data_6NRE # _entry.id 6NRE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6NRE WWPDB D_1000239270 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NRE _pdbx_database_status.recvd_initial_deposition_date 2019-01-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Clayton G, M.' 1 0000-0003-3380-362X 'Kappler J, W.' 2 ? 'Chan, S.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos One' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1932-6203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first e0213052 _citation.page_last e0213052 _citation.title 'Structural characteristics of lipocalin allergens: Crystal structure of the immunogenic dog allergen Can f 6.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pone.0213052 _citation.pdbx_database_id_PubMed 31525203 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clayton, G.M.' 1 ? primary 'White, J.' 2 ? primary 'Lee, S.' 3 ? primary 'Kappler, J.W.' 4 ? primary 'Chan, S.K.' 5 0000-0002-9281-5711 # _cell.entry_id 6NRE _cell.length_a 67.154 _cell.length_b 67.154 _cell.length_c 72.488 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NRE _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lipocalin-Can f 6 allergen' 21046.691 1 ? ? ? ? 2 water nat water 18.015 13 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVKDIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKD GEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRC LQARQSEAAQVSSAEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;HEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVKDIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKD GEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRC LQARQSEAAQVSSAEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 GLU n 1 3 GLU n 1 4 GLU n 1 5 ASN n 1 6 ASP n 1 7 VAL n 1 8 VAL n 1 9 LYS n 1 10 GLY n 1 11 ASN n 1 12 PHE n 1 13 ASP n 1 14 ILE n 1 15 SER n 1 16 LYS n 1 17 ILE n 1 18 SER n 1 19 GLY n 1 20 ASP n 1 21 TRP n 1 22 TYR n 1 23 SER n 1 24 ILE n 1 25 LEU n 1 26 LEU n 1 27 ALA n 1 28 SER n 1 29 ASP n 1 30 ILE n 1 31 LYS n 1 32 GLU n 1 33 LYS n 1 34 ILE n 1 35 GLU n 1 36 GLU n 1 37 ASN n 1 38 GLY n 1 39 SER n 1 40 MET n 1 41 ARG n 1 42 VAL n 1 43 PHE n 1 44 VAL n 1 45 LYS n 1 46 ASP n 1 47 ILE n 1 48 GLU n 1 49 VAL n 1 50 LEU n 1 51 SER n 1 52 ASN n 1 53 SER n 1 54 SER n 1 55 LEU n 1 56 ILE n 1 57 PHE n 1 58 THR n 1 59 MET n 1 60 HIS n 1 61 THR n 1 62 LYS n 1 63 VAL n 1 64 ASN n 1 65 GLY n 1 66 LYS n 1 67 CYS n 1 68 THR n 1 69 LYS n 1 70 ILE n 1 71 SER n 1 72 LEU n 1 73 ILE n 1 74 CYS n 1 75 ASN n 1 76 LYS n 1 77 THR n 1 78 GLU n 1 79 LYS n 1 80 ASP n 1 81 GLY n 1 82 GLU n 1 83 TYR n 1 84 ASP n 1 85 VAL n 1 86 VAL n 1 87 HIS n 1 88 ASP n 1 89 GLY n 1 90 TYR n 1 91 ASN n 1 92 LEU n 1 93 PHE n 1 94 ARG n 1 95 ILE n 1 96 ILE n 1 97 GLU n 1 98 THR n 1 99 ALA n 1 100 TYR n 1 101 GLU n 1 102 ASP n 1 103 TYR n 1 104 ILE n 1 105 ILE n 1 106 PHE n 1 107 HIS n 1 108 LEU n 1 109 ASN n 1 110 ASN n 1 111 VAL n 1 112 ASN n 1 113 GLN n 1 114 GLU n 1 115 GLN n 1 116 GLU n 1 117 PHE n 