data_6NLA # _entry.id 6NLA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NLA pdb_00006nla 10.2210/pdb6nla/pdb WWPDB D_1000237583 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NLA _pdbx_database_status.recvd_initial_deposition_date 2019-01-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Maniaci, B.' 1 0000-0001-5686-8456 'Stec, B.' 2 0000-0002-8696-0349 'Huxford, T.' 3 0000-0002-1939-7373 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 58 _citation.language ? _citation.page_first 2199 _citation.page_last 2207 _citation.title 'Design of High-Affinity Metal-Controlled Protein Dimers.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.9b00055 _citation.pdbx_database_id_PubMed 30938154 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Maniaci, B.' 1 0000-0001-5686-8456 primary 'Lipper, C.H.' 2 ? primary 'Anipindi, D.L.' 3 ? primary 'Erlandsen, H.' 4 ? primary 'Cole, J.L.' 5 0000-0002-9028-8364 primary 'Stec, B.' 6 ? primary 'Huxford, T.' 7 ? primary 'Love, J.J.' 8 0000-0001-7220-0923 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6NLA _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.155 _cell.length_a_esd ? _cell.length_b 63.155 _cell.length_b_esd ? _cell.length_c 39.610 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NLA _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Immunoglobulin G-binding protein G' 6233.942 1 ? 'L12H, E15V, T16L, T18I, V29H, Y33H, N37L' ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 4 non-polymer nat GLYCEROL 92.094 1 ? ? ? ? 5 non-polymer nat 'SODIUM ION' 22.990 2 ? ? ? ? 6 water nat water 18.015 113 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IgG-binding protein G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTYKLILNGKTHKGVLTIEAVDAATAEKHFKQHANDLGVDGEWTYDDATKTFTVTE _entity_poly.pdbx_seq_one_letter_code_can MTYKLILNGKTHKGVLTIEAVDAATAEKHFKQHANDLGVDGEWTYDDATKTFTVTE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 TYR n 1 4 LYS n 1 5 LEU n 1 6 ILE n 1 7 LEU n 1 8 ASN n 1 9 GLY n 1 10 LYS n 1 11 THR n 1 12 HIS n 1 13 LYS n 1 14 GLY n 1 15 VAL n 1 16 LEU n 1 17 THR n 1 18 ILE n 1 19 GLU n 1 20 ALA n 1 21 VAL n 1 22 ASP n 1 23 ALA n 1 24 ALA n 1 25 THR n 1 26 ALA n 1 27 GLU n 1 28 LYS n 1 29 HIS n 1 30 PHE n 1 31 LYS n 1 32 GLN n 1 33 HIS n 1 34 ALA n 1 35 ASN n 1 36 ASP n 1 37 LEU n 1 38 GLY n 1 39 VAL n 1 40 ASP n 1 41 GLY n 1 42 GLU n 1 43 TRP n 1 44 THR n 1 45 TYR n 1 46 ASP n 1 47 ASP n 1 48 ALA n 1 49 THR n 1 50 LYS n 1 51 THR n 1 52 PHE n 1 53 THR n 1 54 VAL n 1 55 THR n 1 56 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 56 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene spg _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name Streptococcus _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1301 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'T7 expression' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPG2_STRSG _struct_ref.pdbx_db_accession P19909 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _struct_ref.pdbx_align_begin 303 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NLA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19909 _struct_ref_seq.db_align_beg 303 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 357 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 56 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NLA MET A 1 ? UNP P19909 ? ? 