data_6NXZ # _entry.id 6NXZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6NXZ pdb_00006nxz 10.2210/pdb6nxz/pdb WWPDB D_1000239475 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6NXZ _pdbx_database_status.recvd_initial_deposition_date 2019-02-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yachnin, B.J.' 1 0000-0001-6812-6329 'Berghuis, A.M.' 2 0000-0002-2663-025X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Omega' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2470-1343 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 10056 _citation.page_last 10069 _citation.title ;Structure-Based Design of Dimeric Bisbenzimidazole Inhibitors to an Emergent Trimethoprim-Resistant Type II Dihydrofolate Reductase Guides the Design of Monomeric Analogues. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsomega.9b00640 _citation.pdbx_database_id_PubMed 31460098 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Toulouse, J.L.' 1 ? primary 'Yachnin, B.J.' 2 ? primary 'Ruediger, E.H.' 3 ? primary 'Deon, D.' 4 ? primary 'Gagnon, M.' 5 ? primary 'Saint-Jacques, K.' 6 ? primary 'Ebert, M.C.C.J.C.' 7 ? primary 'Forge, D.' 8 ? primary 'Bastien, D.' 9 ? primary 'Colin, D.Y.' 10 ? primary 'Vanden Eynde, J.J.' 11 ? primary 'Marinier, A.' 12 ? primary 'Berghuis, A.M.' 13 ? primary 'Pelletier, J.N.' 14 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6NXZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.617 _cell.length_a_esd ? _cell.length_b 67.617 _cell.length_b_esd ? _cell.length_c 51.977 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6NXZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dihydrofolate reductase type 2' 6733.513 1 1.5.1.3 ? ? ? 2 non-polymer syn '2-[4-[(2~{R})-4-[4-(6-carboxy-1~{H}-benzimidazol-2-yl)phenoxy]-2-oxidanyl-butoxy]phenyl]-1~{H}-benzimidazole-5-carboxylic acid' 578.571 1 ? ? ? ? 3 non-polymer syn '(4R)-2-METHYLPENTANE-2,4-DIOL' 118.174 2 ? ? ? ? 4 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 5 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dihydrofolate reductase type II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VFPSDATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN _entity_poly.pdbx_seq_one_letter_code_can VFPSDATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PHE n 1 3 PRO n 1 4 SER n 1 5 ASP n 1 6 ALA n 1 7 THR n 1 8 PHE n 1 9 GLY n 1 10 MET n 1 11 GLY n 1 12 ASP n 1 13 ARG n 1 14 VAL n 1 15 ARG n 1 16 LYS n 1 17 LYS n 1 18 SER n 1 19 GLY n 1 20 ALA n 1 21 ALA n 1 22 TRP n 1 23 GLN n 1 24 GLY n 1 25 GLN n 1 26 ILE n 1 27 VAL n 1 28 GLY n 1 29 TRP n 1 30 TYR n 1 31 CYS n 1 32 THR n 1 33 ASN n 1 34 LEU n 1 35 THR n 1 36 PRO n 1 37 GLU n 1 38 GLY n 1 39 TYR n 1 40 ALA n 1 41 VAL n 1 42 GLU n 1 43 SER n 1 44 GLU n 1 45 ALA n 1 46 HIS n 1 47 PRO n 1 48 GLY n 1 49 SER n 1 50 VAL n 1 51 GLN n 1 52 ILE n 1 53 TYR n 1 54 PRO n 1 55 VAL n 1 56 ALA n 1 57 ALA n 1 58 LEU n 1 59 GLU n 1 60 ARG n 1 61 ILE n 1 62 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 62 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511698 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant pRep4 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pQE32 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DYR21_ECOLX _struct_ref.pdbx_db_accession P00383 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6NXZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00383 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 17 _struct_ref_seq.pdbx_auth_seq_align_end 78 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6NXZ _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 5 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00383 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 21 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 21 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 D49 non-polymer . '2-[4-[(2~{R})-4-[4-(6-carboxy-1~{H}-benzimidazol-2-yl)phenoxy]-2-oxidanyl-butoxy]phenyl]-1~{H}-benzimidazole-5-carboxylic acid' ? 'C32 H26 N4 O7' 578.571 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MRD non-polymer . '(4R)-2-METHYLPENTANE-2,4-DIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6NXZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;The protein concentration was adjusted from 13.3 mg/ml to 10 mg/mL by addition of a final concentration of 25% MPD. Reservoirs were prepared in Eppendorf tubes with 100mM Tris-Cl pH 8.0 55% MPD in a Greiner 24-well hanging-drop crystallization plate. On a siliconized glass cover slip (Hampton Research), 2.0 uL of protein solution were combined with 2.0 uL of the reservoir solution. The plate was incubated at 277 K, and crystals were obtained after 3-4 days. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'VariMax HF' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6NXZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.750 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6007 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 79.200 _reflns.pdbx_Rmerge_I_obs 0.204 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.235 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.205 _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.750 1.780 ? ? ? ? ? ? 153 48.700 ? ? ? ? ? ? ? ? ? ? ? ? ? 1.500 ? 0.895 ? ? ? ? ? 1 1 0.697 ? 1.780 1.810 ? ? ? ? ? ? 186 59.600 ? ? ? ? ? ? ? ? ? ? ? ? ? 2.100 ? 0.771 ? ? ? 0.637 ? 2 1 0.896 ? 1.810 1.850 ? ? ? ? ? ? 236 80.000 ? ? ? ? ? ? ? ? ? ? ? ? ? 4.200 ? 0.804 ? ? ? 0.645 ? 3 1 0.215 ? 1.850 1.890 ? ? ? ? ? ? 304 96.800 ? ? ? ? ? ? ? ? ? ? ? ? ? 6.800 ? 0.899 ? ? ? 0.361 ? 4 1 0.583 ? 1.890 1.930 ? ? ? ? ? ? 309 99.000 ? ? ? ? 0.868 ? ? ? ? ? ? ? ? 15.600 ? 0.992 ? ? 0.897 0.212 ? 5 1 0.771 ? 1.930 1.970 ? ? ? ? ? ? 307 99.700 ? ? ? ? 0.770 ? ? ? ? ? ? ? ? 26.300 ? 1.035 ? ? 0.785 0.148 ? 6 1 0.901 ? 1.970 2.020 ? ? ? ? ? ? 319 100.000 ? ? ? ? 0.609 ? ? ? ? ? ? ? ? 40.200 ? 1.070 ? ? 0.616 0.094 ? 7 1 0.966 ? 2.020 2.070 ? ? ? ? ? ? 315 100.000 ? ? ? ? 0.504 ? ? ? ? ? ? ? ? 53.400 ? 1.105 ? ? 0.509 0.068 ? 8 1 0.989 ? 2.070 2.140 ? ? ? ? ? ? 312 100.000 ? ? ? ? 0.490 ? ? ? ? ? ? ? ? 64.900 ? 1.104 ? ? 0.494 0.060 ? 9 1 0.988 ? 2.140 2.200 ? ? ? ? ? ? 311 100.000 ? ? ? ? 0.436 ? ? ? ? ? ? ? ? 75.900 ? 1.130 ? ? 0.439 0.050 ? 10 1 0.994 ? 2.200 2.280 ? ? ? ? ? ? 316 100.000 ? ? ? ? 0.398 ? ? ? ? ? ? ? ? 87.500 ? 1.127 ? ? 0.401 0.042 ? 11 1 0.996 ? 2.280 2.380 ? ? ? ? ? ? 315 100.000 ? ? ? ? 0.410 ? ? ? ? ? ? ? ? 99.400 ? 1.150 ? ? 0.413 0.041 ? 12 1 0.996 ? 2.380 2.480 ? ? ? ? ? ? 317 100.000 ? ? ? ? 0.379 ? ? ? ? ? ? ? ? 112.500 ? 1.160 ? ? 0.381 0.036 ? 13 1 0.996 ? 2.480 2.610 ? ? ? ? ? ? 317 100.000 ? ? ? ? 0.371 ? ? ? ? ? ? ? ? 120.600 ? 1.126 ? ? 0.373 0.034 ? 14 1 0.997 ? 2.610 2.780 ? ? ? ? ? ? 309 100.000 ? ? ? ? 0.312 ? ? ? ? ? ? ? ? 128.100 ? 1.174 ? ? 0.313 0.027 ? 15 1 0.998 ? 2.780 2.990 ? ? ? ? ? ? 323 100.000 ? ? ? ? 0.245 ? ? ? ? ? ? ? ? 130.000 ? 1.182 ? ? 0.245 0.021 ? 16 1 0.999 ? 2.990 3.290 ? ? ? ? ? ? 329 100.000 ? ? ? ? 0.182 ? ? ? ? ? ? ? ? 130.200 ? 1.265 ? ? 0.183 0.016 ? 17 1 0.999 ? 3.290 3.770 ? ? ? ? ? ? 326 100.000 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 130.300 ? 1.360 ? ? 0.151 0.013 ? 18 1 0.999 ? 3.770 4.750 ? ? ? ? ? ? 337 100.000 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? 127.800 ? 1.406 ? ? 0.126 0.011 ? 19 1 1.000 ? 4.750 50.000 ? ? ? ? ? ? 366 99.200 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 116.500 ? 1.616 ? ? 0.151 0.014 ? 20 1 0.999 ? # _refine.aniso_B[1][1] 0.1200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.1200 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.2500 _refine.B_iso_max 110.200 _refine.B_iso_mean 21.0630 _refine.B_iso_min 11.820 _refine.correlation_coeff_Fo_to_Fc 0.9530 _refine.correlation_coeff_Fo_to_Fc_free 0.9650 _refine.details ;Authors state that inhibitor D49 is partially modelled at the active site. Binding of the ligand has been confirmed biochemically, and ligand disorder outside of the pore center has been observed for other known ligands. More details can be found in the primary citation. ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6NXZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7500 _refine.ls_d_res_low 47.8600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5681 _refine.ls_number_reflns_R_free 319 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.2700 _refine.ls_percent_reflns_R_free 5.3000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1785 _refine.ls_R_factor_R_free 0.2082 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1768 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2RH2 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1210 _refine.pdbx_overall_ESU_R_Free 0.1140 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.7230 _refine.overall_SU_ML 0.0810 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7500 _refine_hist.d_res_low 47.8600 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 60 _refine_hist.number_atoms_total 504 _refine_hist.pdbx_number_residues_total 56 _refine_hist.pdbx_B_iso_mean_ligand 62.92 _refine_hist.pdbx_B_iso_mean_solvent 34.25 _refine_hist.pdbx_number_atoms_protein 418 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 0.019 461 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 440 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.061 1.982 626 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.947 3.000 1008 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.246 5.000 57 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.412 23.684 19 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.031 15.000 69 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.721 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.111 0.200 68 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.021 507 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 102 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.7480 _refine_ls_shell.d_res_low 1.7940 _refine_ls_shell.number_reflns_all 225 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 16 _refine_ls_shell.number_reflns_R_work 209 _refine_ls_shell.percent_reflns_obs 49.6700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3500 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.5940 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6NXZ _struct.title 'Crystal structure of trimethoprim-resistant type II dihydrofolate reductase in complex with a bisbenzimidazole inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6NXZ _struct_keywords.text 'antibiotic resistance; selective inhibitor; R67 DHFR; SH3-like barrel, ANTIBIOTIC, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 50 ? PRO A 54 ? VAL A 66 PRO A 70 AA1 2 GLY A 38 ? SER A 43 ? GLY A 54 SER A 59 AA1 3 GLN A 23 ? TYR A 30 ? GLN A 39 TYR A 46 AA1 4 ARG A 13 ? LYS A 16 ? ARG A 29 LYS A 32 AA1 5 LEU A 58 ? ARG A 60 ? LEU A 74 ARG A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 51 ? O GLN A 67 N VAL A 41 ? N VAL A 57 AA1 2 3 O ALA A 40 ? O ALA A 56 N VAL A 27 ? N VAL A 43 AA1 3 4 O GLY A 24 ? O GLY A 40 N VAL A 14 ? N VAL A 30 AA1 4 5 N ARG A 15 ? N ARG A 31 O GLU A 59 ? O GLU A 75 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A D49 101 ? 6 'binding site for residue D49 A 101' AC2 Software A MRD 102 ? 4 'binding site for residue MRD A 102' AC3 Software A MRD 103 ? 5 'binding site for residue MRD A 103' AC4 Software A PO4 104 ? 8 'binding site for residue PO4 A 104' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 VAL A 50 ? VAL A 66 . ? 1_555 ? 2 AC1 6 GLN A 51 ? GLN A 67 . ? 1_555 ? 3 AC1 6 GLN A 51 ? GLN A 67 . ? 10_555 ? 4 AC1 6 ILE A 52 ? ILE A 68 . ? 1_555 ? 5 AC1 6 ILE A 52 ? ILE A 68 . ? 10_555 ? 6 AC1 6 HOH F . ? HOH A 249 . ? 1_555 ? 7 AC2 4 GLY A 19 ? GLY A 35 . ? 3_545 ? 8 AC2 4 ASN A 33 ? ASN A 49 . ? 1_555 ? 9 AC2 4 LEU A 34 ? LEU A 50 . ? 6_545 ? 10 AC2 4 LEU A 34 ? LEU A 50 . ? 1_555 ? 11 AC3 5 ALA A 6 ? ALA A 22 . ? 1_555 ? 12 AC3 5 GLY A 9 ? GLY A 25 . ? 1_555 ? 13 AC3 5 ASP A 12 ? ASP A 28 . ? 1_555 ? 14 AC3 5 ARG A 60 ? ARG A 76 . ? 5_555 ? 15 AC3 5 ILE A 61 ? ILE A 77 . ? 5_555 ? 16 AC4 8 ARG A 15 ? ARG A 31 . ? 3_545 ? 17 AC4 8 LYS A 16 ? LYS A 32 . ? 3_545 ? 18 AC4 8 LYS A 17 ? LYS A 33 . ? 3_545 ? 19 AC4 8 CYS A 31 ? CYS A 47 . ? 1_555 ? 20 AC4 8 THR A 32 ? THR A 48 . ? 1_555 ? 21 AC4 8 ASN A 33 ? ASN A 49 . ? 1_555 ? 22 AC4 8 GLU A 59 ? GLU A 75 . ? 3_545 ? 23 AC4 8 HOH F . ? HOH A 205 . ? 1_555 ? # _atom_sites.entry_id 6NXZ _atom_sites.fract_transf_matrix[1][1] 0.014789 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014789 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019239 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 17 ? ? ? A . n A 1 2 PHE 2 18 ? ? ? A . n A 1 3 PRO 3 19 ? ? ? A . n A 1 4 SER 4 20 ? ? ? A . n A 1 5 ASP 5 21 ? ? ? A . n A 1 6 ALA 6 22 22 ALA ALA A . n A 1 7 THR 7 23 23 THR THR A . n A 1 8 PHE 8 24 24 PHE PHE A . n A 1 9 GLY 9 25 25 GLY GLY A . n A 1 10 MET 10 26 26 MET MET A . n A 1 11 GLY 11 27 27 GLY GLY A . n A 1 12 ASP 12 28 28 ASP ASP A . n A 1 13 ARG 13 29 29 ARG ARG A . n A 1 14 VAL 14 30 30 VAL VAL A . n A 1 15 ARG 15 31 31 ARG ARG A . n A 1 16 LYS 16 32 32 LYS LYS A . n A 1 17 LYS 17 33 33 LYS LYS A . n A 1 18 SER 18 34 34 SER SER A . n A 1 19 GLY 19 35 35 GLY GLY A . n A 1 20 ALA 20 36 36 ALA ALA A . n A 1 21 ALA 21 37 37 ALA ALA A . n A 1 22 TRP 22 38 38 TRP TRP A . n A 1 23 GLN 23 39 39 GLN GLN A . n A 1 24 GLY 24 40 40 GLY GLY A . n A 1 25 GLN 25 41 41 GLN GLN A . n A 1 26 ILE 26 42 42 ILE ILE A . n A 1 27 VAL 27 43 43 VAL VAL A . n A 1 28 GLY 28 44 44 GLY GLY A . n A 1 29 TRP 29 45 45 TRP TRP A . n A 1 30 TYR 30 46 46 TYR TYR A . n A 1 31 CYS 31 47 47 CYS CYS A . n A 1 32 THR 32 48 48 THR THR A . n A 1 33 ASN 33 49 49 ASN ASN A . n A 1 34 LEU 34 50 50 LEU LEU A . n A 1 35 THR 35 51 51 THR THR A . n A 1 36 PRO 36 52 52 PRO PRO A . n A 1 37 GLU 37 53 53 GLU GLU A . n A 1 38 GLY 38 54 54 GLY GLY A . n A 1 39 TYR 39 55 55 TYR TYR A . n A 1 40 ALA 40 56 56 ALA ALA A . n A 1 41 VAL 41 57 57 VAL VAL A . n A 1 42 GLU 42 58 58 GLU GLU A . n A 1 43 SER 43 59 59 SER SER A . n A 1 44 GLU 44 60 60 GLU GLU A . n A 1 45 ALA 45 61 61 ALA ALA A . n A 1 46 HIS 46 62 62 HIS HIS A . n A 1 47 PRO 47 63 63 PRO PRO A . n A 1 48 GLY 48 64 64 GLY GLY A . n A 1 49 SER 49 65 65 SER SER A . n A 1 50 VAL 50 66 66 VAL VAL A . n A 1 51 GLN 51 67 67 GLN GLN A . n A 1 52 ILE 52 68 68 ILE ILE A . n A 1 53 TYR 53 69 69 TYR TYR A . n A 1 54 PRO 54 70 70 PRO PRO A . n A 1 55 VAL 55 71 71 VAL VAL A . n A 1 56 ALA 56 72 72 ALA ALA A . n A 1 57 ALA 57 73 73 ALA ALA A . n A 1 58 LEU 58 74 74 LEU LEU A . n A 1 59 GLU 59 75 75 GLU GLU A . n A 1 60 ARG 60 76 76 ARG ARG A . n A 1 61 ILE 61 77 77 ILE ILE A . n A 1 62 ASN 62 78 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 D49 1 101 1 D49 D49 A . C 3 MRD 1 102 61 MRD MRD A . D 3 MRD 1 103 62 MRD MRD A . E 4 PO4 1 104 63 PO4 PO4 A . F 5 HOH 1 201 13 HOH HOH A . F 5 HOH 2 202 27 HOH HOH A . F 5 HOH 3 203 29 HOH HOH A . F 5 HOH 4 204 41 HOH HOH A . F 5 HOH 5 205 52 HOH HOH A . F 5 HOH 6 206 7 HOH HOH A . F 5 HOH 7 207 30 HOH HOH A . F 5 HOH 8 208 10 HOH HOH A . F 5 HOH 9 209 26 HOH HOH A . F 5 HOH 10 210 28 HOH HOH A . F 5 HOH 11 211 34 HOH HOH A . F 5 HOH 12 212 6 HOH HOH A . F 5 HOH 13 213 57 HOH HOH A . F 5 HOH 14 214 14 HOH HOH A . F 5 HOH 15 215 12 HOH HOH A . F 5 HOH 16 216 19 HOH HOH A . F 5 HOH 17 217 17 HOH HOH A . F 5 HOH 18 218 3 HOH HOH A . F 5 HOH 19 219 18 HOH HOH A . F 5 HOH 20 220 15 HOH HOH A . F 5 HOH 21 221 56 HOH HOH A . F 5 HOH 22 222 55 HOH HOH A . F 5 HOH 23 223 2 HOH HOH A . F 5 HOH 24 224 42 HOH HOH A . F 5 HOH 25 225 40 HOH HOH A . F 5 HOH 26 226 1 HOH HOH A . F 5 HOH 27 227 31 HOH HOH A . F 5 HOH 28 228 16 HOH HOH A . F 5 HOH 29 229 49 HOH HOH A . F 5 HOH 30 230 5 HOH HOH A . F 5 HOH 31 231 38 HOH HOH A . F 5 HOH 32 232 8 HOH HOH A . F 5 HOH 33 233 45 HOH HOH A . F 5 HOH 34 234 51 HOH HOH A . F 5 HOH 35 235 24 HOH HOH A . F 5 HOH 36 236 35 HOH HOH A . F 5 HOH 37 237 11 HOH HOH A . F 5 HOH 38 238 25 HOH HOH A . F 5 HOH 39 239 21 HOH HOH A . F 5 HOH 40 240 4 HOH HOH A . F 5 HOH 41 241 32 HOH HOH A . F 5 HOH 42 242 46 HOH HOH A . F 5 HOH 43 243 53 HOH HOH A . F 5 HOH 44 244 47 HOH HOH A . F 5 HOH 45 245 23 HOH HOH A . F 5 HOH 46 246 33 HOH HOH A . F 5 HOH 47 247 43 HOH HOH A . F 5 HOH 48 248 54 HOH HOH A . F 5 HOH 49 249 58 HOH HOH A . F 5 HOH 50 250 48 HOH HOH A . F 5 HOH 51 251 44 HOH HOH A . F 5 HOH 52 252 37 HOH HOH A . F 5 HOH 53 253 22 HOH HOH A . F 5 HOH 54 254 20 HOH HOH A . F 5 HOH 55 255 36 HOH HOH A . F 5 HOH 56 256 9 HOH HOH A . F 5 HOH 57 257 50 HOH HOH A . F 5 HOH 58 258 39 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6480 ? 1 MORE -45 ? 1 'SSA (A^2)' 11130 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-05-29 2 'Structure model' 1 1 2019-07-03 3 'Structure model' 1 2 2019-09-11 4 'Structure model' 1 3 2020-01-08 5 'Structure model' 1 4 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation.pdbx_database_id_PubMed' 12 3 'Structure model' '_citation.title' 13 4 'Structure model' '_pdbx_audit_support.funding_organization' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0073 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 47 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 47 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 A _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 47 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 A _pdbx_validate_rmsd_angle.angle_value 120.97 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 6.77 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TRP 45 ? CG ? A TRP 29 CG 2 1 Y 1 A TRP 45 ? CD1 ? A TRP 29 CD1 3 1 Y 1 A TRP 45 ? CD2 ? A TRP 29 CD2 4 1 Y 1 A TRP 45 ? NE1 ? A TRP 29 NE1 5 1 Y 1 A TRP 45 ? CE2 ? A TRP 29 CE2 6 1 Y 1 A TRP 45 ? CE3 ? A TRP 29 CE3 7 1 Y 1 A TRP 45 ? CZ2 ? A TRP 29 CZ2 8 1 Y 1 A TRP 45 ? CZ3 ? A TRP 29 CZ3 9 1 Y 1 A TRP 45 ? CH2 ? A TRP 29 CH2 10 1 N 1 A D49 101 ? C1 ? B D49 1 C1 11 1 N 1 A D49 101 ? C2 ? B D49 1 C2 12 1 N 1 A D49 101 ? C3 ? B D49 1 C3 13 1 N 1 A D49 101 ? C4 ? B D49 1 C4 14 1 N 1 A D49 101 ? C5 ? B D49 1 C5 15 1 N 1 A D49 101 ? C13 ? B D49 1 C13 16 1 N 1 A D49 101 ? N1 ? B D49 1 N1 17 1 N 1 A D49 101 ? C7 ? B D49 1 C7 18 1 N 1 A D49 101 ? C10 ? B D49 1 C10 19 1 N 1 A D49 101 ? N2 ? B D49 1 N2 20 1 N 1 A D49 101 ? C6 ? B D49 1 C6 21 1 N 1 A D49 101 ? C12 ? B D49 1 C12 22 1 N 1 A D49 101 ? C14 ? B D49 1 C14 23 1 N 1 A D49 101 ? C15 ? B D49 1 C15 24 1 N 1 A D49 101 ? C16 ? B D49 1 C16 25 1 N 1 A D49 101 ? O2 ? B D49 1 O2 26 1 N 1 A D49 101 ? O1 ? B D49 1 O1 27 1 N 1 A D49 101 ? C17 ? B D49 1 C17 28 1 N 1 A D49 101 ? C18 ? B D49 1 C18 29 1 N 1 A D49 101 ? C19 ? B D49 1 C19 30 1 N 1 A D49 101 ? C20 ? B D49 1 C20 31 1 N 1 A D49 101 ? C21 ? B D49 1 C21 32 1 N 1 A D49 101 ? C22 ? B D49 1 C22 33 1 N 1 A D49 101 ? C32 ? B D49 1 C32 34 1 N 1 A D49 101 ? N3 ? B D49 1 N3 35 1 N 1 A D49 101 ? C24 ? B D49 1 C24 36 1 N 1 A D49 101 ? C25 ? B D49 1 C25 37 1 N 1 A D49 101 ? N4 ? B D49 1 N4 38 1 N 1 A D49 101 ? C27 ? B D49 1 C27 39 1 N 1 A D49 101 ? C28 ? B D49 1 C28 40 1 N 1 A D49 101 ? C29 ? B D49 1 C29 41 1 N 1 A D49 101 ? C30 ? B D49 1 C30 42 1 N 1 A D49 101 ? C31 ? B D49 1 C31 43 1 N 1 A D49 101 ? O3 ? B D49 1 O3 44 1 N 1 A D49 101 ? O4 ? B D49 1 O4 45 1 N 1 A MRD 102 ? C4 ? C MRD 1 C4 46 1 N 1 A MRD 102 ? O4 ? C MRD 1 O4 47 1 N 1 A MRD 102 ? C5 ? C MRD 1 C5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 17 ? A VAL 1 2 1 Y 1 A PHE 18 ? A PHE 2 3 1 Y 1 A PRO 19 ? A PRO 3 4 1 Y 1 A SER 20 ? A SER 4 5 1 Y 1 A ASP 21 ? A ASP 5 6 1 Y 1 A ASN 78 ? A ASN 62 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 D49 O7 O N N 88 D49 C8 C N N 89 D49 C9 C N R 90 D49 O10 O N N 91 D49 C11 C Y N 92 D49 O35 O N N 93 D49 C36 C N N 94 D49 C37 C N N 95 D49 H2 H N N 96 D49 H3 H N N 97 D49 H4 H N N 98 D49 H8 H N N 99 D49 H9 H N N 100 D49 H10 H N N 101 D49 H11 H N N 102 D49 H12 H N N 103 D49 C1 C Y N 104 D49 C2 C Y N 105 D49 C3 C Y N 106 D49 C4 C Y N 107 D49 C5 C Y N 108 D49 C13 C Y N 109 D49 N1 N Y N 110 D49 C7 C Y N 111 D49 C10 C Y N 112 D49 N2 N Y N 113 D49 C6 C Y N 114 D49 C12 C Y N 115 D49 C14 C Y N 116 D49 C15 C Y N 117 D49 C16 C N N 118 D49 O2 O N N 119 D49 O1 O N N 120 D49 C17 C Y N 121 D49 C18 C Y N 122 D49 C19 C Y N 123 D49 C20 C Y N 124 D49 C21 C Y N 125 D49 C22 C Y N 126 D49 C32 C Y N 127 D49 N3 N Y N 128 D49 C24 C Y N 129 D49 C25 C Y N 130 D49 N4 N Y N 131 D49 C27 C Y N 132 D49 C28 C Y N 133 D49 C29 C Y N 134 D49 C30 C Y N 135 D49 C31 C N N 136 D49 O3 O N N 137 D49 O4 O N N 138 D49 H1 H N N 139 D49 H5 H N N 140 D49 H6 H N N 141 D49 H7 H N N 142 D49 H13 H N N 143 D49 H14 H N N 144 D49 H15 H N N 145 D49 H16 H N N 146 D49 H17 H N N 147 D49 H18 H N N 148 D49 H19 H N N 149 D49 H20 H N N 150 D49 H21 H N N 151 D49 H22 H N N 152 D49 H23 H N N 153 D49 H24 H N N 154 D49 H25 H N N 155 D49 H26 H N N 156 GLN N N N N 157 GLN CA C N S 158 GLN C C N N 159 GLN O O N N 160 GLN CB C N N 161 GLN CG C N N 162 GLN CD C N N 163 GLN OE1 O N N 164 GLN NE2 N N N 165 GLN OXT O N N 166 GLN H H N N 167 GLN H2 H N N 168 GLN HA H N N 169 GLN HB2 H N N 170 GLN HB3 H N N 171 GLN HG2 H N N 172 GLN HG3 H N N 173 GLN HE21 H N N 174 GLN HE22 H N N 175 GLN HXT H N N 176 GLU N N N N 177 GLU CA C N S 178 GLU C C N N 179 GLU O O N N 180 GLU CB C N N 181 GLU CG C N N 182 GLU CD C N N 183 GLU OE1 O N N 184 GLU OE2 O N N 185 GLU OXT O N N 186 GLU H H N N 187 GLU H2 H N N 188 GLU HA H N N 189 GLU HB2 H N N 190 GLU HB3 H N N 191 GLU HG2 H N N 192 GLU HG3 H N N 193 GLU HE2 H N N 194 GLU HXT H N N 195 GLY N N N N 196 GLY CA C N N 197 GLY C C N N 198 GLY O O N N 199 GLY OXT O N N 200 GLY H H N N 201 GLY H2 H N N 202 GLY HA2 H N N 203 GLY HA3 H N N 204 GLY HXT H N N 205 HIS N N N N 206 HIS CA C N S 207 HIS C C N N 208 HIS O O N N 209 HIS CB C N N 210 HIS CG C Y N 211 HIS ND1 N Y N 212 HIS CD2 C Y N 213 HIS CE1 C Y N 214 HIS NE2 N Y N 215 HIS OXT O N N 216 HIS H H N N 217 HIS H2 H N N 218 HIS HA H N N 219 HIS HB2 H N N 220 HIS HB3 H N N 221 HIS HD1 H N N 222 HIS HD2 H N N 223 HIS HE1 H N N 224 HIS HE2 H N N 225 HIS HXT H N N 226 HOH O O N N 227 HOH H1 H N N 228 HOH H2 H N N 229 ILE N N N N 230 ILE CA C N S 231 ILE C C N N 232 ILE O O N N 233 ILE CB C N S 234 ILE CG1 C N N 235 ILE CG2 C N N 236 ILE CD1 C N N 237 ILE OXT O N N 238 ILE H H N N 239 ILE H2 H N N 240 ILE HA H N N 241 ILE HB H N N 242 ILE HG12 H N N 243 ILE HG13 H N N 244 ILE HG21 H N N 245 ILE HG22 H N N 246 ILE HG23 H N N 247 ILE HD11 H N N 248 ILE HD12 H N N 249 ILE HD13 H N N 250 ILE HXT H N N 251 LEU N N N N 252 LEU CA C N S 253 LEU C C N N 254 LEU O O N N 255 LEU CB C N N 256 LEU CG C N N 257 LEU CD1 C N N 258 LEU CD2 C N N 259 LEU OXT O N N 260 LEU H H N N 261 LEU H2 H N N 262 LEU HA H N N 263 LEU HB2 H N N 264 LEU HB3 H N N 265 LEU HG H N N 266 LEU HD11 H N N 267 LEU HD12 H N N 268 LEU HD13 H N N 269 LEU HD21 H N N 270 LEU HD22 H N N 271 LEU HD23 H N N 272 LEU HXT H N N 273 LYS N N N N 274 LYS CA C N S 275 LYS C C N N 276 LYS O O N N 277 LYS CB C N N 278 LYS CG C N N 279 LYS CD C N N 280 LYS CE C N N 281 LYS NZ N N N 282 LYS OXT O N N 283 LYS H H N N 284 LYS H2 H N N 285 LYS HA H N N 286 LYS HB2 H N N 287 LYS HB3 H N N 288 LYS HG2 H N N 289 LYS HG3 H N N 290 LYS HD2 H N N 291 LYS HD3 H N N 292 LYS HE2 H N N 293 LYS HE3 H N N 294 LYS HZ1 H N N 295 LYS HZ2 H N N 296 LYS HZ3 H N N 297 LYS HXT H N N 298 MET N N N N 299 MET CA C N S 300 MET C C N N 301 MET O O N N 302 MET CB C N N 303 MET CG C N N 304 MET SD S N N 305 MET CE C N N 306 MET OXT O N N 307 MET H H N N 308 MET H2 H N N 309 MET HA H N N 310 MET HB2 H N N 311 MET HB3 H N N 312 MET HG2 H N N 313 MET HG3 H N N 314 MET HE1 H N N 315 MET HE2 H N N 316 MET HE3 H N N 317 MET HXT H N N 318 MRD C1 C N N 319 MRD C2 C N N 320 MRD O2 O N N 321 MRD CM C N N 322 MRD C3 C N N 323 MRD C4 C N R 324 MRD O4 O N N 325 MRD C5 C N N 326 MRD H1C1 H N N 327 MRD H1C2 H N N 328 MRD H1C3 H N N 329 MRD H2 H N N 330 MRD HMC1 H N N 331 MRD HMC2 H N N 332 MRD HMC3 H N N 333 MRD H3C1 H N N 334 MRD H3C2 H N N 335 MRD H4 H N N 336 MRD HA H N N 337 MRD H5C1 H N N 338 MRD H5C2 H N N 339 MRD H5C3 H N N 340 PHE N N N N 341 PHE CA C N S 342 PHE C C N N 343 PHE O O N N 344 PHE CB C N N 345 PHE CG C Y N 346 PHE CD1 C Y N 347 PHE CD2 C Y N 348 PHE CE1 C Y N 349 PHE CE2 C Y N 350 PHE CZ C Y N 351 PHE OXT O N N 352 PHE H H N N 353 PHE H2 H N N 354 PHE HA H N N 355 PHE HB2 H N N 356 PHE HB3 H N N 357 PHE HD1 H N N 358 PHE HD2 H N N 359 PHE HE1 H N N 360 PHE HE2 H N N 361 PHE HZ H N N 362 PHE HXT H N N 363 PO4 P P N N 364 PO4 O1 O N N 365 PO4 O2 O N N 366 PO4 O3 O N N 367 PO4 O4 O N N 368 PRO N N N N 369 PRO CA C N S 370 PRO C C N N 371 PRO O O N N 372 PRO CB C N N 373 PRO CG C N N 374 PRO CD C N N 375 PRO OXT O N N 376 PRO H H N N 377 PRO HA H N N 378 PRO HB2 H N N 379 PRO HB3 H N N 380 PRO HG2 H N N 381 PRO HG3 H N N 382 PRO HD2 H N N 383 PRO HD3 H N N 384 PRO HXT H N N 385 SER N N N N 386 SER CA C N S 387 SER C C N N 388 SER O O N N 389 SER CB C N N 390 SER OG O N N 391 SER OXT O N N 392 SER H H N N 393 SER H2 H N N 394 SER HA H N N 395 SER HB2 H N N 396 SER HB3 H N N 397 SER HG H N N 398 SER HXT H N N 399 THR N N N N 400 THR CA C N S 401 THR C C N N 402 THR O O N N 403 THR CB C N R 404 THR OG1 O N N 405 THR CG2 C N N 406 THR OXT O N N 407 THR H H N N 408 THR H2 H N N 409 THR HA H N N 410 THR HB H N N 411 THR HG1 H N N 412 THR HG21 H N N 413 THR HG22 H N N 414 THR HG23 H N N 415 THR HXT H N N 416 TRP N N N N 417 TRP CA C N S 418 TRP C C N N 419 TRP O O N N 420 TRP CB C N N 421 TRP CG C Y N 422 TRP CD1 C Y N 423 TRP CD2 C Y N 424 TRP NE1 N Y N 425 TRP CE2 C Y N 426 TRP CE3 C Y N 427 TRP CZ2 C Y N 428 TRP CZ3 C Y N 429 TRP CH2 C Y N 430 TRP OXT O N N 431 TRP H H N N 432 TRP H2 H N N 433 TRP HA H N N 434 TRP HB2 H N N 435 TRP HB3 H N N 436 TRP HD1 H N N 437 TRP HE1 H N N 438 TRP HE3 H N N 439 TRP HZ2 H N N 440 TRP HZ3 H N N 441 TRP HH2 H N N 442 TRP HXT H N N 443 TYR N N N N 444 TYR CA C N S 445 TYR C C N N 446 TYR O O N N 447 TYR CB C N N 448 TYR CG C Y N 449 TYR CD1 C Y N 450 TYR CD2 C Y N 451 TYR CE1 C Y N 452 TYR CE2 C Y N 453 TYR CZ C Y N 454 TYR OH O N N 455 TYR OXT O N N 456 TYR H H N N 457 TYR H2 H N N 458 TYR HA H N N 459 TYR HB2 H N N 460 TYR HB3 H N N 461 TYR HD1 H N N 462 TYR HD2 H N N 463 TYR HE1 H N N 464 TYR HE2 H N N 465 TYR HH H N N 466 TYR HXT H N N 467 VAL N N N N 468 VAL CA C N S 469 VAL C C N N 470 VAL O O N N 471 VAL CB C N N 472 VAL CG1 C N N 473 VAL CG2 C N N 474 VAL OXT O N N 475 VAL H H N N 476 VAL H2 H N N 477 VAL HA H N N 478 VAL HB H N N 479 VAL HG11 H N N 480 VAL HG12 H N N 481 VAL HG13 H N N 482 VAL HG21 H N N 483 VAL HG22 H N N 484 VAL HG23 H N N 485 VAL HXT H N N 486 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 D49 O35 C9 sing N N 83 D49 C11 O10 sing N N 84 D49 C37 O10 sing N N 85 D49 C37 C36 sing N N 86 D49 C8 C9 sing N N 87 D49 C8 O7 sing N N 88 D49 C9 C36 sing N N 89 D49 C8 H2 sing N N 90 D49 C8 H3 sing N N 91 D49 C9 H4 sing N N 92 D49 O35 H8 sing N N 93 D49 C36 H9 sing N N 94 D49 C36 H10 sing N N 95 D49 C37 H11 sing N N 96 D49 C37 H12 sing N N 97 D49 C11 C1 sing Y N 98 D49 C1 C2 doub Y N 99 D49 C2 C3 sing Y N 100 D49 C3 C4 doub Y N 101 D49 C4 C5 sing Y N 102 D49 C5 C11 doub Y N 103 D49 C3 C13 sing N N 104 D49 C13 N1 sing Y N 105 D49 N1 C7 sing Y N 106 D49 C7 C10 doub Y N 107 D49 C10 N2 sing Y N 108 D49 N2 C13 doub Y N 109 D49 C10 C6 sing Y N 110 D49 C6 C12 doub Y N 111 D49 C12 C14 sing Y N 112 D49 C14 C15 doub Y N 113 D49 C15 C7 sing Y N 114 D49 C14 C16 sing N N 115 D49 C16 O2 sing N N 116 D49 C16 O1 doub N N 117 D49 O7 C17 sing N N 118 D49 C17 C18 sing Y N 119 D49 C18 C19 doub Y N 120 D49 C19 C20 sing Y N 121 D49 C20 C21 doub Y N 122 D49 C21 C22 sing Y N 123 D49 C22 C17 doub Y N 124 D49 C20 C32 sing N N 125 D49 C32 N3 sing Y N 126 D49 N3 C24 sing Y N 127 D49 C24 C25 doub Y N 128 D49 C25 N4 sing Y N 129 D49 N4 C32 doub Y N 130 D49 C25 C27 sing Y N 131 D49 C27 C28 doub Y N 132 D49 C28 C29 sing Y N 133 D49 C29 C30 doub Y N 134 D49 C30 C24 sing Y N 135 D49 C28 C31 sing N N 136 D49 C31 O3 doub N N 137 D49 C31 O4 sing N N 138 D49 C1 H1 sing N N 139 D49 C2 H5 sing N N 140 D49 C4 H6 sing N N 141 D49 C5 H7 sing N N 142 D49 N1 H13 sing N N 143 D49 C6 H14 sing N N 144 D49 C12 H15 sing N N 145 D49 C15 H16 sing N N 146 D49 O2 H17 sing N N 147 D49 C18 H18 sing N N 148 D49 C19 H19 sing N N 149 D49 C21 H20 sing N N 150 D49 C22 H21 sing N N 151 D49 N3 H22 sing N N 152 D49 C27 H23 sing N N 153 D49 C29 H24 sing N N 154 D49 C30 H25 sing N N 155 D49 O4 H26 sing N N 156 GLN N CA sing N N 157 GLN N H sing N N 158 GLN N H2 sing N N 159 GLN CA C sing N N 160 GLN CA CB sing N N 161 GLN CA HA sing N N 162 GLN C O doub N N 163 GLN C OXT sing N N 164 GLN CB CG sing N N 165 GLN CB HB2 sing N N 166 GLN CB HB3 sing N N 167 GLN CG CD sing N N 168 GLN CG HG2 sing N N 169 GLN CG HG3 sing N N 170 GLN CD OE1 doub N N 171 GLN CD NE2 sing N N 172 GLN NE2 HE21 sing N N 173 GLN NE2 HE22 sing N N 174 GLN OXT HXT sing N N 175 GLU N CA sing N N 176 GLU N H sing N N 177 GLU N H2 sing N N 178 GLU CA C sing N N 179 GLU CA CB sing N N 180 GLU CA HA sing N N 181 GLU C O doub N N 182 GLU C OXT sing N N 183 GLU CB CG sing N N 184 GLU CB HB2 sing N N 185 GLU CB HB3 sing N N 186 GLU CG CD sing N N 187 GLU CG HG2 sing N N 188 GLU CG HG3 sing N N 189 GLU CD OE1 doub N N 190 GLU CD OE2 sing N N 191 GLU OE2 HE2 sing N N 192 GLU OXT HXT sing N N 193 GLY N CA sing N N 194 GLY N H sing N N 195 GLY N H2 sing N N 196 GLY CA C sing N N 197 GLY CA HA2 sing N N 198 GLY CA HA3 sing N N 199 GLY C O doub N N 200 GLY C OXT sing N N 201 GLY OXT HXT sing N N 202 HIS N CA sing N N 203 HIS N H sing N N 204 HIS N H2 sing N N 205 HIS CA C sing N N 206 HIS CA CB sing N N 207 HIS CA HA sing N N 208 HIS C O doub N N 209 HIS C OXT sing N N 210 HIS CB CG sing N N 211 HIS CB HB2 sing N N 212 HIS CB HB3 sing N N 213 HIS CG ND1 sing Y N 214 HIS CG CD2 doub Y N 215 HIS ND1 CE1 doub Y N 216 HIS ND1 HD1 sing N N 217 HIS CD2 NE2 sing Y N 218 HIS CD2 HD2 sing N N 219 HIS CE1 NE2 sing Y N 220 HIS CE1 HE1 sing N N 221 HIS NE2 HE2 sing N N 222 HIS OXT HXT sing N N 223 HOH O H1 sing N N 224 HOH O H2 sing N N 225 ILE N CA sing N N 226 ILE N H sing N N 227 ILE N H2 sing N N 228 ILE CA C sing N N 229 ILE CA CB sing N N 230 ILE CA HA sing N N 231 ILE C O doub N N 232 ILE C OXT sing N N 233 ILE CB CG1 sing N N 234 ILE CB CG2 sing N N 235 ILE CB HB sing N N 236 ILE CG1 CD1 sing N N 237 ILE CG1 HG12 sing N N 238 ILE CG1 HG13 sing N N 239 ILE CG2 HG21 sing N N 240 ILE CG2 HG22 sing N N 241 ILE CG2 HG23 sing N N 242 ILE CD1 HD11 sing N N 243 ILE CD1 HD12 sing N N 244 ILE CD1 HD13 sing N N 245 ILE OXT HXT sing N N 246 LEU N CA sing N N 247 LEU N H sing N N 248 LEU N H2 sing N N 249 LEU CA C sing N N 250 LEU CA CB sing N N 251 LEU CA HA sing N N 252 LEU C O doub N N 253 LEU C OXT sing N N 254 LEU CB CG sing N N 255 LEU CB HB2 sing N N 256 LEU CB HB3 sing N N 257 LEU CG CD1 sing N N 258 LEU CG CD2 sing N N 259 LEU CG HG sing N N 260 LEU CD1 HD11 sing N N 261 LEU CD1 HD12 sing N N 262 LEU CD1 HD13 sing N N 263 LEU CD2 HD21 sing N N 264 LEU CD2 HD22 sing N N 265 LEU CD2 HD23 sing N N 266 LEU OXT HXT sing N N 267 LYS N CA sing N N 268 LYS N H sing N N 269 LYS N H2 sing N N 270 LYS CA C sing N N 271 LYS CA CB sing N N 272 LYS CA HA sing N N 273 LYS C O doub N N 274 LYS C OXT sing N N 275 LYS CB CG sing N N 276 LYS CB HB2 sing N N 277 LYS CB HB3 sing N N 278 LYS CG CD sing N N 279 LYS CG HG2 sing N N 280 LYS CG HG3 sing N N 281 LYS CD CE sing N N 282 LYS CD HD2 sing N N 283 LYS CD HD3 sing N N 284 LYS CE NZ sing N N 285 LYS CE HE2 sing N N 286 LYS CE HE3 sing N N 287 LYS NZ HZ1 sing N N 288 LYS NZ HZ2 sing N N 289 LYS NZ HZ3 sing N N 290 LYS OXT HXT sing N N 291 MET N CA sing N N 292 MET N H sing N N 293 MET N H2 sing N N 294 MET CA C sing N N 295 MET CA CB sing N N 296 MET CA HA sing N N 297 MET C O doub N N 298 MET C OXT sing N N 299 MET CB CG sing N N 300 MET CB HB2 sing N N 301 MET CB HB3 sing N N 302 MET CG SD sing N N 303 MET CG HG2 sing N N 304 MET CG HG3 sing N N 305 MET SD CE sing N N 306 MET CE HE1 sing N N 307 MET CE HE2 sing N N 308 MET CE HE3 sing N N 309 MET OXT HXT sing N N 310 MRD C1 C2 sing N N 311 MRD C1 H1C1 sing N N 312 MRD C1 H1C2 sing N N 313 MRD C1 H1C3 sing N N 314 MRD C2 O2 sing N N 315 MRD C2 CM sing N N 316 MRD C2 C3 sing N N 317 MRD O2 H2 sing N N 318 MRD CM HMC1 sing N N 319 MRD CM HMC2 sing N N 320 MRD CM HMC3 sing N N 321 