HOH 72 572 572 HOH HOH A . 
F 4 HOH 73 573 573 HOH HOH A . 
F 4 HOH 74 574 574 HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_3366: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                 4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6NFK 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     50.600 
_cell.length_a_esd                 ? 
_cell.length_b                     50.600 
_cell.length_b_esd                 ? 
_cell.length_c                     149.300 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6NFK 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6NFK 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.09 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.20 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Sodium Iodide, PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-04-13 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6NFK 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.86 
_reflns.d_resolution_low                 35.8 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17023 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.37 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.5 
_reflns.pdbx_Rmerge_I_obs                0.057 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.057 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.062 
_reflns.pdbx_Rpim_I_all                  0.024 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.86 
_reflns_shell.d_res_low                   1.92 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1631 
_reflns_shell.percent_possible_all        98.43 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.30 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.4 
_reflns_shell.pdbx_Rsym_value             1.30 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             1.41 
_reflns_shell.pdbx_Rpim_I_all             0.54 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.54 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6NFK 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.860 
_refine.ls_d_res_low                             35.780 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     17020 
_refine.ls_number_reflns_R_free                  873 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.39 
_refine.ls_percent_reflns_R_free                 5.13 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1914 
_refine.ls_R_factor_R_free                       0.2379 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1888 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5CQD 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.02 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.25 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1502 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         13 
_refine_hist.number_atoms_solvent             74 
_refine_hist.number_atoms_total               1589 
_refine_hist.d_res_high                       1.860 
_refine_hist.d_res_low                        35.780 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.015  ? 1569 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.220  ? 2124 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 20.907 ? 930  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.076  ? 217  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008  ? 280  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8600 1.9766  . . 142 2595 99.00  . . . 0.3523 . 0.2645 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9766 2.1291  . . 133 2659 100.00 . . . 0.2735 . 0.1991 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1291 2.3434  . . 141 2632 99.00  . . . 0.2435 . 0.1805 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3434 2.6824  . . 153 2674 100.00 . . . 0.2110 . 0.1753 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6824 3.3791  . . 136 2732 100.00 . . . 0.2242 . 0.1992 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3791 35.7862 . . 168 2855 99.00  . . . 0.2389 . 0.1826 . . . . . . . . . . 
# 
_struct.entry_id                     6NFK 
_struct.title                        
'Crystal Structure of the Cancer Genomic DNA Mutator APOBEC3B with loop 7 from APOBEC3G bound to iodide' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6NFK 
_struct_keywords.text            'APOBEC, deaminase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ABC3B_HUMAN 
_struct_ref.pdbx_db_accession          Q9UH17 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSLQ
LDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWD
TFVYRQGCPFQPWDGLEEHSQALSGRLRAILQ
;
_struct_ref.pdbx_align_begin           187 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6NFK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 185 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UH17 
_struct_ref_seq.db_align_beg                  187 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  378 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       187 
_struct_ref_seq.pdbx_auth_seq_align_end       378 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6NFK MET A 1   ? UNP Q9UH17 ?   ?   'initiating methionine' 186 1  
