data_6NSU # _entry.id 6NSU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NSU pdb_00006nsu 10.2210/pdb6nsu/pdb WWPDB D_1000239353 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-21 2 'Structure model' 1 1 2019-09-25 3 'Structure model' 1 2 2019-11-20 4 'Structure model' 1 3 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NSU _pdbx_database_status.recvd_initial_deposition_date 2019-01-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6NSO unspecified PDB . 4ZKZ unspecified PDB . 5FEV unspecified PDB . 5FEK unspecified PDB . 5FEU unspecified PDB . 4ZK6 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Esakova, O.A.' 1 ? 'Grove, T.L.' 2 ? 'Silakov, A.' 3 ? 'Yennawar, N.H.' 4 ? 'Booker, S.J.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 141 _citation.language ? _citation.page_first 14142 _citation.page_last 14151 _citation.title ;An Unexpected Species Determined by X-ray Crystallography that May Represent an Intermediate in the Reaction Catalyzed by Quinolinate Synthase. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.9b02513 _citation.pdbx_database_id_PubMed 31390192 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Esakova, O.A.' 1 ? primary 'Silakov, A.' 2 ? primary 'Grove, T.L.' 3 ? primary 'Warui, D.M.' 4 ? primary 'Yennawar, N.H.' 5 ? primary 'Booker, S.J.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Quinolinate synthase A' 34190.027 1 2.5.1.72 ? ? ? 2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 3 non-polymer syn DIDEHYDROASPARTATE 131.087 1 ? ? ? ? 4 water nat water 18.015 43 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDLVEEILRLKEERNAIILAHNYQLPEVQDIADFIGDSLELARRATRVDADVIVFAGVDFMAETAKILNPDKVVLIPSRE ATCAMANMLKVEHILEAKRKYPNAPVVLYVNSTAEAKAYADVTVTSANAVEVVKKLDSDVVIFGPDKNLAHYVAKMTGKK IIPVPSKGHCYVHQKFTLDDVERAKKLHPNAKLMIHPECIPEVQEKADIIASTGGMIKRACEWDEWVVFTEREMVYRLRK LYPQKKFYPAREDAFCIGMKAITLKNIYESLKDMKYKVEVPEEIARKARKAIERMLEMSK ; _entity_poly.pdbx_seq_one_letter_code_can ;MDLVEEILRLKEERNAIILAHNYQLPEVQDIADFIGDSLELARRATRVDADVIVFAGVDFMAETAKILNPDKVVLIPSRE ATCAMANMLKVEHILEAKRKYPNAPVVLYVNSTAEAKAYADVTVTSANAVEVVKKLDSDVVIFGPDKNLAHYVAKMTGKK IIPVPSKGHCYVHQKFTLDDVERAKKLHPNAKLMIHPECIPEVQEKADIIASTGGMIKRACEWDEWVVFTEREMVYRLRK LYPQKKFYPAREDAFCIGMKAITLKNIYESLKDMKYKVEVPEEIARKARKAIERMLEMSK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IRON/SULFUR CLUSTER' SF4 3 DIDEHYDROASPARTATE DYA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LEU n 1 4 VAL n 1 5 GLU n 1 6 GLU n 1 7 ILE n 1 8 LEU n 1 9 ARG n 1 10 LEU n 1 11 LYS n 1 12 GLU n 1 13 GLU n 1 14 ARG n 1 15 ASN n 1 16 ALA n 1 17 ILE n 1 18 ILE n 1 19 LEU n 1 20 ALA n 1 21 HIS n 1 22 ASN n 1 23 TYR n 1 24 GLN n 1 25 LEU n 1 26 PRO n 1 27 GLU n 1 28 VAL n 1 29 GLN n 1 30 ASP n 1 31 ILE n 1 32 ALA n 1 33 ASP n 1 34 PHE n 1 35 ILE n 1 36 GLY n 1 37 ASP n 1 38 SER n 1 39 LEU n 1 40 GLU n 1 41 LEU n 1 42 ALA n 1 43 ARG n 1 44 ARG n 1 45 ALA n 1 46 THR n 1 47 ARG n 1 48 VAL n 1 49 ASP n 1 50 ALA n 1 51 ASP n 1 52 VAL n 1 53 ILE n 1 54 VAL n 1 55 PHE n 1 56 ALA n 1 57 GLY n 1 58 VAL n 1 59 ASP n 1 60 PHE n 1 61 MET n 1 62 ALA n 1 63 GLU n 1 64 THR n 1 65 ALA n 1 66 LYS n 1 67 ILE n 1 68 LEU n 1 69 ASN n 1 70 PRO n 1 71 ASP n 1 72 LYS n 1 73 VAL n 1 74 VAL n 1 75 LEU n 1 76 ILE n 1 77 PRO n 1 78 SER n 1 79 ARG n 1 80 GLU n 1 81 ALA n 1 82 THR n 1 83 CYS n 1 84 ALA n 1 85 MET n 1 86 ALA n 1 87 ASN n 1 88 MET n 1 89 LEU n 1 90 LYS n 1 91 VAL n 1 92 GLU n 1 93 HIS n 1 94 ILE n 1 95 LEU n 1 96 GLU n 1 97 ALA n 1 98 LYS n 1 99 ARG n 1 100 LYS n 1 101 TYR n 1 102 PRO n 1 103 ASN n 1 104 ALA n 1 105 PRO n 1 106 VAL n 1 107 VAL n 1 108 LEU n 1 109 TYR n 1 110 VAL n 1 111 ASN n 1 112 SER n 1 113 THR n 1 114 ALA n 1 115 GLU n 1 116 ALA n 1 117 LYS n 1 118 ALA n 1 119 TYR n 1 120 ALA n 1 121 ASP n 1 122 VAL n 1 123 THR n 1 124 VAL n 1 125 THR n 1 126 SER n 1 127 ALA n 1 128 ASN n 1 129 ALA n 1 130 VAL n 1 131 GLU n 1 132 VAL n 1 133 VAL n 1 134 LYS n 1 135 LYS n 1 136 LEU n 1 137 ASP n 1 138 SER