MRD C3 C4 sing N N 322 MRD C3 H3C1 sing N N 323 MRD C3 H3C2 sing N N 324 MRD C4 O4 sing N N 325 MRD C4 C5 sing N N 326 MRD C4 H4 sing N N 327 MRD O4 HA sing N N 328 MRD C5 H5C1 sing N N 329 MRD C5 H5C2 sing N N 330 MRD C5 H5C3 sing N N 331 PHE N CA sing N N 332 PHE N H sing N N 333 PHE N H2 sing N N 334 PHE CA C sing N N 335 PHE CA CB sing N N 336 PHE CA HA sing N N 337 PHE C O doub N N 338 PHE C OXT sing N N 339 PHE CB CG sing N N 340 PHE CB HB2 sing N N 341 PHE CB HB3 sing N N 342 PHE CG CD1 doub Y N 343 PHE CG CD2 sing Y N 344 PHE CD1 CE1 sing Y N 345 PHE CD1 HD1 sing N N 346 PHE CD2 CE2 doub Y N 347 PHE CD2 HD2 sing N N 348 PHE CE1 CZ doub Y N 349 PHE CE1 HE1 sing N N 350 PHE CE2 CZ sing Y N 351 PHE CE2 HE2 sing N N 352 PHE CZ HZ sing N N 353 PHE OXT HXT sing N N 354 PO4 P O1 doub N N 355 PO4 P O2 sing N N 356 PO4 P O3 sing N N 357 PO4 P O4 sing N N 358 PRO N CA sing N N 359 PRO N CD sing N N 360 PRO N H sing N N 361 PRO CA C sing N N 362 PRO CA CB sing N N 363 PRO CA HA sing N N 364 PRO C O doub N N 365 PRO C OXT sing N N 366 PRO CB CG sing N N 367 PRO CB HB2 sing N N 368 PRO CB HB3 sing N N 369 PRO CG CD sing N N 370 PRO CG HG2 sing N N 371 PRO CG HG3 sing N N 372 PRO CD HD2 sing N N 373 PRO CD HD3 sing N N 374 PRO OXT HXT sing N N 375 SER N CA sing N N 376 SER N H sing N N 377 SER N H2 sing N N 378 SER CA C sing N N 379 SER CA CB sing N N 380 SER CA HA sing N N 381 SER C O doub N N 382 SER C OXT sing N N 383 SER CB OG sing N N 384 SER CB HB2 sing N N 385 SER CB HB3 sing N N 386 SER OG HG sing N N 387 SER OXT HXT sing N N 388 THR N CA sing N N 389 THR N H sing N N 390 THR N H2 sing N N 391 THR CA C sing N N 392 THR CA CB sing N N 393 THR CA HA sing N N 394 THR C O doub N N 395 THR C OXT sing N N 396 THR CB OG1 sing N N 397 THR CB CG2 sing N N 398 THR CB HB sing N N 399 THR OG1 HG1 sing N N 400 THR CG2 HG21 sing N N 401 THR CG2 HG22 sing N N 402 THR CG2 HG23 sing N N 403 THR OXT HXT sing N N 404 TRP N CA sing N N 405 TRP N H sing N N 406 TRP N H2 sing N N 407 TRP CA C sing N N 408 TRP CA CB sing N N 409 TRP CA HA sing N N 410 TRP C O doub N N 411 TRP C OXT sing N N 412 TRP CB CG sing N N 413 TRP CB HB2 sing N N 414 TRP CB HB3 sing N N 415 TRP CG CD1 doub Y N 416 TRP CG CD2 sing Y N 417 TRP CD1 NE1 sing Y N 418 TRP CD1 HD1 sing N N 419 TRP CD2 CE2 doub Y N 420 TRP CD2 CE3 sing Y N 421 TRP NE1 CE2 sing Y N 422 TRP NE1 HE1 sing N N 423 TRP CE2 CZ2 sing Y N 424 TRP CE3 CZ3 doub Y N 425 TRP CE3 HE3 sing N N 426 TRP CZ2 CH2 doub Y N 427 TRP CZ2 HZ2 sing N N 428 TRP CZ3 CH2 sing Y N 429 TRP CZ3 HZ3 sing N N 430 TRP CH2 HH2 sing N N 431 TRP OXT HXT sing N N 432 TYR N CA sing N N 433 TYR N H sing N N 434 TYR N H2 sing N N 435 TYR CA C sing N N 436 TYR CA CB sing N N 437 TYR CA HA sing N N 438 TYR C O doub N N 439 TYR C OXT sing N N 440 TYR CB CG sing N N 441 TYR CB HB2 sing N N 442 TYR CB HB3 sing N N 443 TYR CG CD1 doub Y N 444 TYR CG CD2 sing Y N 445 TYR CD1 CE1 sing Y N 446 TYR CD1 HD1 sing N N 447 TYR CD2 CE2 doub Y N 448 TYR CD2 HD2 sing N N 449 TYR CE1 CZ doub Y N 450 TYR CE1 HE1 sing N N 451 TYR CE2 CZ sing Y N 452 TYR CE2 HE2 sing N N 453 TYR CZ OH sing N N 454 TYR OH HH sing N N 455 TYR OXT HXT sing N N 456 VAL N CA sing N N 457 VAL N H sing N N 458 VAL N H2 sing N N 459 VAL CA C sing N N 460 VAL CA CB sing N N 461 VAL CA HA sing N N 462 VAL C O doub N N 463 VAL C OXT sing N N 464 VAL CB CG1 sing N N 465 VAL CB CG2 sing N N 466 VAL CB HB sing N N 467 VAL CG1 HG11 sing N N 468 VAL CG1 HG12 sing N N 469 VAL CG1 HG13 sing N N 470 VAL CG2 HG21 sing N N 471 VAL CG2 HG22 sing N N 472 VAL CG2 HG23 sing N N 473 VAL OXT HXT sing N N 474 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Natural Sciences and Engineering Research Council (NSERC, Canada)' Canada 227853 1 'Natural Sciences and Engineering Research Council (NSERC, Canada)' Canada 2018-04686 2 'Other government' Canada 'Canada Foundation for Innovation 11510 (www.innovation.ca)' 3 'Canadian Institutes of Health Research (CIHR)' Canada MOP-13107 4 'Other private' Canada 'Fondation Marcel et Rolande Gosselin' 5 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id D49 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id D49 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-[4-[(2~{R})-4-[4-(6-carboxy-1~{H}-benzimidazol-2-yl)phenoxy]-2-oxidanyl-butoxy]phenyl]-1~{H}-benzimidazole-5-carboxylic acid' D49 3 '(4R)-2-METHYLPENTANE-2,4-DIOL' MRD 4 'PHOSPHATE ION' PO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2RH2 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Type 2 DHFRs are well-established to be tetramers, both by our group and by others.' #