1 6NFK SER A 15  ? UNP Q9UH17 PHE 200 'engineered mutation'   200 2  
1 6NFK SER A 43  ? UNP Q9UH17 TRP 228 'engineered mutation'   228 3  
1 6NFK LYS A 45  ? UNP Q9UH17 LEU 230 'engineered mutation'   230 4  
1 6NFK SER A 57  ? UNP Q9UH17 ALA 242 'engineered mutation'   250 5  
1 6NFK ?   A ?   ? UNP Q9UH17 LYS 243 deletion                ?   6  
1 6NFK ?   A ?   ? UNP Q9UH17 ASN 244 deletion                ?   7  
1 6NFK ?   A ?   ? UNP Q9UH17 LEU 245 deletion                ?   8  
1 6NFK ?   A ?   ? UNP Q9UH17 LEU 246 deletion                ?   9  
1 6NFK ?   A ?   ? UNP Q9UH17 CYS 247 deletion                ?   10 
1 6NFK ?   A ?   ? UNP Q9UH17 GLY 248 deletion                ?   11 
1 6NFK ?   A ?   ? UNP Q9UH17 PHE 249 deletion                ?   12 
1 6NFK ?   A ?   ? UNP Q9UH17 TYR 250 deletion                ?   13 
1 6NFK GLN A 62  ? UNP Q9UH17 GLU 255 'engineered mutation'   255 14 
1 6NFK LYS A 115 ? UNP Q9UH17 PHE 308 'engineered mutation'   308 15 
1 6NFK ASP A 122 ? UNP Q9UH17 TYR 315 'engineered mutation'   315 16 
1 6NFK GLN A 123 ? UNP Q9UH17 ASP 316 'engineered mutation'   316 17 
1 6NFK GLY A 124 ? UNP Q9UH17 PRO 317 'engineered mutation'   317 18 
1 6NFK ARG A 125 ? UNP Q9UH17 LEU 318 'engineered mutation'   318 19 
1 6NFK CYS A 126 ? UNP Q9UH17 TYR 319 'engineered mutation'   319 20 
1 6NFK GLN A 127 ? UNP Q9UH17 LYS 320 'engineered mutation'   320 21 
1 6NFK LEU A 186 ? UNP Q9UH17 ?   ?   'expression tag'        379 22 
1 6NFK GLU A 187 ? UNP Q9UH17 ?   ?   'expression tag'        380 23 
1 6NFK HIS A 188 ? UNP Q9UH17 ?   ?   'expression tag'        381 24 
1 6NFK HIS A 189 ? UNP Q9UH17 ?   ?   'expression tag'        382 25 
1 6NFK HIS A 190 ? UNP Q9UH17 ?   ?   'expression tag'        383 26 
1 6NFK HIS A 191 ? UNP Q9UH17 ?   ?   'expression tag'        384 27 
1 6NFK HIS A 192 ? UNP Q9UH17 ?   ?   'expression tag'        385 28 
1 6NFK HIS A 193 ? UNP Q9UH17 ?   ?   'expression tag'        386 29 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASP A 9   ? ASN A 18  ? ASP A 194 ASN A 203 1 ? 10 
HELX_P HELX_P2 AA2 HIS A 60  ? VAL A 69  ? HIS A 253 VAL A 262 1 ? 10 
HELX_P HELX_P3 AA3 PRO A 70  ? GLN A 73  ? PRO A 263 GLN A 266 5 ? 4  
HELX_P HELX_P4 AA4 GLY A 95  ? ASN A 107 ? GLY A 288 ASN A 300 1 ? 13 
HELX_P HELX_P5 AA5 GLY A 124 ? ALA A 136 ? GLY A 317 ALA A 329 1 ? 13 
HELX_P HELX_P6 AA6 THR A 144 ? VAL A 156 ? THR A 337 VAL A 349 1 ? 13 
HELX_P HELX_P7 AA7 GLY A 168 ? GLN A 185 ? GLY A 361 GLN A 378 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            91 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            96 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             284 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             289 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.440 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      CYS 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       91 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     CYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      96 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       CYS 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        284 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      CYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       289 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               SG 
_pdbx_modification_feature.modified_residue_id_linking_atom   SG 
_pdbx_modification_feature.modified_residue_id                . 
_pdbx_modification_feature.ref_pcm_id                         . 
_pdbx_modification_feature.ref_comp_id                        . 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Disulfide bridge' 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           89 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            282 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    90 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     283 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.85 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 42  ? CYS A 54  ? THR A 227 CYS A 239 
AA1 2 TYR A 30  ? ASP A 39  ? TYR A 215 ASP A 224 
AA1 3 TYR A 80  ? ILE A 86  ? TYR A 273 ILE A 279 
AA1 4 VAL A 110 ? ALA A 116 ? VAL A 303 ALA A 309 
AA1 5 GLN A 139 ? ILE A 142 ? GLN A 332 ILE A 335 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 51  ? O GLY A 236 N TYR A 33  ? N TYR A 218 
AA1 2 3 N CYS A 32  ? N CYS A 217 O PHE A 85  ? O PHE A 278 
AA1 3 4 N TRP A 84  ? N TRP A 277 O LYS A 115 ? O LYS A 308 
AA1 4 5 N ALA A 116 ? N ALA A 309 O SER A 141 ? O SER A 334 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 401 ? 1 'binding site for residue EDO A 401' 
AC2 Software A EDO 402 ? 6 'binding site for residue EDO A 402' 
AC3 Software A EDO 403 ? 4 'binding site for residue EDO A 403' 
AC4 Software A IOD 404 ? 2 'binding site for residue IOD A 404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 LEU A 186 ? LEU A 379 . ? 1_555 ? 