'initiating methionine' 1 1 1 6NLA HIS A 12 ? UNP P19909 LEU 313 'engineered mutation' 12 2 1 6NLA VAL A 15 ? UNP P19909 GLU 316 'engineered mutation' 15 3 1 6NLA LEU A 16 ? UNP P19909 THR 317 'engineered mutation' 16 4 1 6NLA ILE A 18 ? UNP P19909 THR 319 'engineered mutation' 18 5 1 6NLA HIS A 29 ? UNP P19909 VAL 330 'engineered mutation' 29 6 1 6NLA HIS A 33 ? UNP P19909 TYR 334 'engineered mutation' 33 7 1 6NLA LEU A 37 ? UNP P19909 ASN 338 'engineered mutation' 37 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NLA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;4M NaCl 0.1M HEPES pH 7.5 50mM MgCl2, 5mM zinc sulfate ; _exptl_crystal_grow.pdbx_pH_range 7.3-7.6 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0083 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0083 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NLA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.34 _reflns.d_resolution_low 31.58 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16453 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.95 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.9 _reflns.pdbx_Rmerge_I_obs 0.1 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? _reflns.pdbx_CC_star ? # _reflns_shell.d_res_high 1.34 _reflns_shell.d_res_low 1.374 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1038 _reflns_shell.percent_possible_all 83.64 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_CC_star ? # _refine.aniso_B[1][1] 0.08 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.08 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.16 _refine.B_iso_max ? _refine.B_iso_mean 25.219 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.986 _refine.correlation_coeff_Fo_to_Fc_free 0.979 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NLA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.34 _refine.ls_d_res_low 31.58 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16453 _refine.ls_number_reflns_R_free 849 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.95 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.10425 _refine.ls_R_factor_R_free 0.12786 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.10425 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1PGA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.033 _refine.pdbx_overall_ESU_R_Free 0.034 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.943 _refine.overall_SU_ML 0.018 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 439 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 565 _refine_hist.d_res_high 1.34 _refine_hist.d_res_low 31.58 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 0.013 500 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 466 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.137 1.660 686 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.533 1.596 1096 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.926 5.000 69 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.078 26.522 23 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.017 15.000 93 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.114 0.200 71 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.020 567 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 93 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.410 2.131 240 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.415 2.118 239 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.023 3.195 303 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.018 3.203 304 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.866 2.559 260 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.857 2.566 261 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.973 3.657 378 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.355 30.901 620 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.644 28.697 588 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 4.951 3.000 966 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.339 _refine_ls_shell.d_res_low 1.374 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 61 _refine_ls_shell.number_reflns_R_work 1038 _refine_ls_shell.percent_reflns_obs 83.64 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.164 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.113 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6NLA _struct.title ;Crystal structure of de novo designed metal-controlled dimer of B1 immunoglobulin-binding domain of Streptococcal Protein G (L12H, E15V, T16L, T18I, V29H, Y33H, N37L)-zinc ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NLA _struct_keywords.text 'Metal-mediated dimer, B1 Domain of Streptococcal protein G, Immunoglobulin binding protein, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 3 ? H N N 5 ? I N N 5 ? J N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 22 ? LEU A 37 ? ASP A 22 LEU A 37 1 ? 16 HELX_P HELX_P2 AA2 ASP A 47 ? THR A 49 ? ASP A 47 THR A 49 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A MET 1 N ? ? ? 1_555 B ZN . ZN ? ? A MET 1 A ZN 101 1_555 ? ? ? ? ? ? ? 2.045 ? ? metalc2 metalc ? ? A HIS 12 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 12 A ZN 102 6_555 ? ? ? ? ? ? ? 2.006 ? ? metalc3 metalc ? ? A GLU 19 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 19 A ZN 101 1_555 ? ? ? ? ? ? ? 1.972 ? ? metalc4 metalc ? ? A GLU 27 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 27 A ZN 101 4_554 ? ? ? ? ? ? ? 1.961 ? ? metalc5 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 29 A ZN 102 1_555 ? ? ? ? ? ? ? 2.000 ? ? metalc6 metalc ? ? A HIS 33 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 33 A ZN 102 1_555 ? ? ? ? ? ? ? 1.749 ? ? metalc7 metalc ? ? A TYR 45 OH ? ? ? 1_555 I NA . NA ? ? A TYR 45 A NA 108 1_555 ? ? ? ? ? ? ? 2.592 ? ? metalc8 metalc ? ? A ASP 47 OD1 ? ? ? 1_555 I NA . NA ? ? A ASP 47 A NA 108 1_555 ? ? ? ? ? ? ? 2.160 ? ? metalc9 metalc ? ? F GOL . O1 ? ? ? 1_555 H NA . NA ? ? A GOL 105 A NA 107 1_555 ? ? ? ? ? ? ? 2.045 ? ? metalc10 metalc ? ? H NA . NA ? ? ? 1_555 J HOH . O ? ? A NA 107 A HOH 213 1_555 ? ? ? ? ? ? ? 3.006 ? ? metalc11 metalc ? ? H NA . NA ? ? ? 1_555 J HOH . O ? ? A NA 107 A HOH 217 1_555 ? ? ? ? ? ? ? 2.556 ? ? metalc12 metalc ? ? I NA . NA ? ? ? 1_555 J HOH . O ? ? A NA 108 A HOH 222 1_555 ? ? ? ? ? ? ? 2.598 ? ? metalc13 metalc ? ? I NA . NA ? ? ? 1_555 J HOH . O ? ? A NA 108 A HOH 287 1_555 ? ? ? ? ? ? ? 3.063 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 13 ? GLU A 19 ? LYS A 13 GLU A 19 AA1 2 THR A 2 ? ASN A 8 ? THR A 2 ASN A 8 AA1 3 THR A 51 ? THR A 55 ? THR A 51 THR A 55 AA1 4 GLU A 42 ? ASP A 46 ? GLU A 42 ASP A 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 14 ? O GLY A 14 N LEU A 7 ? N LEU A 7 AA1 2 3 N LYS A 4 ? N LYS A 4 O PHE A 52 ? O PHE A 52 AA1 3 4 O THR A 51 ? O THR A 51 N ASP A 46 ? N ASP A 46 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'binding site for residue ZN A 101' AC2 Software A ZN 102 ? 4 'binding site for residue ZN A 102' AC3 Software A CL 103 ? 5 'binding site for residue CL A 103' AC4 Software A CL 104 ? 5 'binding site for residue CL A 104' AC5 Software A GOL 105 ? 10 'binding site for residue GOL A 105' AC6 Software A CL 106 ? 4 'binding site for residue CL A 106' AC7 Software A NA 107 ? 4 'binding site for residue NA A 107' AC8 Software A NA 108 ? 4 'binding site for residue NA A 108' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 MET A 1 ? MET A 1 . ? 1_555 ? 2 AC1 4 GLU A 19 ? GLU A 19 . ? 1_555 ? 3 AC1 4 GLU A 27 ? GLU A 27 . ? 3_545 ? 4 AC1 4 CL E . ? CL A 104 . ? 1_555 ? 5 AC2 4 HIS A 12 ? HIS A 12 . ? 6_555 ? 6 AC2 4 HIS A 29 ? HIS A 29 . ? 1_555 ? 7 AC2 4 HIS A 33 ? HIS A 33 . ? 1_555 ? 8 AC2 4 CL D . ? CL A 103 . ? 1_555 ? 9 AC3 5 HIS A 12 ? HIS A 12 . ? 6_555 ? 10 AC3 5 LYS A 13 ? LYS A 13 . ? 6_555 ? 11 AC3 5 HIS A 29 ? HIS A 29 . ? 1_555 ? 12 AC3 5 HIS A 33 ? HIS A 33 . ? 1_555 ? 13 AC3 5 ZN C . ? ZN A 102 . ? 1_555 ? 14 AC4 5 MET A 1 ? MET A 1 . ? 1_555 ? 15 AC4 5 GLU A 19 ? GLU A 19 . ? 1_555 ? 16 AC4 5 GLU A 27 ? GLU A 27 . ? 3_545 ? 17 AC4 5 THR A 44 ? THR A 44 . ? 3_545 ? 18 AC4 5 ZN B . ? ZN A 101 . ? 1_555 ? 19 AC5 10 THR A 11 ? THR A 11 . ? 6_555 ? 20 AC5 10 HIS A 12 ? HIS A 12 . ? 6_555 ? 21 AC5 10 LYS A 13 ? LYS A 13 . ? 6_555 ? 22 AC5 10 GLU A 19 ? GLU A 19 . ? 1_555 ? 23 AC5 10 ALA A 20 ? ALA A 20 . ? 1_555 ? 24 AC5 10 HIS A 29 ? HIS A 29 . ? 1_555 ? 25 AC5 10 NA H . ? NA A 107 . ? 1_555 ? 26 AC5 10 HOH J . ? HOH A 213 . ? 1_555 ? 27 AC5 10 HOH J . ? HOH A 217 . ? 1_555 ? 28 AC5 10 HOH J . ? HOH A 247 . ? 1_555 ? 29 AC6 4 VAL A 21 ? VAL A 21 . ? 4_554 ? 30 AC6 4 LYS A 31 ? LYS A 31 . ? 1_555 ? 31 AC6 4 NA H . ? NA A 107 . ? 4_554 ? 32 AC6 4 HOH J . ? HOH A 307 . ? 4_554 ? 33 AC7 4 GOL F . ? GOL A 105 . ? 1_555 ? 34 AC7 4 CL G . ? CL A 106 . ? 3_545 ? 35 AC7 4 HOH J . ? HOH A 213 . ? 1_555 ? 36 AC7 4 HOH J . ? HOH A 217 . ? 1_555 ? 37 AC8 4 TYR A 45 ? TYR A 45 . ? 1_555 ? 38 AC8 4 ASP A 47 ? ASP A 47 . ? 1_555 ? 39 AC8 4 HOH J . ? HOH A 222 . ? 1_555 ? 40 AC8 4 HOH J . ? HOH A 287 . ? 1_555 ? # _atom_sites.entry_id 6NLA _atom_sites.fract_transf_matrix[1][1] 0.015834 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015834 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025246 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N NA O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 1 ZN Zn A . C 2 ZN 1 102 2 ZN ZN A . D 3 CL 1 103 3 CL CL A . E 3 CL 1 104 4 CL CL A . F 4 GOL 1 105 6 GOL GOL A . G 3 CL 1 106 2 CL CL A . H 5 NA 1 107 72 NA NA A . I 5 NA 1 108 103 NA NA A . J 6 HOH 1 201 77 HOH HOH A . J 6 HOH 2 202 35 HOH HOH A . J 6 HOH 3 203 100 HOH HOH A . J 6 HOH 4 204 71 HOH HOH A . J 6 HOH 5 205 106 HOH HOH A . J 6 HOH 6 206 44 HOH HOH A . J 6 HOH 7 207 69 HOH HOH A . J 6 HOH 8 208 41 HOH HOH A . J 6 HOH 9 209 68 HOH HOH A . J 6 HOH 10 210 63 HOH HOH A . J 6 HOH 11 211 47 HOH HOH A . J 6 HOH 12 212 75 HOH HOH A . J 6 HOH 13 213 39 HOH HOH A . J 6 HOH 14 214 23 HOH HOH A . J 6 HOH 15 215 6 HOH HOH A . J 6 HOH 16 216 76 HOH HOH A . J 6 HOH 17 217 53 HOH HOH A . J 6 HOH 18 218 64 HOH HOH A . J 6 HOH 19 219 43 HOH HOH A . J 6 HOH 20 220 66 HOH HOH A . J 6 HOH 21 221 80 HOH HOH A . J 6 HOH 22 222 16 HOH HOH A . J 6 HOH 23 223 65 HOH HOH A . J 6 HOH 24 224 59 HOH HOH A . J 6 HOH 25 225 29 HOH HOH A . J 6 HOH 26 226 14 HOH HOH A . J 6 HOH 27 227 42 HOH HOH A . J 6 HOH 28 228 19 HOH HOH A . J 6 HOH 29 229 108 HOH HOH A . J 6 HOH 30 230 62 HOH HOH A . J 6 HOH 31 231 115 HOH HOH A . J 6 HOH 32 232 21 HOH HOH A . J 6 HOH 33 233 4 HOH HOH A . J 6 HOH 34 234 3 HOH HOH A . J 6 HOH 35 235 30 HOH HOH A . J 6 HOH 36 236 99 HOH HOH A . J 6 HOH 37 237 98 HOH HOH A . J 6 HOH 38 238 18 HOH HOH A . J 6 HOH 39 239 12 HOH HOH A . J 6 HOH 40 240 93 HOH HOH A . J 6 HOH 41 241 81 HOH HOH A . J 6 HOH 42 242 11 HOH HOH A . J 6 HOH 43 243 34 HOH HOH A . J 6 HOH 44 244 38 HOH HOH A . J 6 HOH 45 245 22 HOH HOH A . J 6 HOH 46 246 89 HOH HOH A . J 6 HOH 47 247 8 HOH HOH A . J 6 HOH 48 248 13 HOH HOH A . J 6 HOH 49 249 24 HOH HOH A . J 6 HOH 50 250 87 HOH HOH A . J 6 HOH 51 251 33 HOH HOH A . J 6 HOH 52 252 45 HOH HOH A . J 6 HOH 53 253 25 HOH HOH A . J 6 HOH 54 254 7 HOH HOH A . J 6 HOH 55 255 5 HOH HOH A . J 6 HOH 56 256 17 HOH HOH A . J 6 HOH 57 257 74 HOH HOH A . J 6 HOH 58 258 28 HOH HOH A . J 6 HOH 59 259 20 HOH HOH A . J 6 HOH 60 260 1 HOH HOH A . J 6 HOH 61 261 31 HOH HOH A . J 6 HOH 62 262 10 HOH HOH A . J 6 HOH 63 263 60 HOH HOH A . J 6 HOH 64 264 48 HOH HOH A . J 6 HOH 65 265 107 HOH HOH A . J 6 HOH 66 266 9 HOH HOH A . J 6 HOH 67 267 82 HOH HOH A . J 6 HOH 68 268 54 HOH HOH A . J 6 HOH 69 269 27 HOH HOH A . J 6 HOH 70 270 26 HOH HOH A . J 6 HOH 71 271 90 HOH HOH A . J 6 HOH 72 272 57 HOH HOH A . J 6 HOH 73 273 52 HOH HOH A . J 6 HOH 74 274 88 HOH HOH A . J 6 HOH 75 275 111 HOH HOH A . J 6 HOH 76 276 112 HOH HOH A . J 6 HOH 77 277 96 HOH HOH A . J 6 HOH 78 278 97 HOH HOH A . J 6 HOH 79 279 40 HOH HOH A . J 6 HOH 80 280 83 HOH HOH A . J 6 HOH 81 281 49 HOH HOH A . J 6 HOH 82 282 50 HOH HOH A . J 6 HOH 83 283 67 HOH HOH A . J 6 HOH 84 284 36 HOH HOH A . J 6 HOH 85 285 55 HOH HOH A . J 6 HOH 86 286 85 HOH HOH A . J 6 HOH 87 287 104 HOH HOH A . J 6 HOH 88 288 58 HOH HOH A . J 6 HOH 89 289 51 HOH HOH A . J 6 HOH 90 290 110 HOH HOH A . J 6 HOH 91 291 56 HOH HOH A . J 6 HOH 92 292 61 HOH HOH A . J 6 HOH 93 293 94 HOH HOH A . J 6 HOH 94 294 15 HOH HOH A . J 6 HOH 95 295 79 HOH HOH A . J 6 HOH 96 296 95 HOH HOH A . J 6 HOH 97 297 46 HOH HOH A . J 6 HOH 98 298 86 HOH HOH A . J 6 HOH 99 299 70 HOH HOH A . J 6 HOH 100 300 109 HOH HOH A . J 6 HOH 101 301 114 HOH HOH A . J 6 HOH 102 302 1 HOH HOH A . J 6 HOH 103 303 91 HOH HOH A . J 6 HOH 104 304 101 HOH HOH A . J 6 HOH 105 305 84 HOH HOH A . J 6 HOH 106 306 108 HOH HOH A . J 6 HOH 107 307 37 HOH HOH A . J 6 HOH 108 308 105 HOH HOH A . J 6 HOH 109 309 32 HOH HOH A . J 6 HOH 110 310 102 HOH HOH A . J 6 HOH 111 311 73 HOH HOH A . J 6 HOH 112 312 92 HOH HOH A . J 6 HOH 113 313 113 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3380 ? 1 MORE -233 ? 1 'SSA (A^2)' 5990 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 243 ? J HOH . 2 1 A HOH 254 ? J HOH . 3 1 A HOH 260 ? J HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A MET 1 ? A MET 1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 19 ? A GLU 19 ? 1_555 114.3 ? 2 N ? A MET 1 ? A MET 1 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 42.2 ? 3 OE2 ? A GLU 19 ? A GLU 19 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 72.9 ? 4 ND1 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 6_555 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 94.9 ? 5 ND1 ? A HIS 12 ? A HIS 12 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 6_555 NE2 ? A HIS 33 ? A HIS 33 ? 1_555 94.6 ? 6 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 6_555 NE2 ? A HIS 33 ? A HIS 33 ? 1_555 2.9 ? 7 OH ? A TYR 45 ? A TYR 45 ? 1_555 NA ? I NA . ? A NA 108 ? 1_555 OD1 ? A ASP 47 ? A ASP 47 ? 1_555 112.4 ? 8 OH ? A TYR 45 ? A TYR 45 ? 1_555 NA ? I NA . ? A NA 108 ? 1_555 O ? J HOH . ? A HOH 222 ? 1_555 99.6 ? 9 OD1 ? A ASP 47 ? A ASP 47 ? 1_555 NA ? I NA . ? A NA 108 ? 1_555 O ? J HOH . ? A HOH 222 ? 1_555 140.2 ? 10 OH ? A TYR 45 ? A TYR 45 ? 1_555 NA ? I NA . ? A NA 108 ? 1_555 O ? J HOH . ? A HOH 287 ? 1_555 107.6 ? 11 OD1 ? A ASP 47 ? A ASP 47 ? 1_555 NA ? I NA . ? A NA 108 ? 1_555 O ? J HOH . ? A HOH 287 ? 1_555 92.7 ? 12 O ? J HOH . ? A HOH 222 ? 1_555 NA ? I NA . ? A NA 108 ? 1_555 O ? J HOH . ? A HOH 287 ? 1_555 99.8 ? 13 O1 ? F GOL . ? A GOL 105 ? 1_555 NA ? H NA . ? A NA 107 ? 1_555 O ? J HOH . ? A HOH 213 ? 1_555 68.1 ? 