1 118 GLN n 1 119 LEU n 1 120 MET n 1 121 GLU n 1 122 LEU n 1 123 TYR n 1 124 GLY n 1 125 ARG n 1 126 LYS n 1 127 PRO n 1 128 ASP n 1 129 VAL n 1 130 SER n 1 131 PRO n 1 132 LYS n 1 133 VAL n 1 134 LYS n 1 135 GLU n 1 136 LYS n 1 137 PHE n 1 138 VAL n 1 139 ARG n 1 140 TYR n 1 141 CYS n 1 142 GLN n 1 143 GLY n 1 144 MET n 1 145 GLU n 1 146 ILE n 1 147 PRO n 1 148 LYS n 1 149 GLU n 1 150 ASN n 1 151 ILE n 1 152 LEU n 1 153 ASP n 1 154 LEU n 1 155 THR n 1 156 GLN n 1 157 VAL n 1 158 ASP n 1 159 ARG n 1 160 CYS n 1 161 LEU n 1 162 GLN n 1 163 ALA n 1 164 ARG n 1 165 GLN n 1 166 SER n 1 167 GLU n 1 168 ALA n 1 169 ALA n 1 170 GLN n 1 171 VAL n 1 172 SER n 1 173 SER n 1 174 ALA n 1 175 GLU n 1 176 HIS n 1 177 HIS n 1 178 HIS n 1 179 HIS n 1 180 HIS n 1 181 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 181 _entity_src_gen.gene_src_common_name Dog _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene lcn _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Canis lupus familiaris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9615 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code H2B3G5_CANLF _struct_ref.pdbx_db_accession H2B3G5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVKDIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKD GEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRC LQARQSEAAQVSSAE ; _struct_ref.pdbx_align_begin 16 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NRE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 175 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession H2B3G5 _struct_ref_seq.db_align_beg 16 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 190 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 175 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6NRE HIS A 176 ? UNP H2B3G5 ? ? 'expression tag' 176 1 1 6NRE HIS A 177 ? UNP H2B3G5 ? ? 'expression tag' 177 2 1 6NRE HIS A 178 ? UNP H2B3G5 ? ? 'expression tag' 178 3 1 6NRE HIS A 179 ? UNP H2B3G5 ? ? 'expression tag' 179 4 1 6NRE HIS A 180 ? UNP H2B3G5 ? ? 'expression tag' 180 5 1 6NRE HIS A 181 ? UNP H2B3G5 ? ? 'expression tag' 181 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NRE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2-propanol, sodium acetate, polyethylene glycol ether 550' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-07-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NRE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.06 _reflns.d_resolution_low 72.49 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12122 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.0 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 38.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 94 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.052 _reflns.pdbx_Rpim_I_all 0.012 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 69256 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.985 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.06 _reflns_shell.d_res_low 2.11 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.3 _reflns_shell.number_measured_all 5492 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 872 _reflns_shell.percent_possible_all 93.