n 1 139 ASP n 1 140 VAL n 1 141 VAL n 1 142 ILE n 1 143 PHE n 1 144 GLY n 1 145 PRO n 1 146 ASP n 1 147 LYS n 1 148 ASN n 1 149 LEU n 1 150 ALA n 1 151 HIS n 1 152 TYR n 1 153 VAL n 1 154 ALA n 1 155 LYS n 1 156 MET n 1 157 THR n 1 158 GLY n 1 159 LYS n 1 160 LYS n 1 161 ILE n 1 162 ILE n 1 163 PRO n 1 164 VAL n 1 165 PRO n 1 166 SER n 1 167 LYS n 1 168 GLY n 1 169 HIS n 1 170 CYS n 1 171 TYR n 1 172 VAL n 1 173 HIS n 1 174 GLN n 1 175 LYS n 1 176 PHE n 1 177 THR n 1 178 LEU n 1 179 ASP n 1 180 ASP n 1 181 VAL n 1 182 GLU n 1 183 ARG n 1 184 ALA n 1 185 LYS n 1 186 LYS n 1 187 LEU n 1 188 HIS n 1 189 PRO n 1 190 ASN n 1 191 ALA n 1 192 LYS n 1 193 LEU n 1 194 MET n 1 195 ILE n 1 196 HIS n 1 197 PRO n 1 198 GLU n 1 199 CYS n 1 200 ILE n 1 201 PRO n 1 202 GLU n 1 203 VAL n 1 204 GLN n 1 205 GLU n 1 206 LYS n 1 207 ALA n 1 208 ASP n 1 209 ILE n 1 210 ILE n 1 211 ALA n 1 212 SER n 1 213 THR n 1 214 GLY n 1 215 GLY n 1 216 MET n 1 217 ILE n 1 218 LYS n 1 219 ARG n 1 220 ALA n 1 221 CYS n 1 222 GLU n 1 223 TRP n 1 224 ASP n 1 225 GLU n 1 226 TRP n 1 227 VAL n 1 228 VAL n 1 229 PHE n 1 230 THR n 1 231 GLU n 1 232 ARG n 1 233 GLU n 1 234 MET n 1 235 VAL n 1 236 TYR n 1 237 ARG n 1 238 LEU n 1 239 ARG n 1 240 LYS n 1 241 LEU n 1 242 TYR n 1 243 PRO n 1 244 GLN n 1 245 LYS n 1 246 LYS n 1 247 PHE n 1 248 TYR n 1 249 PRO n 1 250 ALA n 1 251 ARG n 1 252 GLU n 1 253 ASP n 1 254 ALA n 1 255 PHE n 1 256 CYS n 1 257 ILE n 1 258 GLY n 1 259 MET n 1 260 LYS n 1 261 ALA n 1 262 ILE n 1 263 THR n 1 264 LEU n 1 265 LYS n 1 266 ASN n 1 267 ILE n 1 268 TYR n 1 269 GLU n 1 270 SER n 1 271 LEU n 1 272 LYS n 1 273 ASP n 1 274 MET n 1 275 LYS n 1 276 TYR n 1 277 LYS n 1 278 VAL n 1 279 GLU n 1 280 VAL n 1 281 PRO n 1 282 GLU n 1 283 GLU n 1 284 ILE n 1 285 ALA n 1 286 ARG n 1 287 LYS n 1 288 ALA n 1 289 ARG n 1 290 LYS n 1 291 ALA n 1 292 ILE n 1 293 GLU n 1 294 ARG n 1 295 MET n 1 296 LEU n 1 297 GLU n 1 298 MET n 1 299 SER n 1 300 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 300 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nadA, PH0013' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 70601 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DYA 'L-peptide linking' n DIDEHYDROASPARTATE ? 'C4 H5 N O4' 131.087 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 MET 156 156 156 MET MET A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 HIS 169 169 169 HIS HIS A . n A 1 170 CYS 170 170 170 CYS CYS A . n A 1 171 TYR 171 171 171 TYR TYR A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 CYS 199 199 199 CYS CYS A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 GLN 204 204 204 GLN GLN A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 MET 216 216 216 MET MET A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 LYS 218 218 218 LYS LYS A . n A 1 219 ARG 219 219 219 ARG ARG A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 CYS 221 221 221 CYS CYS A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 TRP 223 223 223 TRP TRP A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 TRP 226 226 226 TRP TRP A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 MET 234 234 234 MET MET A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 ARG 237 237 237 ARG ARG A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 GLN 244 244 244 GLN GLN A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 PHE 247 247 247 PHE PHE A . n A 1 248 TYR 248 248 248 TYR TYR A . n A 1 249 PRO 249 249 249 PRO PRO A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 CYS 256 256 256 CYS CYS A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 MET 259 259 259 MET MET A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 ASN 266 266 266 ASN ASN A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 TYR 268 268 268 TYR TYR A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 LYS 272 272 272 LYS LYS A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 MET 274 274 274 MET MET A . n A 1 275 LYS 275 275 275 LYS LYS A . n A 1 276 TYR 276 276 276 TYR TYR A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 VAL 278 278 278 VAL VAL A . n A 1 279 GLU 279 279 279 GLU GLU A . n A 1 280 VAL 280 280 280 VAL VAL A . n A 1 281 PRO 281 281 281 PRO PRO A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 ARG 286 286 286 ARG ARG A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 ALA 288 288 288 ALA ALA A . n A 1 289 ARG 289 289 289 ARG ARG A . n A 1 290 LYS 290 290 290 LYS LYS A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 ARG 294 294 294 ARG ARG A . n A 1 295 MET 295 295 295 MET MET A . n A 1 296 LEU 296 296 296 LEU LEU A . n A 1 297 GLU 297 297 297 GLU GLU A . n A 1 298 MET 298 298 298 MET MET A . n A 1 299 SER 299 299 299 SER SER A . n A 1 300 LYS 300 300 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SF4 1 401 1 SF4 SF4 A . C 3 DYA 1 402 1 DYA DRG A . D 4 HOH 1 501 11 HOH HOH A . D 4 HOH 2 502 43 HOH HOH A . D 4 HOH 3 503 5 HOH HOH A . D 4 HOH 4 504 14 HOH HOH A . D 4 HOH 5 505 13 HOH HOH A . D 4 HOH 6 506 22 HOH HOH A . D 4 HOH 7 507 1 HOH HOH A . D 4 HOH 8 508 36 HOH HOH A . D 4 HOH 9 509 50 HOH HOH A . D 4 HOH 10 510 3 HOH HOH A . D 4 HOH 11 511 35 HOH HOH A . D 4 HOH 12 512 6 HOH HOH A . D 4 HOH 13 513 19 HOH HOH A . D 4 HOH 14 514 53 HOH HOH A . D 4 HOH 15 515 21 HOH HOH A . D 4 HOH 16 516 2 HOH HOH A . D 4 HOH 17 517 61 HOH HOH A . D 4 HOH 18 518 9 HOH HOH A . D 4 HOH 19 519 49 HOH HOH A . D 4 HOH 20 520 7 HOH HOH A . D 4 HOH 21 521 18 HOH HOH A . D 4 HOH 22 522 4 HOH HOH A . D 4 HOH 23 523 40 HOH HOH A . D 4 HOH 24 524 8 HOH HOH A . D 4 HOH 25 525 10 HOH HOH A . D 4 HOH 26 526 12 HOH HOH A . D 4 HOH 27 527 37 HOH HOH A . D 4 HOH 28 528 39 HOH HOH A . D 4 HOH 29 529 24 HOH HOH A . D 4 HOH 30 530 26 HOH HOH A . D 4 HOH 31 531 29 HOH HOH A . D 4 HOH 32 532 15 HOH HOH A . D 4 HOH 33 533 25 HOH HOH A . D 4 HOH 34 534 33 HOH HOH A . D 4 HOH 35 535 17 HOH HOH A . D 4 HOH 36 536 48 HOH HOH A . D 4 HOH 37 537 31 HOH HOH A . D 4 HOH 38 538 28 HOH HOH A . D 4 HOH 39 539 27 HOH HOH A . D 4 HOH 40 540 30 HOH HOH A . D 4 HOH 41 541 38 HOH HOH A . D 4 HOH 42 542 44 HOH HOH A . D 4 HOH 43 543 20 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 114.56 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6NSU _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.258 _cell.length_a_esd ? _cell.length_b 52.298 _cell.length_b_esd ? _cell.length_c 53.580 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NSU _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NSU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES, pH 6.5, 12% PEG 20000, 0.2 mM FAD, 5 mM Aspartate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NSU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.15 _reflns.d_resolution_low 48.75 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13168 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.19 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NSU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.15 _refine.ls_d_res_low 48.733 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13170 _refine.ls_number_reflns_R_free 1321 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.16 _refine.ls_percent_reflns_R_free 10.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2142 _refine.ls_R_factor_R_free 0.2477 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2103 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.55 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2375 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 2435 _refine_hist.d_res_high 2.15 _refine_hist.d_res_low 48.733 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2481 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.468 ? 3356 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.393 ? 1562 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 379 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 424 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1317 2.2170 . . 130 1178 88.00 . . . 0.3652 . 0.3230 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2170 2.3179 . . 144 1291 99.00 . . . 0.3321 . 0.2945 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3179 2.4401 . . 152 1338 99.00 . . . 0.3273 . 0.2770 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4401 2.5930 . . 147 1309 99.00 . . . 0.2897 . 0.2621 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5930 2.7932 . . 142 1332 99.00 . . . 0.3208 . 0.2534 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7932 3.0743 . . 152 1328 100.00 . . . 0.2701 . 0.2571 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0743 3.5190 . . 151 1334 100.00 . . . 0.2647 . 0.2151 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5190 4.4331 . . 148 1361 100.00 . . . 0.2139 . 0.1640 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4331 48.7459 . . 155 1378 100.00 . . . 0.1802 . 0.1597 . . . . . . . . . . # _struct.entry_id 6NSU _struct.title 'Crystallographic Capture of Quinolinate Synthase (NadA) from Pyrococcus horikoshii in its Substrates and Product-Bound States' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NSU _struct_keywords.text TRANSFERASE _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NADA_PYRHO _struct_ref.pdbx_db_accession O57767 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDLVEEILRLKEERNAIILAHNYQLPEVQDIADFIGDSLELARRATRVDADVIVFAGVDFMAETAKILNPDKVVLIPSRE ATCAMANMLKVEHILEAKRKYPNAPVVLYVNSTAEAKAYADVTVTSANAVEVVKKLDSDVVIFGPDKNLAHYVAKMTGKK IIPVPSKGHCYVHQKFTLDDVERAKKLHPNAKLMIHPECIPEVQEKADIIASTGGMIKRACEWDEWVVFTEREMVYRLRK LYPQKKFYPAREDAFCIGMKAITLKNIYESLKDMKYKVEVPEEIARKARKAIERMLEMSK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NSU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 300 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O57767 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 300 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 300 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? ARG A 14 ? ASP A 2 ARG A 14 1 ? 13 HELX_P HELX_P2 AA2 LEU A 25 ? ASP A 30 ? LEU A 25 ASP A 30 1 ? 6 HELX_P HELX_P3 AA3 ASP A 37 ? THR A 46 ? ASP A 37 THR A 46 1 ? 10 HELX_P HELX_P4 AA4 VAL A 58 ? ASN A 69 ? VAL A 58 ASN A 69 1 ? 12 HELX_P HELX_P5 AA5 MET A 85 ? LEU A 89 ? MET A 85 LEU A 89 5 ? 5 HELX_P HELX_P6 AA6 LYS A 90 ? TYR A 101 ? LYS A 90 TYR A 101 1 ? 12 HELX_P HELX_P7 AA7 THR A 113 ? ALA A 118 ? THR A 113 ALA A 118 1 ? 6 HELX_P HELX_P8 AA8 ASN A 128 ? LYS A 135 ? ASN A 128 LYS A 135 1 ? 8 HELX_P HELX_P9 AA9 ASP A 146 ? GLY A 158 ? ASP A 146 GLY A 158 1 ? 13 HELX_P HELX_P10 AB1 CYS A 170 ? LYS A 175 ? CYS A 170 LYS A 175 1 ? 6 HELX_P HELX_P11 AB2 THR A 177 ? HIS A 188 ? THR A 177 HIS A 188 1 ? 12 HELX_P HELX_P12 AB3 ILE A 200 ? GLU A 205 ? ILE A 200 GLU A 205 1 ? 6 HELX_P HELX_P13 AB4 SER A 212 ? ALA A 220 ? SER A 212 ALA A 220 1 ? 9 HELX_P HELX_P14 AB5 CYS A 221 ? TRP A 223 ? CYS A 221 TRP A 223 5 ? 3 HELX_P HELX_P15 AB6 ARG A 232 ? TYR A 242 ? ARG A 232 TYR A 242 1 ? 11 HELX_P HELX_P16 AB7 CYS A 256 ? ALA A 261 ? CYS A 256 ALA A 261 1 ? 6 HELX_P HELX_P17 AB8 THR A 263 ? MET A 274 ? THR A 263 MET A 274 1 ? 12 HELX_P HELX_P18 AB9 PRO A 281 ? MET A 298 ? PRO A 281 MET A 298 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 83 SG ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 83 A SF4 401 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc2 metalc ? ? A CYS 170 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 170 A SF4 401 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc3 metalc ? ? A CYS 256 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 256 A SF4 401 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc4 metalc ? ? B SF4 . FE1 ? ? ? 1_555 C DYA . OD1 ? ? A SF4 401 A DYA 402 1_555 ? ? ? ? ? ? ? 1.990 ? ? metalc5 metalc ? ? B SF4 . FE1 ? ? ? 1_555 C DYA . OD2 ? ? A SF4 401 A DYA 402 1_555 ? ? ? ? ? ? ? 2.689 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 83 ? A CYS 83 ? 1_555 FE2 ? B SF4 . ? A SF4 401 ? 1_555 S1 ? B SF4 . ? A SF4 401 ? 1_555 129.6 ? 2 SG ? A CYS 83 ? A CYS 83 ? 1_555 FE2 ? B SF4 . ? A SF4 401 ? 1_555 S3 ? B SF4 . ? A SF4 401 ? 1_555 128.3 ? 3 S1 ? B SF4 . ? A SF4 401 ? 1_555 FE2 ? B SF4 . ? A SF4 401 ? 1_555 S3 ? B SF4 . ? A SF4 401 ? 1_555 90.4 ? 4 SG ? A CYS 83 ? A CYS 83 ? 1_555 FE2 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 116.3 ? 5 S1 ? B SF4 . ? A SF4 401 ? 1_555 FE2 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 90.2 ? 6 S3 ? B SF4 . ? A SF4 401 ? 1_555 FE2 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 90.5 ? 7 SG ? A CYS 170 ? A CYS 170 ? 1_555 FE3 ? B SF4 . ? A SF4 401 ? 1_555 S1 ? B SF4 . ? A SF4 401 ? 1_555 138.3 ? 8 SG ? A CYS 170 ? A CYS 170 ? 1_555 FE3 ? B SF4 . ? A SF4 401 ? 1_555 S2 ? B SF4 . ? A SF4 401 ? 1_555 115.5 ? 9 S1 ? B SF4 . ? A SF4 401 ? 1_555 FE3 ? B SF4 . ? A SF4 401 ? 1_555 S2 ? B SF4 . ? A SF4 401 ? 1_555 90.2 ? 10 SG ? A CYS 170 ? A CYS 170 ? 1_555 FE3 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 119.8 ? 11 S1 ? B SF4 . ? A SF4 401 ? 1_555 FE3 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 90.3 ? 12 S2 ? B SF4 . ? A SF4 401 ? 1_555 FE3 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 90.6 ? 13 SG ? A CYS 256 ? A CYS 256 ? 1_555 FE4 ? B SF4 . ? A SF4 401 ? 1_555 S1 ? B SF4 . ? A SF4 401 ? 1_555 124.5 ? 14 SG ? A CYS 256 ? A CYS 256 ? 1_555 FE4 ? B SF4 . ? A SF4 401 ? 1_555 S2 ? B SF4 . ? A SF4 401 ? 1_555 128.5 ? 15 S1 ? B SF4 . ? A SF4 401 ? 1_555 FE4 ? B SF4 . ? A SF4 401 ? 1_555 S2 ? B SF4 . ? A SF4 401 ? 1_555 90.2 ? 16 SG ? A CYS 256 ? A CYS 256 ? 1_555 FE4 ? B SF4 . ? A SF4 401 ? 1_555 S3 ? B SF4 . ? A SF4 401 ? 1_555 122.2 ? 17 S1 ? B SF4 . ? A SF4 401 ? 1_555 FE4 ? B SF4 . ? A SF4 401 ? 1_555 S3 ? B SF4 . ? A SF4 401 ? 1_555 90.3 ? 18 S2 ? B SF4 . ? A SF4 401 ? 1_555 FE4 ? B SF4 . ? A SF4 401 ? 1_555 S3 ? B SF4 . ? A SF4 401 ? 1_555 90.2 ? 19 OD1 ? C DYA . ? A DYA 402 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 S2 ? B SF4 . ? A SF4 401 ? 1_555 132.5 ? 20 OD1 ? C DYA . ? A DYA 402 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 S3 ? B SF4 . ? A SF4 401 ? 1_555 104.3 ? 21 S2 ? B SF4 . ? A SF4 401 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 S3 ? B SF4 . ? A SF4 401 ? 1_555 90.1 ? 22 OD1 ? C DYA . ? A DYA 402 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 133.3 ? 23 S2 ? B SF4 . ? A SF4 401 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 90.5 ? 24 S3 ? B SF4 . ? A SF4 401 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 S4 ? B SF4 . ? A SF4 401 ? 1_555 90.5 ? 25 OD1 ? C DYA . ? A DYA 402 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 OD2 ? C DYA . ? A DYA 402 ? 1_555 50.5 ? 26 S2 ? B SF4 . ? A SF4 401 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 OD2 ? C DYA . ? A DYA 402 ? 1_555 134.3 ? 27 S3 ? B SF4 . ? A SF4 401 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 OD2 ? C DYA . ? A DYA 402 ? 1_555 135.5 ? 28 S4 ? B SF4 . ? A SF4 401 ? 1_555 FE1 ? B SF4 . ? A SF4 401 ? 1_555 OD2 ? C DYA . ? A DYA 402 ? 1_555 88.2 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 144 A . ? GLY 144 A PRO 145 A ? PRO 145 A 1 -0.80 2 VAL 164 A . ? VAL 164 A PRO 165 A ? PRO 165 A 1 -0.29 3 LYS 275 A . ? LYS 275 A TYR 276 A ? TYR 276 A 1 -3.97 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 34 ? GLY A 36 ? PHE A 34 GLY A 36 AA1 2 ALA A 16 ? HIS A 21 ? ALA A 16 HIS A 21 AA1 3 VAL A 52 ? ALA A 56 ? VAL A 52 ALA A 56 AA1 4 VAL A 73 ? LEU A 75 ? VAL A 73 LEU A 75 AA2 1 VAL A 122 ? VAL A 124 ? VAL A 122 VAL A 124 AA2 2 VAL A 106 ? TYR A 109 ? VAL A 106 TYR A 109 AA2 3 VAL A 140 ? GLY A 144 ? VAL A 140 GLY A 144 AA2 4 LYS A 160 ? PRO A 163 ? LYS A 160 PRO A 163 AA3 1 ILE A 209 ? ILE A 210 ? ILE A 209 ILE A 210 AA3 2 LYS A 192 ? ILE A 195 ? LYS A 192 ILE A 195 AA3 3 GLU A 225 ? PHE A 229 ? GLU A 225 PHE A 229 AA3 4 LYS A 246 ? PRO A 249 ? LYS A 246 PRO A 249 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 34 ? O PHE A 34 N ALA A 20 ? N ALA A 20 AA1 2 3 N LEU A 19 ? N LEU A 19 O ALA A 56 ? O ALA A 56 AA1 3 4 N ILE A 53 ? N ILE A 53 O LEU A 75 ? O LEU A 75 AA2 1 2 O VAL A 124 ? O VAL A 124 N LEU A 108 ? N LEU A 108 AA2 2 3 N TYR A 109 ? N TYR A 109 O GLY A 144 ? O GLY A 144 AA2 3 4 N VAL A 141 ? N VAL A 141 O ILE A 162 ? O ILE A 162 AA3 1 2 O ILE A 209 ? O ILE A 209 N LEU A 193 ? N LEU A 193 AA3 2 3 N MET A 194 ? N MET A 194 O PHE A 229 ? O PHE A 229 AA3 3 4 N VAL A 228 ? N VAL A 228 O TYR A 248 ? O TYR A 248 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SF4 401 ? 5 'binding site for residue SF4 A 401' AC2 Software A DYA 402 ? 11 'binding site for residue DYA A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 83 ? CYS A 83 . ? 1_555 ? 2 AC1 5 ASN A 111 ? ASN A 111 . ? 1_555 ? 3 AC1 5 CYS A 170 ? CYS A 170 . ? 1_555 ? 4 AC1 5 CYS A 256 ? CYS A 256 . ? 1_555 ? 5 AC1 5 DYA C . ? DYA A 402 . ? 1_555 ? 6 AC2 11 HIS A 21 ? HIS A 21 . ? 1_555 ? 7 AC2 11 TYR A 23 ? TYR A 23 . ? 1_555 ? 8 AC2 11 ASP A 37 ? ASP A 37 . ? 1_555 ? 9 AC2 11 TYR A 109 ? TYR A 109 . ? 1_555 ? 10 AC2 11 ASN A 111 ? ASN A 111 . ? 1_555 ? 11 AC2 11 SER A 126 ? SER A 126 . ? 1_555 ? 12 AC2 11 HIS A 196 ? HIS A 196 . ? 1_555 ? 13 AC2 11 GLU A 198 ? GLU A 198 . ? 1_555 ? 14 AC2 11 SER A 212 ? SER A 212 . ? 1_555 ? 15 AC2 11 THR A 213 ? THR A 213 . ? 1_555 ? 16 AC2 11 SF4 B . ? SF4 A 401 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 111 ? ? -67.67 75.69 2 1 PRO A 165 ? ? -78.26 -168.78 3 1 PHE A 229 ? ? -100.58 74.97 4 1 THR A 230 ? ? -161.80 -167.31 5 1 MET A 298 ? ? -97.71 59.94 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 4.6851 10.3106 85.3774 0.5183 0.5813 0.6772 0.1228 0.0987 -0.1154 9.9313 2.0121 6.1275 9.8773 7.4305 6.1944 0.6341 -0.8312 1.0260 1.5123 -1.1070 1.8267 -0.0784 -1.7213 0.5040 'X-RAY DIFFRACTION' 2 ? refined 11.9926 10.1830 73.7244 0.2723 0.2011 0.3590 0.0364 -0.0513 -0.0193 2.3191 2.7260 7.3515 -2.2262 1.4398 -2.4420 -0.1370 -0.1175 -0.0593 0.1381 -0.0391 -0.0189 -0.6535 -0.5047 0.1384 'X-RAY DIFFRACTION' 3 ? refined 22.6184 7.9771 76.1057 0.2768 0.2291 0.3467 0.0467 -0.0728 0.0096 6.9607 8.5034 8.2551 2.2807 0.0038 2.0264 -0.1949 0.0225 0.7522 -0.0607 0.1234 -0.5312 -0.8197 0.3805 0.0617 'X-RAY DIFFRACTION' 4 ? refined 40.4318 -2.9519 62.9697 0.2685 0.3648 0.3974 0.0307 -0.0636 0.0733 5.5180 8.1130 6.9673 4.1034 -5.9169 -2.6000 -0.1614 -0.4467 -0.9130 0.5411 -0.0474 -0.3477 0.0738 0.6757 0.2616 'X-RAY DIFFRACTION' 5 ? refined 36.0043 7.7063 62.2159 0.3098 0.5810 0.4486 -0.0285 -0.1163 -0.0967 3.2751 9.7437 4.3455 1.3976 -2.0018 -0.5114 -0.0545 -0.7576 0.8653 0.3853 -0.4899 0.3582 -0.4382 0.2780 0.5102 'X-RAY DIFFRACTION' 6 ? refined 30.4904 1.4283 55.2952 0.2763 0.3231 0.4272 0.0574 0.0407 -0.0187 9.3480 6.9786 8.3241 -3.1480 6.6704 -6.8399 -0.2183 -0.5062 0.3909 -0.1915 0.2538 -0.1313 -0.1099 -0.4747 -0.0824 'X-RAY DIFFRACTION' 7 ? refined 15.8952 6.4899 53.2536 0.3044 0.2135 0.1893 -0.0319 -0.0134 -0.0030 6.4970 2.5295 1.9206 -2.1677 -0.1162 -0.7106 0.1283 0.5319 0.1607 -0.3599 -0.1496 -0.1332 -0.0039 -0.0220 0.0340 'X-RAY DIFFRACTION' 8 ? refined 13.6811 1.3398 83.2802 0.3817 0.1939 0.3370 0.0012 0.0145 0.0590 5.5706 6.0487 5.1304 -3.8634 1.4377 1.0548 0.1959 -0.3466 -0.5149 0.5509 -0.0694 0.6010 0.4800 -0.1559 -0.1476 'X-RAY DIFFRACTION' 9 ? refined 37.9069 4.7615 79.3498 0.5560 0.9709 0.6628 0.0278 -0.0403 -0.2457 7.5190 2.0022 2.0032 8.7791 -7.0687 -4.2864 -0.2573 -1.0095 -0.4364 0.2538 0.5189 -1.3797 -0.1059 2.7847 -0.2269 'X-RAY DIFFRACTION' 10 ? refined 36.6581 14.5498 69.0337 0.6047 0.8232 0.6661 0.0042 -0.2442 -0.2824 8.1346 5.3504 3.3886 -0.4779 0.4563 -4.2566 -0.6694 -0.2237 1.0563 0.3054 0.2209 -0.1574 -1.1214 1.4316 0.4364 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 2:13)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 14:36)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(chain A and resid 37:85)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(chain A and resid 86:108)' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(chain A and resid 109:142)' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '(chain A and resid 143:151)' 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? '(chain A and resid 152:261)' 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? '(chain A and resid 262:279)' 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? '(chain A and resid 280:288)' 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(chain A and resid 289:299)' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 300 ? A LYS 300 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DYA N N N N 88 DYA CA C N N 89 DYA CB C N N 90 DYA CG C N N 91 DYA OD1 O N N 92 DYA OD2 O N N 93 DYA C C N N 94 DYA O O N N 95 DYA OXT O N N 96 DYA H H N N 97 DYA H2 H N N 98 DYA HB H N N 99 DYA HD1 H N N 100 DYA HXT H N N 101 GLN N N N N 102 GLN CA C N S 103 GLN C C N N 104 GLN O O N N 105 GLN CB C N N 106 GLN CG C N N 107 GLN CD C N N 108 GLN OE1 O N N 109 GLN NE2 N N N 110 GLN OXT O N N 111 GLN H H N N 112 GLN H2 H N N 113 GLN HA H N N 114 GLN HB2 H N N 115 GLN HB3 H N N 116 GLN HG2 H N N 117 GLN HG3 H N N 118 GLN HE21 H N N 119 GLN HE22 H N N 120 GLN HXT H N N 121 GLU N N N N 122 GLU CA C N S 123 GLU C C N N 124 GLU O O N N 125 GLU CB C N N 126 GLU CG C N N 127 GLU CD C N N 128 GLU OE1 O N N 129 GLU OE2 O N N 130 GLU OXT O N N 131 GLU H H N N 132 GLU H2 H N N 133 GLU HA H N N 134 GLU HB2 H N N 135 GLU HB3 H N N 136 GLU HG2 H N N 137 GLU HG3 H N N 138 GLU HE2 H N N 139 GLU HXT H N N 140 GLY N N N N 141 GLY CA C N N 142 GLY C C N N 143 GLY O O N N 144 GLY OXT O N N 145 GLY H H N N 146 GLY H2 H N N 147 GLY HA2 H N N 148 GLY HA3 H N N 149 GLY HXT H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 SF4 FE1 FE N N 318 SF4 FE2 FE N N 319 SF4 FE3 FE N N 320 SF4 FE4 FE N N 321 SF4 S1 S N N 322 SF4 S2 S N N 323 SF4 S3 S N N 324 SF4 S4 S N N 325 THR N N N N 326 THR CA C N S 327 THR C C N N 328 THR O O N N 329 THR CB C N R 330 THR OG1 O N N 331 THR CG2 C N N 332 THR OXT O N N 333 THR H H N N 334 THR H2 H N N 335 THR HA H N N 336 THR HB H N N 337 THR HG1 H N N 338 THR HG21 H N N 339 THR HG22 H N N 340 THR HG23 H N N 341 THR HXT H N N 342 TRP N N N N 343 TRP CA C N S 344 TRP C C N N 345 TRP O O N N 346 TRP CB C N N 347 TRP CG C Y N 348 TRP CD1 C Y N 349 TRP CD2 C Y N 350 TRP NE1 N Y N 351 TRP CE2 C Y N 352 TRP CE3 C Y N 353 TRP CZ2 C Y N 354 TRP CZ3 C Y N 355 TRP CH2 C Y N 356 TRP OXT O N N 357 TRP H H N N 358 TRP H2 H N N 359 TRP HA H N N 360 TRP HB2 H N N 361 TRP HB3 H N N 362 TRP HD1 H N N 363 TRP HE1 H N N 364 TRP HE3 H N N 365 TRP HZ2 H N N 366 TRP HZ3 H N N 367 TRP HH2 H N N 368 TRP HXT H N N 369 TYR N N N N 370 TYR CA C N S 371 TYR C C N N 372 TYR O O N N 373 TYR CB C N N 374 TYR CG C Y N 375 TYR CD1 C Y N 376 TYR CD2 C Y N 377 TYR CE1 C Y N 378 TYR CE2 C Y N 379 TYR CZ C Y N 380 TYR OH O N N 381 TYR OXT O N N 382 TYR H H N N 383 TYR H2 H N N 384 TYR HA H N N 385 TYR HB2 H N N 386 TYR HB3 H N N 387 TYR HD1 H N N 388 TYR HD2 H N N 389 TYR HE1 H N N 390 TYR HE2 H N N 391 TYR HH H N N 392 TYR HXT H N N 393 VAL N N N N 394 VAL CA C N S 395 VAL C C N N 396 VAL O O N N 397 VAL CB C N N 398 VAL CG1 C N N 399 VAL CG2 C N N 400 VAL OXT O N N 401 VAL H H N N 402 VAL H2 H N N 403 VAL HA H N N 404 VAL HB H N N 405 VAL HG11 H N N 406 VAL HG12 H N N 407 VAL HG13 H N N 408 VAL HG21 H N N 409 VAL HG22 H N N 410 VAL HG23 H N N 411 VAL HXT H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DYA N CA sing N N 83 DYA CA CB doub N Z 84 DYA CA C sing N N 85 DYA CB CG sing N N 86 DYA CG OD1 sing N N 87 DYA CG OD2 doub N N 88 DYA C O doub N N 89 DYA C OXT sing N N 90 DYA N H sing N N 91 DYA N H2 sing N N 92 DYA CB HB sing N N 93 DYA OD1 HD1 sing N N 94 DYA OXT HXT sing N N 95 GLN N CA sing N N 96 GLN N H sing N N 97 GLN N H2 sing N N 98 GLN CA C sing N N 99 GLN CA CB sing N N 100 GLN CA HA sing N N 101 GLN C O doub N N 102 GLN C OXT sing N N 103 GLN CB CG sing N N 104 GLN CB HB2 sing N N 105 GLN CB HB3 sing N N 106 GLN CG CD sing N N 107 GLN CG HG2 sing N N 108 GLN CG HG3 sing N N 109 GLN CD OE1 doub N N 110 GLN CD NE2 sing N N 111 GLN NE2 HE21 sing N N 112 GLN NE2 HE22 sing N N 113 GLN OXT HXT sing N N 114 GLU N CA sing N N 115 GLU N H sing N N 116 GLU N H2 sing N N 117 GLU CA C sing N N 118 GLU CA CB sing N N 119 GLU CA HA sing N N 120 GLU C O doub N N 121 GLU C OXT sing N N 122 GLU CB CG sing N N 123 GLU CB HB2 sing N N 124 GLU CB HB3 sing N N 125 GLU CG CD sing N N 126 GLU CG HG2 sing N N 127 GLU CG HG3 sing N N 128 GLU CD OE1 doub N N 129 GLU CD OE2 sing N N 130 GLU OE2 HE2 sing N N 131 GLU OXT HXT sing N N 132 GLY N CA sing N N 133 GLY N H sing N N 134 GLY N H2 sing N N 135 GLY CA C sing N N 136 GLY CA HA2 sing N N 137 GLY CA HA3 sing N N 138 GLY C O doub N N 139 GLY C OXT sing N N 140 GLY OXT HXT sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 SF4 FE1 S2 sing N N 303 SF4 FE1 S3 sing N N 304 SF4 FE1 S4 sing N N 305 SF4 FE2 S1 sing N N 306 SF4 FE2 S3 sing N N 307 SF4 FE2 S4 sing N N 308 SF4 FE3 S1 sing N N 309 SF4 FE3 S2 sing N N 310 SF4 FE3 S4 sing N N 311 SF4 FE4 S1 sing N N 312 SF4 FE4 S2 sing N N 313 SF4 FE4 S3 sing N N 314 THR N CA sing N N 315 THR N H sing N N 316 THR N H2 sing N N 317 THR CA C sing N N 318 THR CA CB sing N N 319 THR CA HA sing N N 320 THR C O doub N N 321 THR C OXT sing N N 322 THR CB OG1 sing N N 323 THR CB CG2 sing N N 324 THR CB HB sing N N 325 THR OG1 HG1 sing N N 326 THR CG2 HG21 sing N N 327 THR CG2 HG22 sing N N 328 THR CG2 HG23 sing N N 329 THR OXT HXT sing N N 330 TRP N CA sing N N 331 TRP N H sing N N 332 TRP N H2 sing N N 333 TRP CA C sing N N 334 TRP CA CB sing N N 335 TRP CA HA sing N N 336 TRP C O doub N N 337 TRP C OXT sing N N 338 TRP CB CG sing N N 339 TRP CB HB2 sing N N 340 TRP CB HB3 sing N N 341 TRP CG CD1 doub Y N 342 TRP CG CD2 sing Y N 343 TRP CD1 NE1 sing Y N 344 TRP CD1 HD1 sing N N 345 TRP CD2 CE2 doub Y N 346 TRP CD2 CE3 sing Y N 347 TRP NE1 CE2 sing Y N 348 TRP NE1 HE1 sing N N 349 TRP CE2 CZ2 sing Y N 350 TRP CE3 CZ3 doub Y N 351 TRP CE3 HE3 sing N N 352 TRP CZ2 CH2 doub Y N 353 TRP CZ2 HZ2 sing N N 354 TRP CZ3 CH2 sing Y N 355 TRP CZ3 HZ3 sing N N 356 TRP CH2 HH2 sing N N 357 TRP OXT HXT sing N N 358 TYR N CA sing N N 359 TYR N H sing N N 360 TYR N H2 sing N N 361 TYR CA C sing N N 362 TYR CA CB sing N N 363 TYR CA HA sing N N 364 TYR C O doub N N 365 TYR C OXT sing N N 366 TYR CB CG sing N N 367 TYR CB HB2 sing N N 368 TYR CB HB3 sing N N 369 TYR CG CD1 doub Y N 370 TYR CG CD2 sing Y N 371 TYR CD1 CE1 sing Y N 372 TYR CD1 HD1 sing N N 373 TYR CD2 CE2 doub Y N 374 TYR CD2 HD2 sing N N 375 TYR CE1 CZ doub Y N 376 TYR CE1 HE1 sing N N 377 TYR CE2 CZ sing Y N 378 TYR CE2 HE2 sing N N 379 TYR CZ OH sing N N 380 TYR OH HH sing N N 381 TYR OXT HXT sing N N 382 VAL N CA sing N N 383 VAL N H sing N N 384 VAL N H2 sing N N 385 VAL CA C sing N N 386 VAL CA CB sing N N 387 VAL CA HA sing N N 388 VAL C O doub N N 389 VAL C OXT sing N N 390 VAL CB CG1 sing N N 391 VAL CB CG2 sing N N 392 VAL CB HB sing N N 393 VAL CG1 HG11 sing N N 394 VAL CG1 HG12 sing N N 395 VAL CG1 HG13 sing N N 396 VAL CG2 HG21 sing N N 397 VAL CG2 HG22 sing N N 398 VAL CG2 HG23 sing N N 399 VAL OXT HXT sing N N 400 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' 'MCB - 1716686' 1 'National Science Foundation (NSF, United States)' 'United States' 'CHE - 1659679' 2 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' 'United States' 'GM - 122595' 3 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 4 # _atom_sites.entry_id 6NSU _atom_sites.fract_transf_matrix[1][1] 0.021160 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009669 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019121 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020520 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_