14 O1 ? F GOL . ? A GOL 105 ? 1_555 NA ? H NA . ? A NA 107 ? 1_555 O ? J HOH . ? A HOH 217 ? 1_555 70.0 ? 15 O ? J HOH . ? A HOH 213 ? 1_555 NA ? H NA . ? A NA 107 ? 1_555 O ? J HOH . ? A HOH 217 ? 1_555 130.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-01-23 2 'Structure model' 1 1 2019-05-08 3 'Structure model' 1 2 2019-05-15 4 'Structure model' 1 3 2023-05-03 5 'Structure model' 1 4 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Structure summary' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' audit_author 4 4 'Structure model' audit_author 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_struct_conn_angle 7 4 'Structure model' struct_conn 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 4 'Structure model' '_audit_author.name' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.value' 24 4 'Structure model' '_struct_conn.pdbx_dist_value' 25 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 31 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 32 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 36 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 204 ? ? O A HOH 301 ? ? 2.15 2 1 O A HOH 258 ? ? O A HOH 263 ? ? 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 236 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 311 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_554 _pdbx_validate_symm_contact.dist 2.19 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CE1 _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 33 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 NE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 33 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.483 _pdbx_validate_rmsd_bond.bond_target_value 1.333 _pdbx_validate_rmsd_bond.bond_deviation 0.150 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 311 ? 6.03 . 2 1 O ? A HOH 312 ? 6.38 . 3 1 O ? A HOH 313 ? 6.48 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CL CL CL N N 47 GLN N N N N 48 GLN CA C N S 49 GLN C C N N 50 GLN O O N N 51 GLN CB C N N 52 GLN CG C N N 53 GLN CD C N N 54 GLN OE1 O N N 55 GLN NE2 N N N 56 GLN OXT O N N 57 GLN H H N N 58 GLN H2 H N N 59 GLN HA H N N 60 GLN HB2 H N N 61 GLN HB3 H N N 62 GLN HG2 H N N 63 GLN HG3 H N N 64 GLN HE21 H N N 65 GLN HE22 H N N 66 GLN HXT H N N 67 GLU N N N N 68 GLU CA C N S 69 GLU C C N N 70 GLU O O N N 71 GLU CB C N N 72 GLU CG C N N 73 GLU CD C N N 74 GLU OE1 O N N 75 GLU OE2 O N N 76 GLU OXT O N N 77 GLU H H N N 78 GLU H2 H N N 79 GLU HA H N N 80 GLU HB2 H N N 81 GLU HB3 H N N 82 GLU HG2 H N N 83 GLU HG3 H N N 84 GLU HE2 H N N 85 GLU HXT H N N 86 GLY N N N N 87 GLY CA C N N 88 GLY C C N N 89 GLY O O N N 90 GLY OXT O N N 91 GLY H H N N 92 GLY H2 H N N 93 GLY HA2 H N N 94 GLY HA3 H N N 95 GLY HXT H N N 96 GOL C1 C N N 97 GOL O1 O N N 98 GOL C2 C N N 99 GOL O2 O N N 100 GOL C3 C N N 101 GOL O3 O N N 102 GOL H11 H N N 103 GOL H12 H N N 104 GOL HO1 H N N 105 GOL H2 H N N 106 GOL HO2 H N N 107 GOL H31 H N N 108 GOL H32 H N N 109 GOL HO3 H N N 110 HIS N N N N 111 HIS CA C N S 112 HIS C C N N 113 HIS O O N N 114 HIS CB C N N 115 HIS CG C Y N 116 HIS ND1 N Y N 117 HIS CD2 C Y N 118 HIS CE1 C Y N 119 HIS NE2 N Y N 120 HIS OXT O N N 121 HIS H H N N 122 HIS H2 H N N 123 HIS HA H N N 124 HIS HB2 H N N 125 HIS HB3 H N N 126 HIS HD1 H N N 127 HIS HD2 H N N 128 HIS HE1 H N N 129 HIS HE2 H N N 130 HIS HXT H N N 131 HOH O O N N 132 HOH H1 H N N 133 HOH H2 H N N 134 ILE N N N N 135 ILE CA C N S 136 ILE C C N N 137 ILE O O N N 138 ILE CB C N S 139 ILE CG1 C N N 140 ILE CG2 C N N 141 ILE CD1 C N N 142 ILE OXT O N N 143 ILE H H N N 