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.412 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 0.100 _reflns_shell.pdbx_Rrim_I_all 0.457 _reflns_shell.pdbx_Rpim_I_all 0.194 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 6NRE _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 22536 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.320 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 58.16 _refine.ls_d_res_high 2.06 _refine.ls_percent_reflns_obs 99.1 _refine.ls_R_factor_obs 0.223 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.221 _refine.ls_R_factor_R_free 0.248 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.720 _refine.ls_number_reflns_R_free 1063 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.310 _refine.pdbx_overall_phase_error 31.510 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1240 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1253 _refine_hist.d_res_high 2.06 _refine_hist.d_res_low 58.16 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.004 ? ? 1275 'X-RAY DIFFRACTION' ? f_angle_d 0.672 ? ? 1723 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.795 ? ? 773 'X-RAY DIFFRACTION' ? f_chiral_restr 0.051 ? ? 198 'X-RAY DIFFRACTION' ? f_plane_restr 0.003 ? ? 219 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.0567 2.1503 2544 0.3345 94.00 0.3954 . . 143 . . 'X-RAY DIFFRACTION' . 2.1503 2.2637 2709 0.2913 99.00 0.3024 . . 102 . . 'X-RAY DIFFRACTION' . 2.2637 2.4055 2687 0.2791 100.00 0.2922 . . 168 . . 'X-RAY DIFFRACTION' . 2.4055 2.5912 2711 0.2843 100.00 0.3505 . . 140 . . 'X-RAY DIFFRACTION' . 2.5912 2.8520 2687 0.2714 100.00 0.3763 . . 110 . . 'X-RAY DIFFRACTION' . 2.8520 3.2647 2694 0.2526 100.00 0.2779 . . 150 . . 'X-RAY DIFFRACTION' . 3.2647 4.1130 2714 0.2076 100.00 0.2194 . . 133 . . 'X-RAY DIFFRACTION' . 4.1130 58.1800 2727 0.1879 100.00 0.2084 . . 117 . . # _struct.entry_id 6NRE _struct.title 'Monomeric Lipocalin Can F 6' _struct.pdbx_descriptor 'Lipocalin Can F 6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NRE _struct_keywords.text 'Lipocalin, metabolic role, ALLERGEN' _struct_keywords.pdbx_keywords ALLERGEN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 13 ? SER A 18 ? ASP A 13 SER A 18 5 ? 6 HELX_P HELX_P2 AA2 ILE A 30 ? ILE A 34 ? ILE A 30 ILE A 34 5 ? 5 HELX_P HELX_P3 AA3 SER A 130 ? MET A 144 ? SER A 130 MET A 144 1 ? 15 HELX_P HELX_P4 AA4 PRO A 147 ? GLU A 149 ? PRO A 147 GLU A 149 5 ? 3 HELX_P HELX_P5 AA5 CYS A 160 ? ARG A 164 ? CYS A 160 ARG A 164 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 67 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 160 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 67 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 160 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.025 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 19 ? ASP A 20 ? GLY A 19 ASP A 20 AA1 2 PHE A 43 ? VAL A 49 ? PHE A 43 VAL A 49 AA1 3 SER A 54 ? VAL A 63 ? SER A 54 VAL A 63 AA1 4 LYS A 66 ? LYS A 76 ? LYS A 66 LYS A 76 AA1 5 GLU A 82 ? VAL A 86 ? GLU A 82 VAL A 86 AA1 6 TYR A 90 ? ALA A 99 ? TYR A 90 ALA A 99 AA1 7 TYR A 103 ? VAL A 111 ? TYR A 103 VAL A 111 AA1 8 PHE A 117 ? GLY A 124 ? PHE A 117 GLY A 124 AA1 9 TYR A 22 ? SER A 28 ? TYR A 22 SER A 28 AA1 10 ILE A 151 ? ASP A 153 ? ILE A 151 ASP A 153 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 19 ? N GLY A 19 O ILE A 47 ? O ILE A 47 AA1 2 3 N LYS A 45 ? N LYS A 45 O THR A 58 ? O THR A 58 AA1 3 4 N LEU A 55 ? N LEU A 55 O CYS A 74 ? O CYS A 74 AA1 4 5 N ASN A 75 ? N ASN A 75 O ASP A 84 ? O ASP A 84 AA1 5 6 N VAL A 85 ? N VAL A 85 O ASN A 91 ? O ASN A 91 AA1 6 7 N LEU A 92 ? N LEU A 92 O ASN A 109 ? O ASN A 109 AA1 7 8 N LEU A 108 ? N LEU A 108 O LEU A 119 ? O LEU A 119 AA1 8 9 O MET A 120 ? O MET A 120 N ALA A 27 ? N ALA A 27 AA1 9 10 N LEU A 26 ? N LEU A 26 O LEU A 152 ? O LEU A 152 # _atom_sites.entry_id 6NRE _atom_sites.fract_transf_matrix[1][1] 0.014891 _atom_sites.fract_transf_matrix[1][2] 0.008597 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017195 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013795 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 CYS 141 141 141 CYS CYS A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 MET 144 144 144 MET MET A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 SER 166 166 ? ? ? A . n A 1 167 GLU 167 167 ? ? ? A . n A 1 168 ALA 168 168 ? ? ? A . n A 1 169 ALA 169 169 ? ? ? A . n A 1 170 GLN 170 170 ? ? ? A . n A 1 171 VAL 171 171 ? ? ? A . n A 1 172 SER 172 172 ? ? ? A . n A 1 173 SER 173 173 ? ? ? A . n A 1 174 ALA 174 174 ? ? ? A . n A 1 175 GLU 175 175 ? ? ? A . n A 1 176 HIS 176 176 ? ? ? A . n A 1 177 HIS 177 177 ? ? ? A . n A 1 178 HIS 178 178 ? ? ? A . n A 1 179 HIS 179 179 ? ? ? A . n A 1 180 HIS 180 180 ? ? ? A . n A 1 181 HIS 181 181 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH HOH A . B 2 HOH 2 202 202 HOH HOH A . B 2 HOH 3 203 203 HOH HOH A . B 2 HOH 4 204 204 HOH HOH A . B 2 HOH 5 205 205 HOH HOH A . B 2 HOH 6 206 206 HOH HOH A . B 2 HOH 7 207 207 HOH HOH A . B 2 HOH 8 208 208 HOH HOH A . B 2 HOH 9 209 209 HOH HOH A . B 2 HOH 10 210 210 HOH HOH A . B 2 HOH 11 211 211 HOH HOH A . B 2 HOH 12 212 212 HOH HOH A . B 2 HOH 13 213 213 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2019-09-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 2 ? 'data scaling' ? ? 'Phil Evans' ? 29/03/17 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.5.32 3 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk ? ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Sep. 1, 2017' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.24 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 37 ? ? 86.56 1.70 2 1 PRO A 127 ? ? -60.21 5.17 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 6 ? CG ? A ASP 6 CG 2 1 Y 1 A ASP 6 ? OD1 ? A ASP 6 OD1 3 1 Y 1 A ASP 6 ? OD2 ? A ASP 6 OD2 4 1 Y 1 A ASN 11 ? CG ? A ASN 11 CG 5 1 Y 1 A ASN 11 ? OD1 ? A ASN 11 OD1 6 1 Y 1 A ASN 11 ? ND2 ? A ASN 11 ND2 7 1 Y 1 A GLU 35 ? CG ? A GLU 35 CG 8 1 Y 1 A GLU 35 ? CD ? A GLU 35 CD 9 1 Y 1 A GLU 35 ? OE1 ? A GLU 35 OE1 10 1 Y 1 A GLU 35 ? OE2 ? A GLU 35 OE2 11 1 Y 1 A GLU 48 ? CG ? A GLU 48 CG 12 1 Y 1 A GLU 48 ? CD ? A GLU 48 CD 13 1 Y 1 A GLU 48 ? OE1 ? A GLU 48 OE1 14 1 Y 1 A GLU 48 ? OE2 ? A GLU 48 OE2 15 1 Y 1 A ASN 52 ? CG ? A ASN 52 CG 16 1 Y 1 A ASN 52 ? OD1 ? A ASN 52 OD1 17 1 Y 1 A ASN 52 ? ND2 ? A ASN 52 ND2 18 1 Y 1 A LYS 66 ? CG ? A LYS 66 CG 19 1 Y 1 A LYS 66 ? CD ? A LYS 66 CD 20 1 Y 1 A LYS 66 ? CE ? A LYS 66 CE 21 1 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 22 1 Y 1 A LYS 76 ? CG ? A LYS 76 CG 23 1 Y 1 A LYS 76 ? CD ? A LYS 76 CD 24 1 Y 1 A LYS 76 ? CE ? A LYS 76 CE 25 1 Y 1 A LYS 76 ? NZ ? A LYS 76 NZ 26 1 Y 1 A GLU 78 ? CG ? A GLU 78 CG 27 1 Y 1 A GLU 78 ? CD ? A GLU 78 CD 28 1 Y 1 A GLU 78 ? OE1 ? A GLU 78 OE1 29 1 Y 1 A GLU 78 ? OE2 ? A GLU 78 OE2 30 1 Y 1 A LYS 79 ? CG ? A LYS 79 CG 31 1 Y 1 A LYS 79 ? CD ? A LYS 79 CD 32 1 Y 1 A LYS 79 ? CE ? A LYS 79 CE 33 1 Y 1 A LYS 79 ? NZ ? A LYS 79 NZ 34 1 Y 1 A ASP 88 ? CG ? A ASP 88 CG 35 1 Y 1 A ASP 88 ? OD1 ? A ASP 88 OD1 36 1 Y 1 A ASP 88 ? OD2 ? A ASP 88 OD2 37 1 Y 1 A GLU 101 ? CG ? A GLU 101 CG 38 1 Y 1 A GLU 101 ? CD ? A GLU 101 CD 39 1 Y 1 A GLU 101 ? OE1 ? A GLU 101 OE1 40 1 Y 1 A GLU 101 ? OE2 ? A GLU 101 OE2 41 1 Y 1 A GLN 113 ? CG ? A GLN 113 CG 42 1 Y 1 A GLN 113 ? CD ? A GLN 113 CD 43 1 Y 1 A GLN 113 ? OE1 ? A GLN 113 OE1 44 1 Y 1 A GLN 113 ? NE2 ? A GLN 113 NE2 45 1 Y 1 A GLU 114 ? CG ? A GLU 114 CG 46 1 Y 1 A GLU 114 ? CD ? A GLU 114 CD 47 1 Y 1 A GLU 114 ? OE1 ? A GLU 114 OE1 48 1 Y 1 A GLU 114 ? OE2 ? A GLU 114 OE2 49 1 Y 1 A GLU 116 ? CG ? A GLU 116 CG 50 1 Y 1 A GLU 116 ? CD ? A GLU 116 CD 51 1 Y 1 A GLU 116 ? OE1 ? A GLU 116 OE1 52 1 Y 1 A GLU 116 ? OE2 ? A GLU 116 OE2 53 1 Y 1 A LYS 132 ? CG ? A LYS 132 CG 54 1 Y 1 A LYS 132 ? CD ? A LYS 132 CD 55 1 Y 1 A LYS 132 ? CE ? A LYS 132 CE 56 1 Y 1 A LYS 132 ? NZ ? A LYS 132 NZ 57 1 Y 1 A GLU 135 ? CG ? A GLU 135 CG 58 1 Y 1 A GLU 135 ? CD ? A GLU 135 CD 59 1 Y 1 A GLU 135 ? OE1 ? A GLU 135 OE1 60 1 Y 1 A GLU 135 ? OE2 ? A GLU 135 OE2 61 1 Y 1 A GLN 165 ? CG ? A GLN 165 CG 62 1 Y 1 A GLN 165 ? CD ? A GLN 165 CD 63 1 Y 1 A GLN 165 ? OE1 ? A GLN 165 OE1 64 1 Y 1 A GLN 165 ? NE2 ? A GLN 165 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 1 ? A HIS 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A SER 166 ? A SER 166 7 1 Y 1 A GLU 167 ? A GLU 167 8 1 Y 1 A ALA 168 ? A ALA 168 9 1 Y 1 A ALA 169 ? A ALA 169 10 1 Y 1 A GLN 170 ? A GLN 170 11 1 Y 1 A VAL 171 ? A VAL 171 12 1 Y 1 A SER 172 ? A SER 172 13 1 Y 1 A SER 173 ? A SER 173 14 1 Y 1 A ALA 174 ? A ALA 174 15 1 Y 1 A GLU 175 ? A GLU 175 16 1 Y 1 A HIS 176 ? A HIS 176 17 1 Y 1 A HIS 177 ? A HIS 177 18 1 Y 1 A HIS 178 ? A HIS 178 19 1 Y 1 A HIS 179 ? A HIS 179 20 1 Y 1 A HIS 180 ? A HIS 180 21 1 Y 1 A HIS 181 ? A HIS 181 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #