data_6NG3 # _entry.id 6NG3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NG3 pdb_00006ng3 10.2210/pdb6ng3/pdb WWPDB D_1000238743 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NG3 _pdbx_database_status.recvd_initial_deposition_date 2018-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, W.' 1 0000-0002-5661-4728 'Bonanno, J.' 2 ? 'Almo, S.C.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1286 _citation.page_last 1295.e4 _citation.title 'Structural Basis of CD160:HVEM Recognition.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2019.05.010 _citation.pdbx_database_id_PubMed 31230945 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, W.' 1 ? primary 'Garrett, S.C.' 2 ? primary 'Fedorov, E.V.' 3 ? primary 'Ramagopal, U.A.' 4 ? primary 'Garforth, S.J.' 5 ? primary 'Bonanno, J.B.' 6 ? primary 'Almo, S.C.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6NG3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.930 _cell.length_a_esd ? _cell.length_b 87.930 _cell.length_b_esd ? _cell.length_c 157.698 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NG3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CD160 antigen,Tumor necrosis factor receptor superfamily member 14' 26314.684 1 ? ? ? ? 2 branched man ;beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; 748.682 1 ? ? ? ? 3 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 4 non-polymer man 'MAGNESIUM ION' 24.305 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Natural killer cell receptor BY55,Herpes virus entry mediator A,HveA,Tumor necrosis factor receptor-like 2,TR2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLH SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKGGGGSGGGGSGGGGSGGGGSLPSCKEDEYPVGSECCPKCSPG YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRA YATGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLH SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKGGGGSGGGGSGGGGSGGGGSLPSCKEDEYPVGSECCPKCSPG YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRA YATGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 ASN n 1 3 ILE n 1 4 THR n 1 5 SER n 1 6 SER n 1 7 ALA n 1 8 SER n 1 9 GLN n 1 10 GLU n 1 11 GLY n 1 12 THR n 1 13 ARG n 1 14 LEU n 1 15 ASN n 1 16 LEU n 1 17 ILE n 1 18 CYS n 1 19 THR n 1 20 VAL n 1 21 TRP n 1 22 HIS n 1 23 LYS n 1 24 LYS n 1 25 GLU n 1 26 GLU n 1 27 ALA n 1 28 GLU n 1 29 GLY n 1 30 PHE n 1 31 VAL n 1 32 VAL n 1 33 PHE n 1 34 LEU n 1 35 CYS n 1 36 LYS n 1 37 ASP n 1 38 ARG n 1 39 SER n 1 40 GLY n 1 41 ASP n 1 42 CYS n 1 43 SER n 1 44 PRO n 1 45 GLU n 1 46 THR n 1 47 SER n 1 48 LEU n 1 49 LYS n 1 50 GLN n 1 51 LEU n 1 52 ARG n 1 53 LEU n 1 54 LYS n 1 55 ARG n 1 56 ASP n 1 57 PRO n 1 58 GLY n 1 59 ILE n 1 60 ASP n 1 61 GLY n 1 62 VAL n 1 63 GLY n 1 64 GLU n 1 65 ILE n 1 66 SER n 1 67 SER n 1 68 GLN n 1 69 LEU n 1 70 MET n 1 71 PHE n 1 72 THR n 1 73 ILE n 1 74 SER n 1 75 GLN n 1 76 VAL n 1 77 THR n 1 78 PRO n 1 79 LEU n 1 80 HIS n 1 81 SER n 1 82 GLY n 1 83 THR n 1 84 TYR n 1 85 GLN n 1 86 CYS n 1 87 CYS n 1 88 ALA n 1 89 ARG n 1 90 SER n 1 91 GLN n 1 92 LYS n 1 93 SER n 1 94 GLY n 1 95 ILE n 1 96 ARG n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 HIS n 1 101 PHE n 1 102 PHE n 1 103 SER n 1 104 ILE n 1 105 LEU n 1 106 PHE n 1 107 THR n 1 108 GLU n 1 109 THR n 1 110 GLY n 1 111 ASN n 1 112 TYR n 1 113 THR n 1 114 VAL n 1 115 THR n 1 116 GLY n 1 117 LEU n 1 118 LYS n 1 119 GLY n 1 120 GLY n 1 121 GLY n 1 122 GLY n 1 123 SER n 1 124 GLY n 1 125 GLY n 1 126 GLY n 1 127 GLY n 1 128 SER n 1 129 GLY n 1 130 GLY n 1 131 GLY n 1 132 GLY n 1 133 SER n 1 134 GLY n 1 135 GLY n 1 136 GLY n 1 137 GLY n 1 138 SER n 1 139 LEU n 1 140 PRO n 1 141 SER n 1 142 CYS n 1 143 LYS n 1 144 GLU n 1 145 ASP n 1 146 GLU n 1 147 TYR n 1 148 PRO n 1 149 VAL n 1 150 GLY n 1 151 SER n 1 152 GLU n 1 153 CYS n 1 154 CYS n 1 155 PRO n 1 156 LYS n 1 157 CYS n 1 158 SER n 1 159 PRO n 1 160 GLY n 1 161 TYR n 1 162 ARG n 1 163 VAL n 1 164 LYS n 1 165 GLU n 1 166 ALA n 1 167 CYS n 1 168 GLY n 1 169 GLU n 1 170 LEU n 1 171 THR n 1 172 GLY n 1 173 THR n 1 174 VAL n 1 175 CYS n 1 176 GLU n 1 177 PRO n 1 178 CYS n 1 179 PRO n 1 180 PRO n 1 181 GLY n 1 182 THR n 1 183 TYR n 1 184 ILE n 1 185 ALA n 1 186 HIS n 1 187 LEU n 1 188 ASN n 1 189 GLY n 1 190 LEU n 1 191 SER n 1 192 LYS n 1 193 CYS n 1 194 LEU n 1 195 GLN n 1 196 CYS n 1 197 GLN n 1 198 MET n 1 199 CYS n 1 200 ASP n 1 201 PRO n 1 202 ALA n 1 203 MET n 1 204 GLY n 1 205 LEU n 1 206 ARG n 1 207 ALA n 1 208 SER n 1 209 ARG n 1 210 ASN n 1 211 CYS n 1 212 SER n 1 213 ARG n 1 214 THR n 1 215 GLU n 1 216 ASN n 1 217 ALA n 1 218 VAL n 1 219 CYS n 1 220 GLY n 1 221 CYS n 1 222 SER n 1 223 PRO n 1 224 GLY n 1 225 HIS n 1 226 PHE n 1 227 CYS n 1 228 ILE n 1 229 VAL n 1 230 GLN n 1 231 ASP n 1 232 GLY n 1 233 ASP n 1 234 HIS n 1 235 CYS n 1 236 ALA n 1 237 ALA n 1 238 CYS n 1 239 ARG n 1 240 ALA n 1 241 TYR n 1 242 ALA n 1 243 THR n 1 244 GLY n 1 245 HIS n 1 246 HIS n 1 247 HIS n 1 248 HIS n 1 249 HIS n 1 250 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 118 Human ? 