144 ILE H2 H N N 145 ILE HA H N N 146 ILE HB H N N 147 ILE HG12 H N N 148 ILE HG13 H N N 149 ILE HG21 H N N 150 ILE HG22 H N N 151 ILE HG23 H N N 152 ILE HD11 H N N 153 ILE HD12 H N N 154 ILE HD13 H N N 155 ILE HXT H N N 156 LEU N N N N 157 LEU CA C N S 158 LEU C C N N 159 LEU O O N N 160 LEU CB C N N 161 LEU CG C N N 162 LEU CD1 C N N 163 LEU CD2 C N N 164 LEU OXT O N N 165 LEU H H N N 166 LEU H2 H N N 167 LEU HA H N N 168 LEU HB2 H N N 169 LEU HB3 H N N 170 LEU HG H N N 171 LEU HD11 H N N 172 LEU HD12 H N N 173 LEU HD13 H N N 174 LEU HD21 H N N 175 LEU HD22 H N N 176 LEU HD23 H N N 177 LEU HXT H N N 178 LYS N N N N 179 LYS CA C N S 180 LYS C C N N 181 LYS O O N N 182 LYS CB C N N 183 LYS CG C N N 184 LYS CD C N N 185 LYS CE C N N 186 LYS NZ N N N 187 LYS OXT O N N 188 LYS H H N N 189 LYS H2 H N N 190 LYS HA H N N 191 LYS HB2 H N N 192 LYS HB3 H N N 193 LYS HG2 H N N 194 LYS HG3 H N N 195 LYS HD2 H N N 196 LYS HD3 H N N 197 LYS HE2 H N N 198 LYS HE3 H N N 199 LYS HZ1 H N N 200 LYS HZ2 H N N 201 LYS HZ3 H N N 202 LYS HXT H N N 203 MET N N N N 204 MET CA C N S 205 MET C C N N 206 MET O O N N 207 MET CB C N N 208 MET CG C N N 209 MET SD S N N 210 MET CE C N N 211 MET OXT O N N 212 MET H H N N 213 MET H2 H N N 214 MET HA H N N 215 MET HB2 H N N 216 MET HB3 H N N 217 MET HG2 H N N 218 MET HG3 H N N 219 MET HE1 H N N 220 MET HE2 H N N 221 MET HE3 H N N 222 MET HXT H N N 223 NA NA NA N N 224 PHE N N N N 225 PHE CA C N S 226 PHE C C N N 227 PHE O O N N 228 PHE CB C N N 229 PHE CG C Y N 230 PHE CD1 C Y N 231 PHE CD2 C Y N 232 PHE CE1 C Y N 233 PHE CE2 C Y N 234 PHE CZ C Y N 235 PHE OXT O N N 236 PHE H H N N 237 PHE H2 H N N 238 PHE HA H N N 239 PHE HB2 H N N 240 PHE HB3 H N N 241 PHE HD1 H N N 242 PHE HD2 H N N 243 PHE HE1 H N N 244 PHE HE2 H N N 245 PHE HZ H N N 246 PHE HXT H N N 247 THR N N N N 248 THR CA C N S 249 THR C C N N 250 THR O O N N 251 THR CB C N R 252 THR OG1 O N N 253 THR CG2 C N N 254 THR OXT O N N 255 THR H H N N 256 THR H2 H N N 257 THR HA H N N 258 THR HB H N N 259 THR HG1 H N N 260 THR HG21 H N N 261 THR HG22 H N N 262 THR HG23 H N N 263 THR HXT H N N 264 TRP N N N N 265 TRP CA C N S 266 TRP C C N N 267 TRP O O N N 268 TRP CB C N N 269 TRP CG C Y N 270 TRP CD1 C Y N 271 TRP CD2 C Y N 272 TRP NE1 N Y N 273 TRP CE2 C Y N 274 TRP CE3 C Y N 275 TRP CZ2 C Y N 276 TRP CZ3 C Y N 277 TRP CH2 C Y N 278 TRP OXT O N N 279 TRP H H N N 280 TRP H2 H N N 281 TRP HA H N N 282 TRP HB2 H N N 283 TRP HB3 H N N 284 TRP HD1 H N N 285 TRP HE1 H N N 286 TRP HE3 H N N 287 TRP HZ2 H N N 288 TRP HZ3 H N N 289 TRP HH2 H N N 290 TRP HXT H N N 291 TYR N N N N 292 TYR CA C N S 293 TYR C C N N 294 TYR O O N N 295 TYR CB C N N 296 TYR CG C Y N 297 TYR CD1 C Y N 298 TYR CD2 C Y N 299 TYR CE1 C Y N 300 TYR CE2 C Y N 301 TYR CZ C Y N 302 TYR OH O N N 303 TYR OXT O N N 304 TYR H H N N 305 TYR H2 H N N 306 TYR HA H N N 307 TYR HB2 H N N 308 TYR HB3 H N N 309 TYR HD1 H N N 310 TYR HD2 H N N 311 TYR HE1 H N N 312 TYR HE2 H N N 313 TYR HH H N N 314 TYR HXT H N N 315 VAL N N N N 316 VAL CA C N S 317 VAL C C N N 318 VAL O O N N 319 VAL CB C N N 320 VAL CG1 C N N 321 VAL CG2 C N N 322 VAL OXT O N N 323 VAL H H N N 324 VAL H2 H N N 325 VAL HA H N N 326 VAL HB H N N 327 VAL HG11 H N N 328 VAL HG12 H N N 329 VAL HG13 H N N 330 VAL HG21 H N N 331 VAL HG22 H N N 332 VAL HG23 H N N 333 VAL HXT H N N 334 ZN ZN ZN N N 335 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 GOL C1 O1 sing N N 90 GOL C1 C2 sing N N 91 GOL C1 H11 sing N N 92 GOL C1 H12 sing N N 93 GOL O1 HO1 sing N N 94 GOL C2 O2 sing N N 95 GOL C2 C3 sing N N 96 GOL C2 H2 sing N N 97 GOL