2  AC2 6 ARG A 27  ? ARG A 212 . ? 6_544 ? 
3  AC2 6 GLN A 28  ? GLN A 213 . ? 6_544 ? 
4  AC2 6 ASP A 146 ? ASP A 339 . ? 1_555 ? 
5  AC2 6 GLU A 149 ? GLU A 342 . ? 1_555 ? 
6  AC2 6 TYR A 150 ? TYR A 343 . ? 1_555 ? 
7  AC2 6 HOH F .   ? HOH A 505 . ? 6_544 ? 
8  AC3 4 TYR A 6   ? TYR A 191 . ? 1_555 ? 
9  AC3 4 GLY A 51  ? GLY A 236 . ? 1_555 ? 
10 AC3 4 PHE A 52  ? PHE A 237 . ? 1_555 ? 
11 AC3 4 GLN A 174 ? GLN A 367 . ? 6_444 ? 
12 AC4 2 GLN A 62  ? GLN A 255 . ? 1_555 ? 
13 AC4 2 SER A 89  ? SER A 282 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   6NFK 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASN 
_pdbx_validate_close_contact.auth_seq_id_1    203 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    501 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O  A HOH 538 ? ? 1_555 O  A HOH 561 ? ? 6_544 2.09 
2 1 OG A SER 250 ? ? 1_555 OH A TYR 338 ? B 6_444 2.19 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     250 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             62.04 
_pdbx_validate_torsion.psi             62.81 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -16.2486 -10.6300 -21.7658 0.3345 0.4938 0.4268 -0.0095 -0.0210 0.0101  0.0850  0.0655 0.0930  
0.1239  -0.1564 -0.0984 0.0092  0.3191  0.2354  -0.0908 0.1707  0.4208  -0.0575 -0.6170 0.0003  
'X-RAY DIFFRACTION' 2 ? refined -16.2666 -12.3485 -7.2828  0.4710 0.5276 0.4680 -0.0103 0.0509  0.0155  -0.0370 0.1878 -0.0205 
0.1005  0.0380  0.0166  0.1382  0.0948  -0.0094 0.3808  -0.0515 0.2985  0.4238  -0.4103 -0.0000 
'X-RAY DIFFRACTION' 3 ? refined -5.5499  -23.0781 -27.9435 0.5121 0.4407 0.2548 -0.0368 0.0908  -0.0309 0.6771  1.1864 0.6426  
0.8120  -0.2452 -0.0722 -0.1550 0.6414  -0.0466 -0.6286 0.1816  -0.0185 0.1057  -0.1277 0.1331  
'X-RAY DIFFRACTION' 4 ? refined -13.3639 -30.4420 -22.7453 0.4110 0.3767 0.4582 -0.0734 -0.0127 -0.0204 0.6073  1.1894 1.1732  
0.0030  0.4081  -1.0634 -0.1828 -0.2434 -0.8131 -0.0520 0.3104  0.5955  0.7524  -0.2769 0.0057  
'X-RAY DIFFRACTION' 5 ? refined -9.6243  -28.5859 -13.6982 0.5359 0.4362 0.5061 0.0241  0.0288  0.0951  0.7313  0.2642 0.2351  
-0.1833 -0.1753 -0.0376 -0.0502 -0.4237 -0.3480 0.1716  0.1554  0.2183  0.4864  -0.2750 -0.0000 
'X-RAY DIFFRACTION' 6 ? refined -5.4700  -24.3530 -11.3821 0.4252 0.3781 0.4145 0.0864  0.0145  0.0238  0.9325  0.9008 1.1066  
0.9452  -0.8019 -1.0462 0.1352  -0.0434 -0.3187 -0.1387 -0.1058 0.1374  0.1362  0.2008  -0.0001 
'X-RAY DIFFRACTION' 7 ? refined -5.3671  -28.7029 -3.7481  0.5495 0.3940 0.4979 -0.0024 0.0737  0.1061  1.1647  0.1975 0.4929  
-0.4382 0.7190  -0.2647 0.0189  -1.7977 -1.0352 0.8861  -0.0459 0.4184  0.6588  -0.3745 -0.0148 
'X-RAY DIFFRACTION' 8 ? refined -4.2052  -11.1338 -14.9567 0.2828 0.3941 0.3625 0.0041  0.0223  0.0380  1.9455  1.0439 2.0749  
1.2472  0.0832  0.4110  -0.0875 0.2471  0.2544  0.0149  -0.0909 0.0482  -0.0962 0.3569  0.0001  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 190 through 202 )
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 203 through 214 )
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 215 through 239 )
;
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 240 through 272 )
;
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 273 through 299 )
;
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 300 through 317 )
;
'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 318 through 328 )
;
'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 329 through 379 )
;
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 186 ? A MET 1   
2  1 Y 1 A GLU 187 ? A GLU 2   
3  1 Y 1 A ILE 188 ? A ILE 3   
4  1 Y 1 A LEU 189 ? A LEU 4   
5  1 Y 1 A GLU 380 ? A GLU 187 
6  1 Y 1 A HIS 381 ? A HIS 188 
7  1 Y 1 A HIS 382 ? A HIS 189 
8  1 Y 1 A HIS 383 ? A HIS 190 
9  1 Y 1 A HIS 384 ? A HIS 191 
10 1 Y 1 A HIS 385 ? A HIS 192 
11 1 Y 1 A HIS 386 ? A HIS 193 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
EDO C1   C N N 88  
EDO O1   O N N 89  
EDO C2   C N N 90  
EDO O2   O N N 91  
EDO H11  H N N 92  
EDO H12  H N N 93  
EDO HO1  H N N 94  
EDO H21  H N N 95  
EDO H22  H N N 96  
EDO HO2  H N N 97  
GLN N    N N N 98  
GLN CA   C N S 99  
GLN C    C N N 100 
GLN O    O N N 101 
GLN CB   C N N 102 
GLN CG   C N N 103 
GLN CD   C N N 104 
GLN OE1  O N N 105 
GLN NE2  N N N 106 
GLN OXT  O N N 107 
GLN H    H N N 108 
GLN H2   H N N 109 
GLN HA   H N N 110 
GLN HB2  H N N 111 
GLN HB3  H N N 112 
GLN HG2  H N N 113 
GLN HG3  H N N 114 
GLN HE21 H N N 115 
GLN HE22 H N N 116 
GLN HXT  H N N 117 
GLU N    N N N 118 
GLU CA   C N S 119 
GLU C    C N N 120 
GLU O    O N N 121 
GLU CB   C N N 122 
GLU CG   C N N 123 
GLU CD   C N N 124 
GLU OE1  O N N 125 
GLU OE2  O N N 126 
GLU OXT  O N N 127 
GLU H    H N N 128 
GLU H2   H N N 129 
GLU HA   H N N 130 
GLU HB2  H N N 131 
GLU HB3  H N N 132 
GLU HG2  H N N 133 
GLU HG3  H N N 134 
GLU HE2  H N N 135 
GLU HXT  H N N 136 
GLY N    N N N 137 
GLY CA   C N N 138 
GLY C    C N N 139 
GLY O    O N N 140 
GLY OXT  O N N 141 
GLY H    H N N 142 
GLY H2   H N N 143 
GLY HA2  H N N 144 
GLY HA3  H N N 145 
GLY HXT  H N N 146 
HIS N    N N N 147 
HIS CA   C N S 148 
HIS C    C N N 149 
HIS O    O N N 150 
HIS CB   C N N 151 
HIS CG   C Y N 152 
HIS ND1  N Y N 153 
HIS CD2  C Y N 154 
HIS CE1  C Y N 155 
HIS NE2  N Y N 156 
HIS OXT  O N N 157 
HIS H    H N N 158 
HIS H2   H N N 159 
HIS HA   H N N 160 
HIS HB2  H N N 161 
HIS HB3  H N N 162 
HIS HD1  H N N 163 
HIS HD2  H N N 164 
HIS HE1  H N N 165 
HIS HE2  H N N 166 
HIS HXT  H N N 167 
HOH O    O N N 168 
HOH H1   H N N 169 
HOH H2   H N N 170 
ILE N    N N N 171 
ILE CA   C N S 172 
ILE C    C N N 173 
ILE O    O N N 174 
ILE CB   C N S 175 
ILE CG1  C N N 176 
ILE CG2  C N N 177 
ILE CD1  C N N 178 
ILE OXT  O N N 179 
ILE H    H N N 180 
ILE H2   H N N 181 
ILE HA   H N N 182 
ILE HB   H N N 183 
ILE HG12 H N N 184 
ILE HG13 H N N 185 
ILE HG21 H N N 186 
ILE HG22 H N N 187 
ILE HG23 H N N 188 
ILE HD11 H N N 189 
ILE HD12 H N N 190 
ILE HD13 H N N 191 
ILE HXT  H N N 192 
IOD I    I N N 193 
LEU N    N N N 194 
LEU CA   C N S 195 
LEU C    C N N 196 
LEU O    O N N 197 
LEU CB   C N N 198 
LEU CG   C N N 199 
LEU CD1  C N N 200 
LEU CD2  C N N 201 
LEU OXT  O N N 202 
LEU H    H N N 203 
LEU H2   H N N 204 
LEU HA   H N N 205 
LEU HB2  H N N 206 
LEU HB3  H N N 207 
LEU HG   H N N 208 
LEU HD11 H N N 209 
LEU HD12 H N N 210 
LEU HD13 H N N 211 
LEU HD21 H N N 212 
LEU HD22 H N N 213 
LEU HD23 H N N 214 
LEU HXT  H N N 215 
LYS N    N N N 216 
LYS CA   C N S 217 
LYS C    C N N 218 
LYS O    O N N 219 
LYS CB   C N N 220 
LYS CG   C N N 221 
LYS CD   C N N 222 
LYS CE   C N N 223 
LYS NZ   N N N 224 
LYS OXT  O N N 225 
LYS H    H N N 226 
LYS H2   H N N 227 
LYS HA   H N N 228 
LYS HB2  H N N 229 
LYS HB3  H N N 230 
LYS HG2  H N N 231 
LYS HG3  H N N 232 
LYS HD2  H N N 233 
LYS HD3  H N N 234 
LYS HE2  H N N 235 
LYS HE3  H N N 236 
LYS HZ1  H N N 237 
LYS HZ2  H N N 238 
LYS HZ3  H N N 239 
LYS HXT  H N N 240 
MET N    N N N 241 
MET CA   C N S 242 
MET C    C N N 243 
MET O    O N N 244 
MET CB   C N N 245 
MET CG   C N N 246 
MET SD   S N N 247 
MET CE   C N N 248 
MET OXT  O N N 249 
MET H    H N N 250 
MET H2   H N N 251 
MET HA   H N N 252 
MET HB2  H N N 253 
MET HB3  H N N 254 
MET HG2  H N N 255 
MET HG3  H N N 256 
MET HE1  H N N 257 
MET HE2  H N N 258 
MET HE3  H N N 259 
MET HXT  H N N 260 
PHE N    N N N 261 
PHE CA   C N S 262 
PHE C    C N N 263 
PHE O    O N N 264 
PHE CB   C N N 265 
PHE CG   C Y N 266 
PHE CD1  C Y N 267 
PHE CD2  C Y N 268 
PHE CE1  C Y N 269 
PHE CE2  C Y N 270 
PHE CZ   C Y N 271 
PHE OXT  O N N 272 
PHE H    H N N 273 
PHE H2   H N N 274 
PHE HA   H N N 275 
PHE HB2  H N N 276 
PHE HB3  H N N 277 
PHE HD1  H N N 278 
PHE HD2  H N N 279 
PHE HE1  H N N 280 
PHE HE2  H N N 281 
PHE HZ   H N N 282 
PHE HXT  H N N 283 
PRO N    N N N 284 
PRO CA   C N S 285 
PRO C    C N N 286 
PRO O    O N N 287 
PRO CB   C N N 288 
PRO CG   C N N 289 
PRO CD   C N N 290 
PRO OXT  O N N 291 
PRO H    H N N 292 
PRO HA   H N N 293 
PRO HB2  H N N 294 
PRO HB3  H N N 295 
PRO HG2  H N N 296 
PRO HG3  H N N 297 
PRO HD2  H N N 298 
PRO HD3  H N N 299 
PRO HXT  H N N 300 
SER N    N N N 301 
SER CA   C N S 302 
SER C    C N N 303 
SER O    O N N 304 
SER CB   C N N 305 
SER OG   O N N 306 
SER OXT  O N N 307 
SER H    H N N 308 
SER H2   H N N 309 
SER HA   H N N 310 
SER HB2  H N N 311 
SER HB3  H N N 312 
SER HG   H N N 313 
SER HXT  H N N 314 
THR N    N N N 315 
THR CA   C N S 316 
THR C    C N N 317 
THR O    O N N 318 
THR CB   C N R 319 
THR OG1  O N N 320 
THR CG2  C N N 321 
THR OXT  O N N 322 
THR H    H N N 323 
THR H2   H N N 324 
THR HA   H N N 325 
THR HB   H N N 326 
THR HG1  H N N 327 
THR HG21 H N N 328 
THR HG22 H N N 329 
THR HG23 H N N 330 
THR HXT  H N N 331 
TRP N    N N N 332 
TRP CA   C N S 333 
TRP C    C N N 334 
TRP O    O N N 335 
TRP CB   C N N 336 
TRP CG   C Y N 337 
TRP CD1  C Y N 338 
TRP CD2  C Y N 339 
TRP NE1  N Y N 340 
TRP CE2  C Y N 341 
TRP CE3  C Y N 342 
TRP CZ2  C Y N 343 
TRP CZ3  C Y N 344 
TRP CH2  C Y N 345 
TRP OXT  O N N 346 
TRP H    H N N 347 
TRP H2   H N N 348 
TRP HA   H N N 349 
TRP HB2  H N N 350 
TRP HB3  H N N 351 
TRP HD1  H N N 352 
TRP HE1  H N N 353 
TRP HE3  H N N 354 
TRP HZ2  H N N 355 
TRP HZ3  H N N 356 
TRP HH2  H N N 357 
TRP HXT  H N N 358 
TYR N    N N N 359 
TYR CA   C N S 360 
TYR C    C N N 361 
TYR O    O N N 362 
TYR CB   C N N 363 
TYR CG   C Y N 364 
TYR CD1  C Y N 365 
TYR CD2  C Y N 366 
TYR CE1  C Y N 367 
TYR CE2  C Y N 368 
TYR CZ   C Y N 369 
TYR OH   O N N 370 
TYR OXT  O N N 371 
TYR H    H N N 372 
TYR H2   H N N 373 
TYR HA   H N N 374 
TYR HB2  H N N 375 
TYR HB3  H N N 376 
TYR HD1  H N N 377 
TYR HD2  H N N 378 
TYR HE1  H N N 379 
TYR HE2  H N N 380 
TYR HH   H N N 381 
TYR HXT  H N N 382 
VAL N    N N N 383 
VAL CA   C N S 384 
VAL C    C N N 385 
VAL O    O N N 386 
VAL CB   C N N 387 
VAL CG1  C N N 388 
VAL CG2  C N N 389 
VAL OXT  O N N 390 
VAL H    H N N 391 
VAL H2   H N N 392 
VAL HA   H N N 393 
VAL HB   H N N 394 
VAL HG11 H N N 395 
VAL HG12 H N N 396 
VAL HG13 H N N 397 
VAL HG21 H N N 398 
VAL HG22 H N N 399 
VAL HG23 H N N 400 
VAL HXT  H N N 401 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
EDO C1  O1   sing N N 83  
EDO C1  C2   sing N N 84  
EDO C1  H11  sing N N 85  
EDO C1  H12  sing N N 86  
EDO O1  HO1  sing N N 87  
EDO C2  O2   sing N N 88  
EDO C2  H21  sing N N 89  
EDO C2  H22  sing N N 90  
EDO O2  HO2  sing N N 91  
GLN N   CA   sing N N 92  
GLN N   H    sing N N 93  
GLN N   H2   sing N N 94  
GLN CA  C    sing N N 95  
GLN CA  CB   sing N N 96  
GLN CA  HA   sing N N 97  
GLN C   O    doub N N 98  
GLN C   OXT  sing N N 99  
GLN CB  CG   sing N N 100 
GLN CB  HB2  sing N N 101 
GLN CB  HB3  sing N N 102 
GLN CG  CD   sing N N 103 
GLN CG  HG2  sing N N 104 
GLN CG  HG3  sing N N 105 
GLN CD  OE1  doub N N 106 
GLN CD  NE2  sing N N 107 
GLN NE2 HE21 sing N N 108 
GLN NE2 HE22 sing N N 109 
GLN OXT HXT  sing N N 110 
GLU N   CA   sing N N 111 
GLU N   H    sing N N 112 
GLU N   H2   sing N N 113 
GLU CA  C    sing N N 114 
GLU CA  CB   sing N N 115 
GLU CA  HA   sing N N 116 
GLU C   O    doub N N 117 
GLU C   OXT  sing N N 118 
GLU CB  CG   sing N N 119 
GLU CB  HB2  sing N N 120 
GLU CB  HB3  sing N N 121 
GLU CG  CD   sing N N 122 
GLU CG  HG2  sing N N 123 
GLU CG  HG3  sing N N 124 
GLU CD  OE1  doub N N 125 
GLU CD  OE2  sing N N 126 
GLU OE2 HE2  sing N N 127 
GLU OXT HXT  sing N N 128 
GLY N   CA   sing N N 129 
GLY N   H    sing N N 130 
GLY N   H2   sing N N 131 
GLY CA  C    sing N N 132 
GLY CA  HA2  sing N N 133 
GLY CA  HA3  sing N N 134 
GLY C   O    doub N N 135 
GLY C   OXT  sing N N 136 
GLY OXT HXT  sing N N 137 
HIS N   CA   sing N N 138 
HIS N   H    sing N N 139 
HIS N   H2   sing N N 140 
HIS CA  C    sing N N 141 
HIS CA  CB   sing N N 142 
HIS CA  HA   sing N N 143 
HIS C   O    doub N N 144 
HIS C   OXT  sing N N 145 
HIS CB  CG   sing N N 146 
HIS CB  HB2  sing N N 147 
HIS CB  HB3  sing N N 148 
HIS CG  ND1  sing Y N 149 
HIS CG  CD2  doub Y N 150 
HIS ND1 CE1  doub Y N 151 
HIS ND1 HD1  sing N N 152 
HIS CD2 NE2  sing Y N 153 
HIS CD2 HD2  sing N N 154 
HIS CE1 NE2  sing Y N 155 
HIS CE1 HE1  sing N N 156 
HIS NE2 HE2  sing N N 157 
HIS OXT HXT  sing N N 158 
HOH O   H1   sing N N 159 
HOH O   H2   sing N N 160 
ILE N   CA   sing N N 161 
ILE N   H    sing N N 162 
ILE N   H2   sing N N 163 
ILE CA  C    sing N N 164 
ILE CA  CB   sing N N 165 
ILE CA  HA   sing N N 166 
ILE C   O    doub N N 167 
ILE C   OXT  sing N N 168 
ILE CB  CG1  sing N N 169 
ILE CB  CG2  sing N N 170 
ILE CB  HB   sing N N 171 
ILE CG1 CD1  sing N N 172 
ILE CG1 HG12 sing N N 173 
ILE CG1 HG13 sing N N 174 
ILE CG2 HG21 sing N N 175 
ILE CG2 HG22 sing N N 176 
ILE CG2 HG23 sing N N 177 
ILE CD1 HD11 sing N N 178 
ILE CD1 HD12 sing N N 179 
ILE CD1 HD13 sing N N 180 
ILE OXT HXT  sing N N 181 
LEU N   CA   sing N N 182 
LEU N   H    sing N N 183 
LEU N   H2   sing N N 184 
LEU CA  C    sing N N 185 
LEU CA  CB   sing N N 186 
LEU CA  HA   sing N N 187 
LEU C   O    doub N N 188 
LEU C   OXT  sing N N 189 
LEU CB  CG   sing N N 190 
LEU CB  HB2  sing N N 191 
LEU CB  HB3  sing N N 192 
LEU CG  CD1  sing N N 193 
LEU CG  CD2  sing N N 194 
LEU CG  HG   sing N N 195 
LEU CD1 HD11 sing N N 196 
LEU CD1 HD12 sing N N 197 
LEU CD1 HD13 sing N N 198 
LEU CD2 HD21 sing N N 199 
LEU CD2 HD22 sing N N 200 
LEU CD2 HD23 sing N N 201 
LEU OXT HXT  sing N N 202 
LYS N   CA   sing N N 203 
LYS N   H    sing N N 204 
LYS N   H2   sing N N 205 
LYS CA  C    sing N N 206 
LYS CA  CB   sing N N 207 
LYS CA  HA   sing N N 208 
LYS C   O    doub N N 209 
LYS C   OXT  sing N N 210 
LYS CB  CG   sing N N 211 
LYS CB  HB2  sing N N 212 
LYS CB  HB3  sing N N 213 
LYS CG  CD   sing N N 214 
LYS CG  HG2  sing N N 215 
LYS CG  HG3  sing N N 216 
LYS CD  CE   sing N N 217 
LYS CD  HD2  sing N N 218 
LYS CD  HD3  sing N N 219 
LYS CE  NZ   sing N N 220 
LYS CE  HE2  sing N N 221 
LYS CE  HE3  sing N N 222 
LYS NZ  HZ1  sing N N 223 
LYS NZ  HZ2  sing N N 224 
LYS NZ  HZ3  sing N N 225 
LYS OXT HXT  sing N N 226 
MET N   CA   sing N N 227 
MET N   H    sing N N 228 
MET N   H2   sing N N 229 
MET CA  C    sing N N 230 
MET CA  CB   sing N N 231 
MET CA  HA   sing N N 232 
MET C   O    doub N N 233 
MET C   OXT  sing N N 234 
MET CB  CG   sing N N 235 
MET CB  HB2  sing N N 236 
MET CB  HB3  sing N N 237 
MET CG  SD   sing N N 238 
MET CG  HG2  sing N N 239 
MET CG  HG3  sing N N 240 
MET SD  CE   sing N N 241 
MET CE  HE1  sing N N 242 
MET CE  HE2  sing N N 243 
MET CE  HE3  sing N N 244 
MET OXT HXT  sing N N 245 
PHE N   CA   sing N N 246 
PHE N   H    sing N N 247 
PHE N   H2   sing N N 248 
PHE CA  C    sing N N 249 
PHE CA  CB   sing N N 250 
PHE CA  HA   sing N N 251 
PHE C   O    doub N N 252 
PHE C   OXT  sing N N 253 
PHE CB  CG   sing N N 254 
PHE CB  HB2  sing N N 255 
PHE CB  HB3  sing N N 256 
PHE CG  CD1  doub Y N 257 
PHE CG  CD2  sing Y N 258 
PHE CD1 CE1  sing Y N 259 
PHE CD1 HD1  sing N N 260 
PHE CD2 CE2  doub Y N 261 
PHE CD2 HD2  sing N N 262 
PHE CE1 CZ   doub Y N 263 
PHE CE1 HE1  sing N N 264 
PHE CE2 CZ   sing Y N 265 
PHE CE2 HE2  sing N N 266 
PHE CZ  HZ   sing N N 267 
PHE OXT HXT  sing N N 268 
PRO N   CA   sing N N 269 
PRO N   CD   sing N N 270 
PRO N   H    sing N N 271 
PRO CA  C    sing N N 272 
PRO CA  CB   sing N N 273 
PRO CA  HA   sing N N 274 
PRO C   O    doub N N 275 
PRO C   OXT  sing N N 276 
PRO CB  CG   sing N N 277 
PRO CB  HB2  sing N N 278 
PRO CB  HB3  sing N N 279 
PRO CG  CD   sing N N 280 
PRO CG  HG2  sing N N 281 
PRO CG  HG3  sing N N 282 
PRO CD  HD2  sing N N 283 
PRO CD  HD3  sing N N 284 
PRO OXT HXT  sing N N 285 
SER N   CA   sing N N 286 
SER N   H    sing N N 287 
SER N   H2   sing N N 288 
SER CA  C    sing N N 289 
SER CA  CB   sing N N 290 
SER CA  HA   sing N N 291 
SER C   O    doub N N 292 
SER C   OXT  sing N N 293 
SER CB  OG   sing N N 294 
SER CB  HB2  sing N N 295 
SER CB  HB3  sing N N 296 
SER OG  HG   sing N N 297 
SER OXT HXT  sing N N 298 
THR N   CA   sing N N 299 
THR N   H    sing N N 300 
THR N   H2   sing N N 301 
THR CA  C    sing N N 302 
THR CA  CB   sing N N 303 
THR CA  HA   sing N N 304 
THR C   O    doub N N 305 
THR C   OXT  sing N N 306 
THR CB  OG1  sing N N 307 
THR CB  CG2  sing N N 308 
THR CB  HB   sing N N 309 
THR OG1 HG1  sing N N 310 
THR CG2 HG21 sing N N 311 
THR CG2 HG22 sing N N 312 
THR CG2 HG23 sing N N 313 
THR OXT HXT  sing N N 314 
TRP N   CA   sing N N 315 
TRP N   H    sing N N 316 
TRP N   H2   sing N N 317 
TRP CA  C    sing N N 318 
TRP CA  CB   sing N N 319 
TRP CA  HA   sing N N 320 
TRP C   O    doub N N 321 
TRP C   OXT  sing N N 322 
TRP CB  CG   sing N N 323 
TRP CB  HB2  sing N N 324 
TRP CB  HB3  sing N N 325 
TRP CG  CD1  doub Y N 326 
TRP CG  CD2  sing Y N 327 
TRP CD1 NE1  sing Y N 328 
TRP CD1 HD1  sing N N 329 
TRP CD2 CE2  doub Y N 330 
TRP CD2 CE3  sing Y N 331 
TRP NE1 CE2  sing Y N 332 
TRP NE1 HE1  sing N N 333 
TRP CE2 CZ2  sing Y N 334 
TRP CE3 CZ3  doub Y N 335 
TRP CE3 HE3  sing N N 336 
TRP CZ2 CH2  doub Y N 337 
TRP CZ2 HZ2  sing N N 338 
TRP CZ3 CH2  sing Y N 339 
TRP CZ3 HZ3  sing N N 340 
TRP CH2 HH2  sing N N 341 
TRP OXT HXT  sing N N 342 
TYR N   CA   sing N N 343 
TYR N   H    sing N N 344 
TYR N   H2   sing N N 345 
TYR CA  C    sing N N 346 
TYR CA  CB   sing N N 347 
TYR CA  HA   sing N N 348 
TYR C   O    doub N N 349 
TYR C   OXT  sing N N 350 
TYR CB  CG   sing N N 351 
TYR CB  HB2  sing N N 352 
TYR CB  HB3  sing N N 353 
TYR CG  CD1  doub Y N 354 
TYR CG  CD2  sing Y N 355 
TYR CD1 CE1  sing Y N 356 
TYR CD1 HD1  sing N N 357 
TYR CD2 CE2  doub Y N 358 
TYR CD2 HD2  sing N N 359 
TYR CE1 CZ   doub Y N 360 
TYR CE1 HE1  sing N N 361 
TYR CE2 CZ   sing Y N 362 
TYR CE2 HE2  sing N N 363 
TYR CZ  OH   sing N N 364 
TYR OH  HH   sing N N 365 
TYR OXT HXT  sing N N 366 
VAL N   CA   sing N N 367 
VAL N   H    sing N N 368 
VAL N   H2   sing N N 369 
VAL CA  C    sing N N 370 
VAL CA  CB   sing N N 371 
VAL CA  HA   sing N N 372 
VAL C   O    doub N N 373 
VAL C   OXT  sing N N 374 
VAL CB  CG1  sing N N 375 
VAL CB  CG2  sing N N 376 
VAL CB  HB   sing N N 377 
VAL CG1 HG11 sing N N 378 
VAL CG1 HG12 sing N N 379 
VAL CG1 HG13 sing N N 380 
VAL CG2 HG21 sing N N 381 
VAL CG2 HG22 sing N N 382 
VAL CG2 HG23 sing N N 383 
VAL OXT HXT  sing N N 384 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM118047 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   5CQD 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    6NFK 
_atom_sites.fract_transf_matrix[1][1]   0.019763 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019763 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006698 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
I 
N 
O 
S 
# 
loop_