'CD160, BY55' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Drosophila acanthoptera' 51166 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 119 250 Human ? 'TNFRSF14, HVEA, HVEM, UNQ329/PRO509' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Drosophila acanthoptera' 51166 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP BY55_HUMAN O95971 ? 1 ;INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLH SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLK ; 27 2 UNP TNR14_HUMAN Q92956 ? 1 ;LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAV CGCSPGHFCIVQDGDHCAACRAYAT ; 39 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6NG3 A 1 ? 118 ? O95971 27 ? 144 ? 27 144 2 2 6NG3 A 139 ? 243 ? Q92956 39 ? 143 ? 1039 1143 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NG3 GLY A 119 ? UNP O95971 ? ? linker 1019 1 1 6NG3 GLY A 120 ? UNP O95971 ? ? linker 1020 2 1 6NG3 GLY A 121 ? UNP O95971 ? ? linker 1021 3 1 6NG3 GLY A 122 ? UNP O95971 ? ? linker 1022 4 1 6NG3 SER A 123 ? UNP O95971 ? ? linker 1023 5 1 6NG3 GLY A 124 ? UNP O95971 ? ? linker 1024 6 1 6NG3 GLY A 125 ? UNP O95971 ? ? linker 1025 7 1 6NG3 GLY A 126 ? UNP O95971 ? ? linker 1026 8 1 6NG3 GLY A 127 ? UNP O95971 ? ? linker 1027 9 1 6NG3 SER A 128 ? UNP O95971 ? ? linker 1028 10 1 6NG3 GLY A 129 ? UNP O95971 ? ? linker 1029 11 1 6NG3 GLY A 130 ? UNP O95971 ? ? linker 1030 12 1 6NG3 GLY A 131 ? UNP O95971 ? ? linker 1031 13 1 6NG3 GLY A 132 ? UNP O95971 ? ? linker 1032 14 1 6NG3 SER A 133 ? UNP O95971 ? ? linker 1033 15 1 6NG3 GLY A 134 ? UNP O95971 ? ? linker 1034 16 1 6NG3 GLY A 135 ? UNP O95971 ? ? linker 1035 17 1 6NG3 GLY A 136 ? UNP O95971 ? ? linker 1036 18 1 6NG3 GLY A 137 ? UNP O95971 ? ? linker 1037 19 1 6NG3 SER A 138 ? UNP O95971 ? ? linker 1038 20 2 6NG3 GLY A 244 ? UNP Q92956 ? ? 'expression tag' 1144 21 2 6NG3 HIS A 245 ? UNP Q92956 ? ? 'expression tag' 1145 22 2 6NG3 HIS A 246 ? UNP Q92956 ? ? 'expression tag' 1146 23 2 6NG3 HIS A 247 ? UNP Q92956 ? ? 'expression tag' 1147 24 2 6NG3 HIS A 248 ? UNP Q92956 ? ? 'expression tag' 1148 25 2 6NG3 HIS A 249 ? UNP Q92956 ? ? 'expression tag' 1149 26 2 6NG3 HIS A 250 ? UNP Q92956 ? ? 'expression tag' 1150 27 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose 'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NG3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH7.0, 30% (V/V) Jeffamine ED-2001 pH7.0, and 0.1 M sodium citrate tribasic dihydrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-08-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 31-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 31-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NG3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.88 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7332 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.1 _reflns.pdbx_Rmerge_I_obs 0.178 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.88 _reflns_shell.d_res_low 2.93 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 364 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.552 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 3.03 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 3.03 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -6.06 _refine.B_iso_max ? _refine.B_iso_mean 71.963 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.924 _refine.correlation_coeff_Fo_to_Fc_free 0.898 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NG3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.88 _refine.ls_d_res_low 20.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6939 _refine.ls_number_reflns_R_free 344 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.45 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23614 _refine.ls_R_factor_R_free 0.27363 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23415 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4FHQ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.268 _refine.pdbx_overall_ESU_R_Free 0.388 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 18.046 _refine.overall_SU_ML 0.344 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.88 _refine_hist.d_res_low 20.00 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1616 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1537 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 79 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 1655 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1517 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.913 2.022 2241 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.028 3.000 3531 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.407 5.000 198 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.667 23.651 63 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 20.246 15.000 275 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 24.399 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.087 0.200 264 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.021 1774 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 347 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.082 6.988 807 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.053 6.986 806 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.063 10.452 1000 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.065 10.457 1001 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.416 7.556 848 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.413 7.563 849 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.103 11.141 1242 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 11.958 54.897 1647 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 11.954 54.945 1648 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.883 _refine_ls_shell.d_res_low 2.956 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 29 _refine_ls_shell.number_reflns_R_work 493 _refine_ls_shell.percent_reflns_obs 98.86 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.358 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.293 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6NG3 _struct.title 'Crystal structure of human CD160 and HVEM complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NG3 _struct_keywords.text 'CD160, HVEM, BTLA, gD, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 23 ? ALA A 27 ? LYS A 49 ALA A 53 5 ? 5 HELX_P HELX_P2 AA2 SER A 43 ? SER A 47 ? SER A 69 SER A 73 5 ? 5 HELX_P HELX_P3 AA3 ASP A 200 ? MET A 203 ? ASP A 1100 MET A 1103 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 86 SG ? ? A CYS 44 A CYS 112 1_555 ? ? ? ? ? ? ? 2.013 ? ? disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 61 A CYS 68 1_555 ? ? ? ? ? ? ? 2.048 ? ? disulf3 disulf ? ? A CYS 142 SG ? ? ? 1_555 A CYS 153 SG ? ? A CYS 1042 A CYS 1053 1_555 ? ? ? ? ? ? ? 2.064 ? ? disulf4 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 167 SG ? ? A CYS 1054 A CYS 1067 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf5 disulf ? ? A CYS 157 SG ? ? ? 1_555 A CYS 175 SG ? ? A CYS 1057 A CYS 1075 1_555 ? ? ? ? ? ? ? 2.057 ? ? disulf6 disulf ? ? A CYS 178 SG ? ? ? 1_555 A CYS 193 SG ? ? A CYS 1078 A CYS 1093 1_555 ? ? ? ? ? ? ? 2.070 ? ? disulf7 disulf ? ? A CYS 196 SG ? ? ? 1_555 A CYS 211 SG ? ? A CYS 1096 A CYS 1111 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf8 disulf ? ? A CYS 199 SG ? ? ? 1_555 A CYS 219 SG ? ? A CYS 1099 A CYS 1119 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf9 disulf ? ? A CYS 221 SG ? ? ? 1_555 A CYS 238 SG ? ? A CYS 1121 A CYS 1138 1_555 ? ? ? ? ? ? ? 2.049 ? ? disulf10 disulf ? ? A CYS 227 SG ? ? ? 1_555 A CYS 235 SG ? ? A CYS 1127 A CYS 1135 1_555 ? ? ? ? ? ? ? 2.024 ? ? covale1 covale one ? A ASN 2 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 28 B NAG 1 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation covale2 covale one ? A ASN 210 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 1110 C NAG 1 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation covale3 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.440 ? ? covale4 covale both ? B NAG . O4 ? ? ? 1_555 B BMA . C1 ? ? B NAG 2 B BMA 3 1_555 ? ? ? ? ? ? ? 1.423 ? ? covale5 covale both ? B BMA . O3 ? ? ? 1_555 B BMA . C1 ? ? B BMA 3 B BMA 4 1_555 ? ? ? ? ? ? ? 1.452 ? ? covale6 covale both ? C NAG . O4 ? ? ? 1_555 C NAG . C1 ? ? C NAG 1 C NAG 2 1_555 ? ? ? ? ? ? ? 1.473 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 6 ? AA4 ? 2 ? AA5 ? 2 ? AA6 ? 2 ? AA7 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 2 ? GLU A 10 ? ASN A 28 GLU A 36 AA1 2 ARG A 13 ? TRP A 21 ? ARG A 39 TRP A 47 AA1 3 SER A 66 ? ILE A 73 ? SER A 92 ILE A 99 AA2 1 LYS A 49 ? LEU A 53 ? LYS A 75 LEU A 79 AA2 2 PHE A 30 ? LYS A 36 ? PHE A 56 LYS A 62 AA2 3 GLY A 82 ? SER A 90 ? GLY A 108 SER A 116 AA2 4 PHE A 102 ? LEU A 105 ? PHE A 128 LEU A 131 AA2 5 THR A 113 ? THR A 115 ? THR A 139 THR A 141 AA3 1 LYS A 49 ? LEU A 53 ? LYS A 75 LEU A 79 AA3 2 PHE A 30 ? LYS A 36 ? PHE A 56 LYS A 62 AA3 3 GLY A 82 ? SER A 90 ? GLY A 108 SER A 116 AA3 4 ARG A 96 ? GLN A 98 ? ARG A 122 GLN A 124 AA3 5 THR A 173 ? PRO A 177 ? THR A 1073 PRO A 1077 AA3 6 TYR A 161 ? GLU A 165 ? TYR A 1061 GLU A 1065 AA4 1 GLU A 146 ? VAL A 149 ? GLU A 1046 VAL A 1049 AA4 2 GLU A 152 ? PRO A 155 ? GLU A 1052 PRO A 1055 AA5 1 THR A 182 ? TYR A 183 ? THR A 1082 TYR A 1083 AA5 2 LEU A 194 ? GLN A 195 ? LEU A 1094 GLN A 1095 AA6 1 LEU A 205 ? ARG A 209 ? LEU A 1105 ARG A 1109 AA6 2 VAL A 218 ? CYS A 221 ? VAL A 1118 CYS A 1121 AA7 1 CYS A 227 ? VAL A 229 ? CYS A 1127 VAL A 1129 AA7 2 ALA A 237 ? CYS A 238 ? ALA A 1137 CYS A 1138 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 8 ? N SER A 34 O ASN A 15 ? O ASN A 41 AA1 2 3 N VAL A 20 ? N VAL A 46 O SER A 67 ? O SER A 93 AA2 1 2 O LEU A 51 ? O LEU A 77 N VAL A 32 ? N VAL A 58 AA2 2 3 N PHE A 33 ? N PHE A 59 O CYS A 87 ? O CYS A 113 AA2 3 4 N TYR A 84 ? N TYR A 110 O PHE A 102 ? O PHE A 128 AA2 4 5 N LEU A 105 ? N LEU A 131 O THR A 113 ? O THR A 139 AA3 1 2 O LEU A 51 ? O LEU A 77 N VAL A 32 ? N VAL A 58 AA3 2 3 N PHE A 33 ? N PHE A 59 O CYS A 87 ? O CYS A 113 AA3 3 4 N ALA A 88 ? N ALA A 114 O LEU A 97 ? O LEU A 123 AA3 4 5 N ARG A 96 ? N ARG A 122 O CYS A 175 ? O CYS A 1075 AA3 5 6 O VAL A 174 ? O VAL A 1074 N GLU A 165 ? N GLU A 1065 AA4 1 2 N VAL A 149 ? N VAL A 1049 O GLU A 152 ? O GLU A 1052 AA5 1 2 N TYR A 183 ? N TYR A 1083 O LEU A 194 ? O LEU A 1094 AA6 1 2 N ARG A 206 ? N ARG A 1106 O GLY A 220 ? O GLY A 1120 AA7 1 2 N ILE A 228 ? N ILE A 1128 O ALA A 237 ? O ALA A 1137 # _atom_sites.entry_id 6NG3 _atom_sites.fract_transf_matrix[1][1] 0.011373 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011373 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006341 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 27 27 ILE ILE A . n A 1 2 ASN 2 28 28 ASN ASN A . n A 1 3 ILE 3 29 29 ILE ILE A . n A 1 4 THR 4 30 30 THR THR A . n A 1 5 SER 5 31 31 SER SER A . n A 1 6 SER 6 32 32 SER SER A . n A 1 7 ALA 7 33 33 ALA ALA A . n A 1 8 SER 8 34 34 SER SER A . n A 1 9 GLN 9 35 35 GLN GLN A . n A 1 10 GLU 10 36 36 GLU GLU A . n A 1 11 GLY 11 37 37 GLY GLY A . n A 1 12 THR 12 38 38 THR THR A . n A 1 13 ARG 13 39 39 ARG ARG A . n A 1 14 LEU 14 40 40 LEU LEU A . n A 1 15 ASN 15 41 41 ASN ASN A . n A 1 16 LEU 16 42 42 LEU LEU A . n A 1 17 ILE 17 43 43 ILE ILE A . n A 1 18 CYS 18 44 44 CYS CYS A . n A 1 19 THR 19 45 45 THR THR A . n A 1 20 VAL 20 46 46 VAL VAL A . n A 1 21 TRP 21 47 47 TRP TRP A . n A 1 22 HIS 22 48 48 HIS HIS A . n A 1 23 LYS 23 49 49 LYS LYS A . n A 1 24 LYS 24 50 50 LYS LYS A . n A 1 25 GLU 25 51 51 GLU GLU A . n A 1 26 GLU 26 52 52 GLU GLU A . n A 1 27 ALA 27 53 53 ALA ALA A . n A 1 28 GLU 28 54 54 GLU GLU A . n A 1 29 GLY 29 55 55 GLY GLY A . n A 1 30 PHE 30 56 56 PHE PHE A . n A 1 31 VAL 31 57 57 VAL VAL A . n A 1 32 VAL 32 58 58 VAL VAL A . n A 1 33 PHE 33 59 59 PHE PHE A . n A 1 34 LEU 34 60 60 LEU LEU A . n A 1 35 CYS 35 61 61 CYS CYS A . n A 1 36 LYS 36 62 62 LYS LYS A . n A 1 37 ASP 37 63 63 ASP ASP A . n A 1 38 ARG 38 64 64 ARG ARG A . n A 1 39 SER 39 65 65 SER SER A . n A 1 40 GLY 40 66 66 GLY GLY A . n A 1 41 ASP 41 67 67 ASP ASP A . n A 1 42 CYS 42 68 68 CYS CYS A . n A 1 43 SER 43 69 69 SER SER A . n A 1 44 PRO 44 70 70 PRO PRO A . n A 1 45 GLU 45 71 71 GLU GLU A . n A 1 46 THR 46 72 72 THR THR A . n A 1 47 SER 47 73 73 SER SER A . n A 1 48 LEU 48 74 74 LEU LEU A . n A 1 49 LYS 49 75 75 LYS LYS A . n A 1 50 GLN 50 76 76 GLN GLN A . n A 1 51 LEU 51 77 77 LEU LEU A . n A 1 52 ARG 52 78 78 ARG ARG A . n A 1 53 LEU 53 79 79 LEU LEU A . n A 1 54 LYS 54 80 80 LYS LYS A . n A 1 55 ARG 55 81 81 ARG ARG A . n A 1 56 ASP 56 82 82 ASP ASP A . n A 1 57 PRO 57 83 ? ? ? A . n A 1 58 GLY 58 84 ? ? ? A . n A 1 59 ILE 59 85 ? ? ? A . n A 1 60 ASP 60 86 ? ? ? A . n A 1 61 GLY 61 87 ? ? ? A . n A 1 62 VAL 62 88 ? ? ? A . n A 1 63 GLY 63 89 ? ? ? A . n A 1 64 GLU 64 90 ? ? ? A . n A 1 65 ILE 65 91 91 ILE ILE A . n A 1 66 SER 66 92 92 SER SER A . n A 1 67 SER 67 93 93 SER SER A . n A 1 68 GLN 68 94 94 GLN GLN A . n A 1 69 LEU 69 95 95 LEU LEU A . n A 1 70 MET 70 96 96 MET MET A . n A 1 71 PHE 71 97 97 PHE PHE A . n A 1 72 THR 72 98 98 THR THR A . n A 1 73 ILE 73 99 99 ILE ILE A . n A 1 74 SER 74 100 100 SER SER A . n A 1 75 GLN 75 101 101 GLN GLN A . n A 1 76 VAL 76 102 102 VAL VAL A . n A 1 77 THR 77 103 103 THR THR A . n A 1 78 PRO 78 104 104 PRO PRO A . n A 1 79 LEU 79 105 105 LEU LEU A . n A 1 80 HIS 80 106 106 HIS HIS A . n A 1 81 SER 81 107 107 SER SER A . n A 1 82 GLY 82 108 108 GLY GLY A . n A 1 83 THR 83 109 109 THR THR A . n A 1 84 TYR 84 110 110 TYR TYR A . n A 1 85 GLN 85 111 111 GLN GLN A . n A 1 86 CYS 86 112 112 CYS CYS A . n A 1 87 CYS 87 113 113 CYS CYS A . n A 1 88 ALA 88 114 114 ALA ALA A . n A 1 89 ARG 89 115 115 ARG ARG A . n A 1 90 SER 90 116 116 SER SER A . n A 1 91 GLN 91 117 117 GLN GLN A . n A 1 92 LYS 92 118 118 LYS LYS A . n A 1 93 SER 93 119 119 SER SER A . n A 1 94 GLY 94 120 120 GLY GLY A . n A 1 95 ILE 95 121 121 ILE ILE A . n A 1 96 ARG 96 122 122 ARG ARG A . n A 1 97 LEU 97 123 123 LEU LEU A . n A 1 98 GLN 98 124 124 GLN GLN A . n A 1 99 GLY 99 125 125 GLY GLY A . n A 1 100 HIS 100 126 126 HIS HIS A . n A 1 101 PHE 101 127 127 PHE PHE A . n A 1 102 PHE 102 128 128 PHE PHE A . n A 1 103 SER 103 129 129 SER SER A . n A 1 104 ILE 104 130 130 ILE ILE A . n A 1 105 LEU 105 131 131 LEU LEU A . n A 1 106 PHE 106 132 132 PHE PHE A . n A 1 107 THR 107 133 133 THR THR A . n A 1 108 GLU 108 134 ? ? ? A . n A 1 109 THR 109 135 ? ? ? A . n A 1 110 GLY 110 136 ? ? ? A . n A 1 111 ASN 111 137 137 ASN ASN A . n A 1 112 TYR 112 138 138 TYR TYR A . n A 1 113 THR 113 139 139 THR THR A . n A 1 114 VAL 114 140 140 VAL VAL A . n A 1 115 THR 115 141 141 THR THR A . n A 1 116 GLY 116 142 142 GLY GLY A . n A 1 117 LEU 117 143 143 LEU LEU A . n A 1 118 LYS 118 144 144 LYS LYS A . n A 1 119 GLY 119 1019 ? ? ? A . n A 1 120 GLY 120 1020 ? ? ? A . n A 1 121 GLY 121 1021 ? ? ? A . n A 1 122 GLY 122 1022 ? ? ? A . n A 1 123 SER 123 1023 ? ? ? A . n A 1 124 GLY 124 1024 ? ? ? A . n A 1 125 GLY 125 1025 ? ? ? A . n A 1 126 GLY 126 1026 ? ? ? A . n A 1 127 GLY 127 1027 ? ? ? A . n A 1 128 SER 128 1028 ? ? ? A . n A 1 129 GLY 129 1029 ? ? ? A . n A 1 130 GLY 130 1030 ? ? ? A . n A 1 131 GLY 131 1031 ? ? ? A . n A 1 132 GLY 132 1032 ? ? ? A . n A 1 133 SER 133 1033 ? ? ? A . n A 1 134 GLY 134 1034 ? ? ? A . n A 1 135 GLY 135 1035 ? ? ? A . n A 1 136 GLY 136 1036 ? ? ? A . n A 1 137 GLY 137 1037 ? ? ? A . n A 1 138 SER 138 1038 ? ? ? A . n A 1 139 LEU 139 1039 ? ? ? A . n A 1 140 PRO 140 1040 ? ? ? A . n A 1 141 SER 141 1041 1041 SER SER A . n A 1 142 CYS 142 1042 1042 CYS CYS A . n A 1 143 LYS 143 1043 1043 LYS LYS A . n A 1 144 GLU 144 1044 1044 GLU GLU A . n A 1 145 ASP 145 1045 1045 ASP ASP A . n A 1 146 GLU 146 1046 1046 GLU GLU A . n A 1 147 TYR 147 1047 1047 TYR TYR A . n A 1 148 PRO 148 1048 1048 PRO PRO A . n A 1 149 VAL 149 1049 1049 VAL VAL A . n A 1 150 GLY 150 1050 1050 GLY GLY A . n A 1 151 SER 151 1051 1051 SER SER A . n A 1 152 GLU 152 1052 1052 GLU GLU A . n A 1 153 CYS 153 1053 1053 CYS CYS A . n A 1 154 CYS 154 1054 1054 CYS CYS A . n A 1 155 PRO 155 1055 1055 PRO PRO A . n A 1 156 LYS 156 1056 1056 LYS LYS A . n A 1 157 CYS 157 1057 1057 CYS CYS A . n A 1 158 SER 158 1058 1058 SER SER A . n A 1 159 PRO 159 1059 1059 PRO PRO A . n A 1 160 GLY 160 1060 1060 GLY GLY A . n A 1 161 TYR 161 1061 1061 TYR TYR A . n A 1 162 ARG 162 1062 1062 ARG ARG A . n A 1 163 VAL 163 1063 1063 VAL VAL A . n A 1 164 LYS 164 1064 1064 LYS LYS A . n A 1 165 GLU 165 1065 1065 GLU GLU A . n A 1 166 ALA 166 1066 1066 ALA ALA A . n A 1 167 CYS 167 1067 1067 CYS CYS A . n A 1 168 GLY 168 1068 1068 GLY GLY A . n A 1 169 GLU 169 1069 1069 GLU GLU A . n A 1 170 LEU 170 1070 1070 LEU LEU A . n A 1 171 THR 171 1071 1071 THR THR A . n A 1 172 GLY 172 1072 1072 GLY GLY A . n A 1 173 THR 173 1073 1073 THR THR A . n A 1 174 VAL 174 1074 1074 VAL VAL A . n A 1 175 CYS 175 1075 1075 CYS CYS A . n A 1 176 GLU 176 1076 1076 GLU GLU A . n A 1 177 PRO 177 1077 1077 PRO PRO A . n A 1 178 CYS 178 1078 1078 CYS CYS A . n A 1 179 PRO 179 1079 1079 PRO PRO A . n A 1 180 PRO 180 1080 1080 PRO PRO A . n A 1 181 GLY 181 1081 1081 GLY GLY A . n A 1 182 THR 182 1082 1082 THR THR A . n A 1 183 TYR 183 1083 1083 TYR TYR A . n A 1 184 ILE 184 1084 1084 ILE ILE A . n A 1 185 ALA 185 1085 1085 ALA ALA A . n A 1 186 HIS 186 1086 1086 HIS HIS A . n A 1 187 LEU 187 1087 1087 LEU LEU A . n A 1 188 ASN 188 1088 1088 ASN ASN A . n A 1 189 GLY 189 1089 1089 GLY GLY A . n A 1 190 LEU 190 1090 1090 LEU LEU A . n A 1 191 SER 191 1091 1091 SER SER A . n A 1 192 LYS 192 1092 1092 LYS LYS A . n A 1 193 CYS 193 1093 1093 CYS CYS A . n A 1 194 LEU 194 1094 1094 LEU LEU A . n A 1 195 GLN 195 1095 1095 GLN GLN A . n A 1 196 CYS 196 1096 1096 CYS CYS A . n A 1 197 GLN 197 1097 1097 GLN GLN A . n A 1 198 MET 198 1098 1098 MET MET A . n A 1 199 CYS 199 1099 1099 CYS CYS A . n A 1 200 ASP 200 1100 1100 ASP ASP A . n A 1 201 PRO 201 1101 1101 PRO PRO A . n A 1 202 ALA 202 1102 1102 ALA ALA A . n A 1 203 MET 203 1103 1103 MET MET A . n A 1 204 GLY 204 1104 1104 GLY GLY A . n A 1 205 LEU 205 1105 1105 LEU LEU A . n A 1 206 ARG 206 1106 1106 ARG ARG A . n A 1 207 ALA 207 1107 1107 ALA ALA A . n A 1 208 SER 208 1108 1108 SER SER A . n A 1 209 ARG 209 1109 1109 ARG ARG A . n A 1 210 ASN 210 1110 1110 ASN ASN A . n A 1 211 CYS 211 1111 1111 CYS CYS A . n A 1 212 SER 212 1112 1112 SER SER A . n A 1 213 ARG 213 1113 1113 ARG ARG A . n A 1 214 THR 214 1114 1114 THR THR A . n A 1 215 GLU 215 1115 1115 GLU GLU A . n A 1 216 ASN 216 1116 1116 ASN ASN A . n A 1 217 ALA 217 1117 1117 ALA ALA A . n A 1 218 VAL 218 1118 1118 VAL VAL A . n A 1 219 CYS 219 1119 1119 CYS CYS A . n A 1 220 GLY 220 1120 1120 GLY GLY A . n A 1 221 CYS 221 1121 1121 CYS CYS A . n A 1 222 SER 222 1122 1122 SER SER A . n A 1 223 PRO 223 1123 1123 PRO PRO A . n A 1 224 GLY 224 1124 1124 GLY GLY A . n A 1 225 HIS 225 1125 1125 HIS HIS A . n A 1 226 PHE 226 1126 1126 PHE PHE A . n A 1 227 CYS 227 1127 1127 CYS CYS A . n A 1 228 ILE 228 1128 1128 ILE ILE A . n A 1 229 VAL 229 1129 1129 VAL VAL A . n A 1 230 GLN 230 1130 1130 GLN GLN A . n A 1 231 ASP 231 1131 1131 ASP ASP A . n A 1 232 GLY 232 1132 ? ? ? A . n A 1 233 ASP 233 1133 ? ? ? A . n A 1 234 HIS 234 1134 ? ? ? A . n A 1 235 CYS 235 1135 1135 CYS CYS A . n A 1 236 ALA 236 1136 1136 ALA ALA A . n A 1 237 ALA 237 1137 1137 ALA ALA A . n A 1 238 CYS 238 1138 1138 CYS CYS A . n A 1 239 ARG 239 1139 1139 ARG ARG A . n A 1 240 ALA 240 1140 ? ? ? A . n A 1 241 TYR 241 1141 ? ? ? A . n A 1 242 ALA 242 1142 ? ? ? A . n A 1 243 THR 243 1143 ? ? ? A . n A 1 244 GLY 244 1144 ? ? ? A . n A 1 245 HIS 245 1145 ? ? ? A . n A 1 246 HIS 246 1146 ? ? ? A . n A 1 247 HIS 247 1147 ? ? ? A . n A 1 248 HIS 248 1148 ? ? ? A . n A 1 249 HIS 249 1149 ? ? ? A . n A 1 250 HIS 250 1150 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id D _pdbx_nonpoly_scheme.entity_id 4 _pdbx_nonpoly_scheme.mon_id MG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1207 _pdbx_nonpoly_scheme.auth_seq_num 305 _pdbx_nonpoly_scheme.pdb_mon_id MG _pdbx_nonpoly_scheme.auth_mon_id MG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-03 2 'Structure model' 1 1 2019-07-10 3 'Structure model' 1 2 2019-08-21 4 'Structure model' 1 3 2019-12-18 5 'Structure model' 2 0 2020-07-29 6 'Structure model' 2 1 2023-10-11 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' Advisory 7 5 'Structure model' 'Atomic model' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' 'Structure summary' 11 6 'Structure model' 'Data collection' 12 6 'Structure model' 'Database references' 13 6 'Structure model' 'Derived calculations' 14 6 'Structure model' 'Refinement description' 15 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' pdbx_audit_support 4 5 'Structure model' atom_site 5 5 'Structure model' chem_comp 6 5 'Structure model' entity 7 5 'Structure model' pdbx_branch_scheme 8 5 'Structure model' pdbx_chem_comp_identifier 9 5 'Structure model' pdbx_entity_branch 10 5 'Structure model' pdbx_entity_branch_descriptor 11 5 'Structure model' pdbx_entity_branch_link 12 5 'Structure model' pdbx_entity_branch_list 13 5 'Structure model' pdbx_entity_nonpoly 14 5 'Structure model' pdbx_nonpoly_scheme 15 5 'Structure model' pdbx_struct_assembly_gen 16 5 'Structure model' pdbx_validate_symm_contact 17 5 'Structure model' struct_asym 18 5 'Structure model' struct_conn 19 5 'Structure model' struct_site 20 5 'Structure model' struct_site_gen 21 6 'Structure model' chem_comp 22 6 'Structure model' chem_comp_atom 23 6 'Structure model' chem_comp_bond 24 6 'Structure model' database_2 25 6 'Structure model' pdbx_initial_refinement_model 26 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 4 'Structure model' '_pdbx_audit_support.funding_organization' 7 5 'Structure model' '_atom_site.auth_asym_id' 8 5 'Structure model' '_atom_site.auth_seq_id' 9 5 'Structure model' '_atom_site.label_asym_id' 10 5 'Structure model' '_atom_site.label_entity_id' 11 5 'Structure model' '_chem_comp.name' 12 5 'Structure model' '_chem_comp.type' 13 5 'Structure model' '_entity.formula_weight' 14 5 'Structure model' '_entity.pdbx_description' 15 5 'Structure model' '_entity.pdbx_number_of_molecules' 16 5 'Structure model' '_entity.type' 17 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 5 'Structure model' '_pdbx_validate_symm_contact.auth_asym_id_2' 19 5 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_2' 20 5 'Structure model' '_struct_conn.pdbx_role' 21 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 22 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 25 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 6 'Structure model' '_chem_comp.pdbx_synonyms' 28 6 'Structure model' '_database_2.pdbx_DOI' 29 6 'Structure model' '_database_2.pdbx_database_accession' 30 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0123 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 41 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 98 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ALA _pdbx_validate_symm_contact.auth_seq_id_1 1066 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O6 _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 BMA _pdbx_validate_symm_contact.auth_seq_id_2 4 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_445 _pdbx_validate_symm_contact.dist 2.14 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 61 ? ? CB A CYS 61 ? ? SG A CYS 61 ? ? 121.18 114.20 6.98 1.10 N 2 1 NE A ARG 1113 ? ? CZ A ARG 1113 ? ? NH2 A ARG 1113 ? ? 123.45 120.30 3.15 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 65 ? ? -107.63 50.77 2 1 ILE A 1128 ? ? -131.17 -35.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 83 ? A PRO 57 2 1 Y 1 A GLY 84 ? A GLY 58 3 1 Y 1 A ILE 85 ? A ILE 59 4 1 Y 1 A ASP 86 ? A ASP 60 5 1 Y 1 A GLY 87 ? A GLY 61 6 1 Y 1 A VAL 88 ? A VAL 62 7 1 Y 1 A GLY 89 ? A GLY 63 8 1 Y 1 A GLU 90 ? A GLU 64 9 1 Y 1 A GLU 134 ? A GLU 108 10 1 Y 1 A THR 135 ? A THR 109 11 1 Y 1 A GLY 136 ? A GLY 110 12 1 Y 1 A GLY 1019 ? A GLY 119 13 1 Y 1 A GLY 1020 ? A GLY 120 14 1 Y 1 A GLY 1021 ? A GLY 121 15 1 Y 1 A GLY 1022 ? A GLY 122 16 1 Y 1 A SER 1023 ? A SER 123 17 1 Y 1 A GLY 1024 ? A GLY 124 18 1 Y 1 A GLY 1025 ? A GLY 125 19 1 Y 1 A GLY 1026 ? A GLY 126 20 1 Y 1 A GLY 1027 ? A GLY 127 21 1 Y 1 A SER 1028 ? A SER 128 22 1 Y 1 A GLY 1029 ? A GLY 129 23 1 Y 1 A GLY 1030 ? A GLY 130 24 1 Y 1 A GLY 1031 ? A GLY 131 25 1 Y 1 A GLY 1032 ? A GLY 132 26 1 Y 1 A SER 1033 ? A SER 133 27 1 Y 1 A GLY 1034 ? A GLY 134 28 1 Y 1 A GLY 1035 ? A GLY 135 29 1 Y 1 A GLY 1036 ? A GLY 136 30 1 Y 1 A GLY 1037 ? A GLY 137 31 1 Y 1 A SER 1038 ? A SER 138 32 1 Y 1 A LEU 1039 ? A LEU 139 33 1 Y 1 A PRO 1040 ? A PRO 140 34 1 Y 1 A GLY 1132 ? A GLY 232 35 1 Y 1 A ASP 1133 ? A ASP 233 36 1 Y 1 A HIS 1134 ? A HIS 234 37 1 Y 1 A ALA 1140 ? A ALA 240 38 1 Y 1 A TYR 1141 ? A TYR 241 39 1 Y 1 A ALA 1142 ? A ALA 242 40 1 Y 1 A THR 1143 ? A THR 243 41 1 Y 1 A GLY 1144 ? A GLY 244 42 1 Y 1 A HIS 1145 ? A HIS 245 43 1 Y 1 A HIS 1146 ? A HIS 246 44 1 Y 1 A HIS 1147 ? A HIS 247 45 1 Y 1 A HIS 1148 ? A HIS 248 46 1 Y 1 A HIS 1149 ? A HIS 249 47 1 Y 1 A HIS 1150 ? A HIS 250 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BMA C1 C N R 74 BMA C2 C N S 75 BMA C3 C N S 76 BMA C4 C N S 77 BMA C5 C N R 78 BMA C6 C N N 79 BMA O1 O N N 80 BMA O2 O N N 81 BMA O3 O N N 82 BMA O4 O N N 83 BMA O5 O N N 84 BMA O6 O N N 85 BMA H1 H N N 86 BMA H2 H N N 87 BMA H3 H N N 88 BMA H4 H N N 89 BMA H5 H N N 90 BMA H61 H N N 91 BMA H62 H N N 92 BMA HO1 H N N 93 BMA HO2 H N N 94 BMA HO3 H N N 95 BMA HO4 H N N 96 BMA HO6 H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 ILE N N N N 182 ILE CA C N S 183 ILE C C N N 184 ILE O O N N 185 ILE CB C N S 186 ILE CG1 C N N 187 ILE CG2 C N N 188 ILE CD1 C N N 189 ILE OXT O N N 190 ILE H H N N 191 ILE H2 H N N 192 ILE HA H N N 193 ILE HB H N N 194 ILE HG12 H N N 195 ILE HG13 H N N 196 ILE HG21 H N N 197 ILE HG22 H N N 198 ILE HG23 H N N 199 ILE HD11 H N N 200 ILE HD12 H N N 201 ILE HD13 H N N 202 ILE HXT H N N 203 LEU N N N N 204 LEU CA C N S 205 LEU C C N N 206 LEU O O N N 207 LEU CB C N N 208 LEU CG C N N 209 LEU CD1 C N N 210 LEU CD2 C N N 211 LEU OXT O N N 212 LEU H H N N 213 LEU H2 H N N 214 LEU HA H N N 215 LEU HB2 H N N 216 LEU HB3 H N N 217 LEU HG H N N 218 LEU HD11 H N N 219 LEU HD12 H N N 220 LEU HD13 H N N 221 LEU HD21 H N N 222 LEU HD22 H N N 223 LEU HD23 H N N 224 LEU HXT H N N 225 LYS N N N N 226 LYS CA C N S 227 LYS C C N N 228 LYS O O N N 229 LYS CB C N N 230 LYS CG C N N 231 LYS CD C N N 232 LYS CE C N N 233 LYS NZ N N N 234 LYS OXT O N N 235 LYS H H N N 236 LYS H2 H N N 237 LYS HA H N N 238 LYS HB2 H N N 239 LYS HB3 H N N 240 LYS HG2 H N N 241 LYS HG3 H N N 242 LYS HD2 H N N 243 LYS HD3 H N N 244 LYS HE2 H N N 245 LYS HE3 H N N 246 LYS HZ1 H N N 247 LYS HZ2 H N N 248 LYS HZ3 H N N 249 LYS HXT H N N 250 MET N N N N 251 MET CA C N S 252 MET C C N N 253 MET O O N N 254 MET CB C N N 255 MET CG C N N 256 MET SD S N N 257 MET CE C N N 258 MET OXT O N N 259 MET H H N N 260 MET H2 H N N 261 MET HA H N N 262 MET HB2 H N N 263 MET HB3 H N N 264 MET HG2 H N N 265 MET HG3 H N N 266 MET HE1 H N N 267 MET HE2 H N N 268 MET HE3 H N N 269 MET HXT H N N 270 MG MG MG N N 271 NAG C1 C N R 272 NAG C2 C N R 273 NAG C3 C N R 274 NAG C4 C N S 275 NAG C5 C N R 276 NAG C6 C N N 277 NAG C7 C N N 278 NAG C8 C N N 279 NAG N2 N N N 280 NAG O1 O N N 281 NAG O3 O N N 282 NAG O4 O N N 283 NAG O5 O N N 284 NAG O6 O N N 285 NAG O7 O N N 286 NAG H1 H N N 287 NAG H2 H N N 288 NAG H3 H N N 289 NAG H4 H N N 290 NAG H5 H N N 291 NAG H61 H N N 292 NAG H62 H N N 293 NAG H81 H N N 294 NAG H82 H N N 295 NAG H83 H N N 296 NAG HN2 H N N 297 NAG HO1 H N N 298 NAG HO3 H N N 299 NAG HO4 H N N 300 NAG HO6 H N N 301 PHE N N N N 302 PHE CA C N S 303 PHE C C N N 304 PHE O O N N 305 PHE CB C N N 306 PHE CG C Y N 307 PHE CD1 C Y N 308 PHE CD2 C Y N 309 PHE CE1 C Y N 310 PHE CE2 C Y N 311 PHE CZ C Y N 312 PHE OXT O N N 313 PHE H H N N 314 PHE H2 H N N 315 PHE HA H N N 316 PHE HB2 H N N 317 PHE HB3 H N N 318 PHE HD1 H N N 319 PHE HD2 H N N 320 PHE HE1 H N N 321 PHE HE2 H N N 322 PHE HZ H N N 323 PHE HXT H N N 324 PRO N N N N 325 PRO CA C N S 326 PRO C C N N 327 PRO O O N N 328 PRO CB C N N 329 PRO CG C N N 330 PRO CD C N N 331 PRO OXT O N N 332 PRO H H N N 333 PRO HA H N N 334 PRO HB2 H N N 335 PRO HB3 H N N 336 PRO HG2 H N N 337 PRO HG3 H N N 338 PRO HD2 H N N 339 PRO HD3 H N N 340 PRO HXT H N N 341 SER N N N N 342 SER CA C N S 343 SER C C N N 344 SER O O N N 345 SER CB C N N 346 SER OG O N N 347 SER OXT O N N 348 SER H H N N 349 SER H2 H N N 350 SER HA H N N 351 SER HB2 H N N 352 SER HB3 H N N 353 SER HG H N N 354 SER HXT H N N 355 THR N N N N 356 THR CA C N S 357 THR C C N N 358 THR O O N N 359 THR CB C N R 360 THR OG1 O N N 361 THR CG2 C N N 362 THR OXT O N N 363 THR H H N N 364 THR H2 H N N 365 THR HA H N N 366 THR HB H N N 367 THR HG1 H N N 368 THR HG21 H N N 369 THR HG22 H N N 370 THR HG23 H N N 371 THR HXT H N N 372 TRP N N N N 373 TRP CA C N S 374 TRP C C N N 375 TRP O O N N 376 TRP CB C N N 377 TRP CG C Y N 378 TRP CD1 C Y N 379 TRP CD2 C Y N 380 TRP NE1 N Y N 381 TRP CE2 C Y N 382 TRP CE3 C Y N 383 TRP CZ2 C Y N 384 TRP CZ3 C Y N 385 TRP CH2 C Y N 386 TRP OXT O N N 387 TRP H H N N 388 TRP H2 H N N 389 TRP HA H N N 390 TRP HB2 H N N 391 TRP HB3 H N N 392 TRP HD1 H N N 393 TRP HE1 H N N 394 TRP HE3 H N N 395 TRP HZ2 H N N 396 TRP HZ3 H N N 397 TRP HH2 H N N 398 TRP HXT H N N 399 TYR N N N N 400 TYR CA C N S 401 TYR C C N N 402 TYR O O N N 403 TYR CB C N N 404 TYR CG C Y N 405 TYR CD1 C Y N 406 TYR CD2 C Y N 407 TYR CE1 C Y N 408 TYR CE2 C Y N 409 TYR CZ C Y N 410 TYR OH O N N 411 TYR OXT O N N 412 TYR H H N N 413 TYR H2 H N N 414 TYR HA H N N 415 TYR HB2 H N N 416 TYR HB3 H N N 417 TYR HD1 H N N 418 TYR HD2 H N N 419 TYR HE1 H N N 420 TYR HE2 H N N 421 TYR HH H N N 422 TYR HXT H N N 423 VAL N N N N 424 VAL CA C N S 425 VAL C C N N 426 VAL O O N N 427 VAL CB C N N 428 VAL CG1 C N N 429 VAL CG2 C N N 430 VAL OXT O N N 431 VAL H H N N 432 VAL H2 H N N 433 VAL HA H N N 434 VAL HB H N N 435 VAL HG11 H N N 436 VAL HG12 H N N 437 VAL HG13 H N N 438 VAL HG21 H N N 439 VAL HG22 H N N 440 VAL HG23 H N N 441 VAL HXT H N N 442 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BMA C1 C2 sing N N 70 BMA C1 O1 sing N N 71 BMA C1 O5 sing N N 72 BMA C1 H1 sing N N 73 BMA C2 C3 sing N N 74 BMA C2 O2 sing N N 75 BMA C2 H2 sing N N 76 BMA C3 C4 sing N N 77 BMA C3 O3 sing N N 78 BMA C3 H3 sing N N 79 BMA C4 C5 sing N N 80 BMA C4 O4 sing N N 81 BMA C4 H4 sing N N 82 BMA C5 C6 sing N N 83 BMA C5 O5 sing N N 84 BMA C5 H5 sing N N 85 BMA C6 O6 sing N N 86 BMA C6 H61 sing N N 87 BMA C6 H62 sing N N 88 BMA O1 HO1 sing N N 89 BMA O2 HO2 sing N N 90 BMA O3 HO3 sing N N 91 BMA O4 HO4 sing N N 92 BMA O6 HO6 sing N N 93 CYS N CA sing N N 94 CYS N H sing N N 95 CYS N H2 sing N N 96 CYS CA C sing N N 97 CYS CA CB sing N N 98 CYS CA HA sing N N 99 CYS C O doub N N 100 CYS C OXT sing N N 101 CYS CB SG sing N N 102 CYS CB HB2 sing N N 103 CYS CB HB3 sing N N 104 CYS SG HG sing N N 105 CYS OXT HXT sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 HIS N CA sing N N 153 HIS N H sing N N 154 HIS N H2 sing N N 155 HIS CA C sing N N 156 HIS CA CB sing N N 157 HIS CA HA sing N N 158 HIS C O doub N N 159 HIS C OXT sing N N 160 HIS CB CG sing N N 161 HIS CB HB2 sing N N 162 HIS CB HB3 sing N N 163 HIS CG ND1 sing Y N 164 HIS CG CD2 doub Y N 165 HIS ND1 CE1 doub Y N 166 HIS ND1 HD1 sing N N 167 HIS CD2 NE2 sing Y N 168 HIS CD2 HD2 sing N N 169 HIS CE1 NE2 sing Y N 170 HIS CE1 HE1 sing N N 171 HIS NE2 HE2 sing N N 172 HIS OXT HXT sing N N 173 ILE N CA sing N N 174 ILE N H sing N N 175 ILE N H2 sing N N 176 ILE CA C sing N N 177 ILE CA CB sing N N 178 ILE CA HA sing N N 179 ILE C O doub N N 180 ILE C OXT sing N N 181 ILE CB CG1 sing N N 182 ILE CB CG2 sing N N 183 ILE CB HB sing N N 184 ILE CG1 CD1 sing N N 185 ILE CG1 HG12 sing N N 186 ILE CG1 HG13 sing N N 187 ILE CG2 HG21 sing N N 188 ILE CG2 HG22 sing N N 189 ILE CG2 HG23 sing N N 190 ILE CD1 HD11 sing N N 191 ILE CD1 HD12 sing N N 192 ILE CD1 HD13 sing N N 193 ILE OXT HXT sing N N 194 LEU N CA sing N N 195 LEU N H sing N N 196 LEU N H2 sing N N 197 LEU CA C sing N N 198 LEU CA CB sing N N 199 LEU CA HA sing N N 200 LEU C O doub N N 201 LEU C OXT sing N N 202 LEU CB CG sing N N 203 LEU CB HB2 sing N N 204 LEU CB HB3 sing N N 205 LEU CG CD1 sing N N 206 LEU CG CD2 sing N N 207 LEU CG HG sing N N 208 LEU CD1 HD11 sing N N 209 LEU CD1 HD12 sing N N 210 LEU CD1 HD13 sing N N 211 LEU CD2 HD21 sing N N 212 LEU CD2 HD22 sing N N 213 LEU CD2 HD23 sing N N 214 LEU OXT HXT sing N N 215 LYS N CA sing N N 216 LYS N H sing N N 217 LYS N H2 sing N N 218 LYS CA C sing N N 219 LYS CA CB sing N N 220 LYS CA HA sing N N 221 LYS C O doub N N 222 LYS C OXT sing N N 223 LYS CB CG sing N N 224 LYS CB HB2 sing N N 225 LYS CB HB3 sing N N 226 LYS CG CD sing N N 227 LYS CG HG2 sing N N 228 LYS CG HG3 sing N N 229 LYS CD CE sing N N 230 LYS CD HD2 sing N N 231 LYS CD HD3 sing N N 232 LYS CE NZ sing N N 233 LYS CE HE2 sing N N 234 LYS CE HE3 sing N N 235 LYS NZ HZ1 sing N N 236 LYS NZ HZ2 sing N N 237 LYS NZ HZ3 sing N N 238 LYS OXT HXT sing N N 239 MET N CA sing N N 240 MET N H sing N N 241 MET N H2 sing N N 242 MET CA C sing N N 243 MET CA CB sing N N 244 MET CA HA sing N N 245 MET C O doub N N 246 MET C OXT sing N N 247 MET CB CG sing N N 248 MET CB HB2 sing N N 249 MET CB HB3 sing N N 250 MET CG SD sing N N 251 MET CG HG2 sing N N 252 MET CG HG3 sing N N 253 MET SD CE sing N N 254 MET CE HE1 sing N N 255 MET CE HE2 sing N N 256 MET CE HE3 sing N N 257 MET OXT HXT sing N N 258 NAG C1 C2 sing N N 259 NAG C1 O1 sing N N 260 NAG C1 O5 sing N N 261 NAG C1 H1 sing N N 262 NAG C2 C3 sing N N 263 NAG C2 N2 sing N N 264 NAG C2 H2 sing N N 265 NAG C3 C4 sing N N 266 NAG C3 O3 sing N N 267 NAG C3 H3 sing N N 268 NAG C4 C5 sing N N 269 NAG C4 O4 sing N N 270 NAG C4 H4 sing N N 271 NAG C5 C6 sing N N 272 NAG C5 O5 sing N N 273 NAG C5 H5 sing N N 274 NAG C6 O6 sing N N 275 NAG C6 H61 sing N N 276 NAG C6 H62 sing N N 277 NAG C7 C8 sing N N 278 NAG C7 N2 sing N N 279 NAG C7 O7 doub N N 280 NAG C8 H81 sing N N 281 NAG C8 H82 sing N N 282 NAG C8 H83 sing N N 283 NAG N2 HN2 sing N N 284 NAG O1 HO1 sing N N 285 NAG O3 HO3 sing N N 286 NAG O4 HO4 sing N N 287 NAG O6 HO6 sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'S10 OD020068' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 B NAG 301 n B 2 NAG 2 B NAG 2 B NAG 302 n B 2 BMA 3 B BMA 3 B BMA 303 n B 2 BMA 4 B BMA 4 B MAN 304 n C 3 NAG 1 C NAG 1 C NAG 301 n C 3 NAG 2 C NAG 2 C NAG 302 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_branch.entity_id _pdbx_entity_branch.type 2 oligosaccharide 3 oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpb1-3DManpb1-4DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,4,3/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2-2/a4-b1_b4-c1_c3-d1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(3+1)][b-D-Manp]{}}}}}' LINUCS PDB-CARE ? 4 3 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 5 3 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 6 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 3 2 4 BMA C1 O1 3 BMA O3 HO3 sing ? 4 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 BMA 3 n 2 BMA 4 n 3 NAG 1 n 3 NAG 2 n # _pdbx_entity_nonpoly.entity_id 4 _pdbx_entity_nonpoly.name 'MAGNESIUM ION' _pdbx_entity_nonpoly.comp_id MG # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4FHQ _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'surface plasmon resonance' _pdbx_struct_assembly_auth_evidence.details ? #