O2 HO2 sing N N 98 GOL C3 O3 sing N N 99 GOL C3 H31 sing N N 100 GOL C3 H32 sing N N 101 GOL O3 HO3 sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 HOH O H1 sing N N 124 HOH O H2 sing N N 125 ILE N CA sing N N 126 ILE N H sing N N 127 ILE N H2 sing N N 128 ILE CA C sing N N 129 ILE CA CB sing N N 130 ILE CA HA sing N N 131 ILE C O doub N N 132 ILE C OXT sing N N 133 ILE CB CG1 sing N N 134 ILE CB CG2 sing N N 135 ILE CB HB sing N N 136 ILE CG1 CD1 sing N N 137 ILE CG1 HG12 sing N N 138 ILE CG1 HG13 sing N N 139 ILE CG2 HG21 sing N N 140 ILE CG2 HG22 sing N N 141 ILE CG2 HG23 sing N N 142 ILE CD1 HD11 sing N N 143 ILE CD1 HD12 sing N N 144 ILE CD1 HD13 sing N N 145 ILE OXT HXT sing N N 146 LEU N CA sing N N 147 LEU N H sing N N 148 LEU N H2 sing N N 149 LEU CA C sing N N 150 LEU CA CB sing N N 151 LEU CA HA sing N N 152 LEU C O doub N N 153 LEU C OXT sing N N 154 LEU CB CG sing N N 155 LEU CB HB2 sing N N 156 LEU CB HB3 sing N N 157 LEU CG CD1 sing N N 158 LEU CG CD2 sing N N 159 LEU CG HG sing N N 160 LEU CD1 HD11 sing N N 161 LEU CD1 HD12 sing N N 162 LEU CD1 HD13 sing N N 163 LEU CD2 HD21 sing N N 164 LEU CD2 HD22 sing N N 165 LEU CD2 HD23 sing N N 166 LEU OXT HXT sing N N 167 LYS N CA sing N N 168 LYS N H sing N N 169 LYS N H2 sing N N 170 LYS CA C sing N N 171 LYS CA CB sing N N 172 LYS CA HA sing N N 173 LYS C O doub N N 174 LYS C OXT sing N N 175 LYS CB CG sing N N 176 LYS CB HB2 sing N N 177 LYS CB HB3 sing N N 178 LYS CG CD sing N N 179 LYS CG HG2 sing N N 180 LYS CG HG3 sing N N 181 LYS CD CE sing N N 182 LYS CD HD2 sing N N 183 LYS CD HD3 sing N N 184 LYS CE NZ sing N N 185 LYS CE HE2 sing N N 186 LYS CE HE3 sing N N 187 LYS NZ HZ1 sing N N 188 LYS NZ HZ2 sing N N 189 LYS NZ HZ3 sing N N 190 LYS OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 PHE N CA sing N N 211 PHE N H sing N N 212 PHE N H2 sing N N 213 PHE CA C sing N N 214 PHE CA CB sing N N 215 PHE CA HA sing N N 216 PHE C O doub N N 217 PHE C OXT sing N N 218 PHE CB CG sing N N 219 PHE CB HB2 sing N N 220 PHE CB HB3 sing N N 221 PHE CG CD1 doub Y N 222 PHE CG CD2 sing Y N 223 PHE CD1 CE1 sing Y N 224 PHE CD1 HD1 sing N N 225 PHE CD2 CE2 doub Y N 226 PHE CD2 HD2 sing N N 227 PHE CE1 CZ doub Y N 228 PHE CE1 HE1 sing N N 229 PHE CE2 CZ sing Y N 230 PHE CE2 HE2 sing N N 231 PHE CZ HZ sing N N 232 PHE OXT HXT sing N N 233 THR N CA sing N N 234 THR N H sing N N 235 THR N H2 sing N N 236 THR CA C sing N N 237 THR CA CB sing N N 238 THR CA HA sing N N 239 THR C O doub N N 240 THR C OXT sing N N 241 THR CB OG1 sing N N 242 THR CB CG2 sing N N 243 THR CB HB sing N N 244 THR OG1 HG1 sing N N 245 THR CG2 HG21 sing N N 246 THR CG2 HG22 sing N N 247 THR CG2 HG23 sing N N 248 THR OXT HXT sing N N 249 TRP N CA sing N N 250 TRP N H sing N N 251 TRP N H2 sing N N 252 TRP CA C sing N N 253 TRP CA CB sing N N 254 TRP CA HA sing N N 255 TRP C O doub N N 256 TRP C OXT sing N N 257 TRP CB CG sing N N 258 TRP CB HB2 sing N N 259 TRP CB HB3 sing N N 260 TRP CG CD1 doub Y N 261 TRP CG CD2 sing Y N 262 TRP CD1 NE1 sing Y N 263 TRP CD1 HD1 sing N N 264 TRP CD2 CE2 doub Y N 265 TRP CD2 CE3 sing Y N 266 TRP NE1 CE2 sing Y N 267 TRP NE1 HE1 sing N N 268 TRP CE2 CZ2 sing Y N 269 TRP CE3 CZ3 doub Y N 270 TRP CE3 HE3 sing N N 271 TRP CZ2 CH2 doub Y N 272 TRP CZ2 HZ2 sing N N 273 TRP CZ3 CH2 sing Y N 274 TRP CZ3 HZ3 sing N N 275 TRP CH2 HH2 sing N N 276 TRP OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CHLORIDE ION' CL 4 GLYCEROL GOL 5 'SODIUM ION' NA 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1PGA _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #