data_6OFA # _entry.id 6OFA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6OFA pdb_00006ofa 10.2210/pdb6ofa/pdb WWPDB D_1000239519 ? ? BMRB 30597 ? 10.13018/BMR30597 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-08-28 2 'Structure model' 1 1 2019-09-11 3 'Structure model' 1 2 2019-09-18 4 'Structure model' 1 3 2019-12-18 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Database references' 7 5 'Structure model' Other 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_database_status 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond 9 6 'Structure model' database_2 10 6 'Structure model' pdbx_entry_details 11 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation_author.identifier_ORCID' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 4 'Structure model' '_pdbx_audit_support.funding_organization' 13 5 'Structure model' '_database_2.pdbx_DOI' 14 5 'Structure model' '_database_2.pdbx_database_accession' 15 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 16 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6OFA _pdbx_database_status.recvd_initial_deposition_date 2019-03-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Wasabi Receptor Toxin' _pdbx_database_related.db_id 30597 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lin King, J.V.' 1 0000-0001-5194-4798 'Kelly, M.J.S.' 2 ? 'Julius, D.' 3 0000-0002-6365-4867 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 178 _citation.language ? _citation.page_first 1362 _citation.page_last 1374.e16 _citation.title 'A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2019.07.014 _citation.pdbx_database_id_PubMed 31447178 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lin King, J.V.' 1 ? primary 'Emrick, J.J.' 2 ? primary 'Kelly, M.J.S.' 3 ? primary 'Herzig, V.' 4 ? primary 'King, G.F.' 5 ? primary 'Medzihradszky, K.F.' 6 ? primary 'Julius, D.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Wasabi Receptor Toxin' _entity.formula_weight 3862.348 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS _entity_poly.pdbx_seq_one_letter_code_can ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 PRO n 1 4 GLN n 1 5 GLN n 1 6 ALA n 1 7 LYS n 1 8 TYR n 1 9 CYS n 1 10 TYR n 1 11 GLU n 1 12 GLN n 1 13 CYS n 1 14 ASN n 1 15 VAL n 1 16 ASN n 1 17 LYS n 1 18 VAL n 1 19 PRO n 1 20 PHE n 1 21 ASP n 1 22 GLN n 1 23 CYS n 1 24 TYR n 1 25 GLN n 1 26 MET n 1 27 CYS n 1 28 SER n 1 29 PRO n 1 30 LEU n 1 31 GLU n 1 32 ARG n 1 33 SER n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 33 _pdbx_entity_src_syn.organism_scientific 'Urodacus manicatus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1330407 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 SER 33 33 33 SER SER A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 33 ? O ? A SER 33 O 2 2 Y 1 A SER 33 ? O ? A SER 33 O 3 3 Y 1 A SER 33 ? O ? A SER 33 O 4 4 Y 1 A SER 33 ? O ? A SER 33 O 5 5 Y 1 A SER 33 ? O ? A SER 33 O 6 6 Y 1 A SER 33 ? O ? A SER 33 O 7 7 Y 1 A SER 33 ? O ? A SER 33 O 8 8 Y 1 A SER 33 ? O ? A SER 33 O 9 9 Y 1 A SER 33 ? O ? A SER 33 O 10 10 Y 1 A SER 33 ? O ? A SER 33 O 11 11 Y 1 A SER 33 ? O ? A SER 33 O 12 12 Y 1 A SER 33 ? O ? A SER 33 O 13 13 Y 1 A SER 33 ? O ? A SER 33 O 14 14 Y 1 A SER 33 ? O ? A SER 33 O 15 15 Y 1 A SER 33 ? O ? A SER 33 O 16 16 Y 1 A SER 33 ? O ? A SER 33 O 17 17 Y 1 A SER 33 ? O ? A SER 33 O 18 18 Y 1 A SER 33 ? O ? A SER 33 O 19 19 Y 1 A SER 33 ? O ? A SER 33 O 20 20 Y 1 A SER 33 ? O ? A SER 33 O 21 21 Y 1 A SER 33 ? O ? A SER 33 O 22 22 Y 1 A SER 33 ? O ? A SER 33 O 23 23 Y 1 A SER 33 ? O ? A SER 33 O 24 24 Y 1 A SER 33 ? O ? A SER 33 O 25 25 Y 1 A SER 33 ? O ? A SER 33 O 26 26 Y 1 A SER 33 ? O ? A SER 33 O 27 27 Y 1 A SER 33 ? O ? A SER 33 O 28 28 Y 1 A SER 33 ? O ? A SER 33 O 29 29 Y 1 A SER 33 ? O ? A SER 33 O 30 30 Y 1 A SER 33 ? O ? A SER 33 O 31 31 Y 1 A SER 33 ? O ? A SER 33 O 32 32 Y 1 A SER 33 ? O ? A SER 33 O 33 33 Y 1 A SER 33 ? O ? A SER 33 O 34 34 Y 1 A SER 33 ? O ? A SER 33 O 35 35 Y 1 A SER 33 ? O ? A SER 33 O 36 36 Y 1 A SER 33 ? O ? A SER 33 O 37 37 Y 1 A SER 33 ? O ? A SER 33 O 38 38 Y 1 A SER 33 ? O ? A SER 33 O 39 39 Y 1 A SER 33 ? O ? A SER 33 O 40 40 Y 1 A SER 33 ? O ? A SER 33 O 41 41 Y 1 A SER 33 ? O ? A SER 33 O 42 42 Y 1 A SER 33 ? O ? A SER 33 O 43 43 Y 1 A SER 33 ? O ? A SER 33 O 44 44 Y 1 A SER 33 ? O ? A SER 33 O 45 45 Y 1 A SER 33 ? O ? A SER 33 O 46 46 Y 1 A SER 33 ? O ? A SER 33 O 47 47 Y 1 A SER 33 ? O ? A SER 33 O 48 48 Y 1 A SER 33 ? O ? A SER 33 O 49 49 Y 1 A SER 33 ? O ? A SER 33 O 50 50 Y 1 A SER 33 ? O ? A SER 33 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OFA _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6OFA _struct.title 'Wasabi Receptor Toxin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OFA _struct_keywords.text 'Cysteine-stabilized helical hairpin, TRPA1, Scorpion, Venom, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6OFA _struct_ref.pdbx_db_accession 6OFA _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6OFA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6OFA _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 33 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 33 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 2820 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? LYS A 17 ? SER A 2 LYS A 17 1 ? 16 HELX_P HELX_P2 AA2 PRO A 19 ? ARG A 32 ? PRO A 19 ARG A 32 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 9 A CYS 27 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 13 A CYS 23 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 9 ? CYS A 27 ? CYS A 9 ? 1_555 CYS A 27 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 13 ? CYS A 23 ? CYS A 13 ? 1_555 CYS A 23 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 6OFA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -161.90 76.40 2 1 ASN A 16 ? ? -71.13 -76.87 3 1 LYS A 17 ? ? 172.45 87.29 4 2 SER A 2 ? ? -159.82 68.46 5 2 ASN A 16 ? ? -73.86 -76.64 6 2 LYS A 17 ? ? 174.91 85.35 7 2 ARG A 32 ? ? 60.13 83.44 8 3 SER A 2 ? ? -152.56 70.61 9 3 ASN A 16 ? ? -80.34 -80.56 10 3 LYS A 17 ? ? 170.36 87.79 11 4 SER A 2 ? ? -152.21 58.03 12 4 ASN A 16 ? ? -67.87 -75.98 13 4 LYS A 17 ? ? 174.87 85.03 14 5 SER A 2 ? ? -169.83 83.10 15 5 ASN A 16 ? ? -79.33 -77.08 16 5 LYS A 17 ? ? 176.46 84.05 17 6 SER A 2 ? ? -157.48 86.98 18 6 ASN A 16 ? ? -68.27 -75.17 19 6 LYS A 17 ? ? 174.38 85.40 20 7 SER A 2 ? ? -161.71 52.26 21 7 ASN A 16 ? ? -81.74 -77.80 22 7 LYS A 17 ? ? 172.88 86.94 23 8 SER A 2 ? ? -165.12 68.74 24 8 ASN A 16 ? ? -68.69 -75.13 25 8 LYS A 17 ? ? 174.44 86.38 26 8 ARG A 32 ? ? 59.21 74.36 27 9 SER A 2 ? ? -153.38 65.51 28 9 ASN A 16 ? ? -70.93 -76.40 29 9 LYS A 17 ? ? 175.34 85.22 30 9 LEU A 30 ? ? -91.68 -65.69 31 10 SER A 2 ? ? -158.00 61.30 32 10 ASN A 16 ? ? -70.08 -73.09 33 10 LYS A 17 ? ? 176.69 84.50 34 11 SER A 2 ? ? -161.37 72.94 35 11 ASN A 16 ? ? -65.37 -74.69 36 11 LYS A 17 ? ? 175.25 84.66 37 11 LEU A 30 ? ? -90.71 -63.33 38 12 SER A 2 ? ? -174.34 73.47 39 12 ASN A 16 ? ? -75.33 -73.80 40 12 LYS A 17 ? ? 176.25 83.87 41 12 LEU A 30 ? ? -91.29 -60.53 42 12 ARG A 32 ? ? 62.99 95.87 43 13 SER A 2 ? ? -166.11 71.27 44 13 ASN A 16 ? ? -81.32 -77.42 45 13 LYS A 17 ? ? 172.96 85.77 46 13 LEU A 30 ? ? -90.55 -64.38 47 14 SER A 2 ? ? -157.55 67.45 48 14 ASN A 16 ? ? -69.04 -74.31 49 14 LYS A 17 ? ? 175.93 85.29 50 15 SER A 2 ? ? -162.64 53.52 51 15 ASN A 16 ? ? -70.51 -76.39 52 15 LYS A 17 ? ? 173.27 85.89 53 15 GLU A 31 ? ? -78.19 -71.48 54 16 SER A 2 ? ? -163.78 70.22 55 16 ASN A 16 ? ? -70.26 -74.59 56 16 LYS A 17 ? ? 176.68 84.47 57 17 SER A 2 ? ? -167.74 79.34 58 17 ASN A 16 ? ? -72.45 -75.58 59 17 LYS A 17 ? ? 176.95 84.96 60 17 ARG A 32 ? ? 58.46 84.89 61 18 SER A 2 ? ? -156.48 75.22 62 18 ASN A 16 ? ? -86.00 -78.32 63 18 LYS A 17 ? ? 173.38 86.88 64 18 LEU A 30 ? ? -90.31 -70.34 65 18 GLU A 31 ? ? -81.97 -72.67 66 19 SER A 2 ? ? -158.15 70.41 67 19 ASN A 16 ? ? -66.22 -74.04 68 19 LYS A 17 ? ? 175.94 85.10 69 20 SER A 2 ? ? -147.61 58.04 70 20 ASN A 16 ? ? -76.63 -74.84 71 20 LYS A 17 ? ? 175.20 86.28 72 21 SER A 2 ? ? -155.97 61.11 73 21 ASN A 16 ? ? -63.26 -73.22 74 21 LYS A 17 ? ? 175.25 85.40 75 22 SER A 2 ? ? -164.72 72.99 76 22 ASN A 16 ? ? -73.28 -75.56 77 22 LYS A 17 ? ? 174.61 85.69 78 23 SER A 2 ? ? -163.75 70.90 79 23 ASN A 16 ? ? -81.33 -79.13 80 23 LYS A 17 ? ? 170.87 85.86 81 24 SER A 2 ? ? -157.63 66.00 82 24 ASN A 16 ? ? -87.66 -77.55 83 24 LYS A 17 ? ? 173.12 85.71 84 24 GLU A 31 ? ? -75.68 -70.67 85 25 SER A 2 ? ? -163.31 72.39 86 25 ASN A 16 ? ? -73.32 -77.48 87 25 LYS A 17 ? ? 175.46 85.02 88 26 SER A 2 ? ? -164.37 74.54 89 26 ASN A 16 ? ? -71.83 -74.40 90 26 LYS A 17 ? ? 177.37 83.91 91 27 SER A 2 ? ? -152.67 74.20 92 27 ASN A 16 ? ? -76.92 -76.62 93 27 LYS A 17 ? ? 175.99 86.38 94 27 LEU A 30 ? ? -90.44 -63.49 95 28 SER A 2 ? ? 178.64 75.66 96 28 ASN A 16 ? ? -75.82 -78.91 97 28 LYS A 17 ? ? 171.55 86.61 98 28 GLU A 31 ? ? -80.06 -70.33 99 29 SER A 2 ? ? -155.14 68.90 100 29 ASN A 16 ? ? -72.88 -76.37 101 29 LYS A 17 ? ? 174.09 85.94 102 30 SER A 2 ? ? -151.53 55.63 103 30 ASN A 16 ? ? -70.89 -75.01 104 30 LYS A 17 ? ? 177.61 84.28 105 30 GLU A 31 ? ? -81.71 -71.61 106 31 SER A 2 ? ? -172.56 73.38 107 31 ASN A 16 ? ? -86.38 -76.07 108 31 LYS A 17 ? ? 175.28 85.86 109 31 LEU A 30 ? ? -90.50 -70.01 110 31 GLU A 31 ? ? -77.36 -71.97 111 32 SER A 2 ? ? -173.36 84.41 112 32 ASN A 16 ? ? -75.02 -74.99 113 32 LYS A 17 ? ? 174.18 84.82 114 33 SER A 2 ? ? -161.33 69.14 115 33 ASN A 16 ? ? -71.06 -74.67 116 33 LYS A 17 ? ? 173.11 85.95 117 34 SER A 2 ? ? -174.15 57.73 118 34 ASN A 16 ? ? -69.53 -73.72 119 34 LYS A 17 ? ? 175.44 85.17 120 35 SER A 2 ? ? -173.26 67.51 121 35 ASN A 16 ? ? -69.74 -75.31 122 35 LYS A 17 ? ? 177.45 84.23 123 35 GLU A 31 ? ? -80.47 -72.16 124 36 SER A 2 ? ? -165.39 61.75 125 36 ASN A 16 ? ? -67.03 -73.57 126 36 LYS A 17 ? ? 175.76 85.44 127 37 ASN A 16 ? ? -86.56 -77.90 128 37 LYS A 17 ? ? 177.45 81.74 129 38 SER A 2 ? ? -140.67 58.20 130 38 ASN A 16 ? ? -70.41 -75.32 131 38 LYS A 17 ? ? 175.25 83.71 132 39 SER A 2 ? ? -158.89 58.32 133 39 ASN A 16 ? ? -69.21 -75.07 134 39 LYS A 17 ? ? 175.45 84.15 135 40 SER A 2 ? ? -159.11 80.22 136 40 ASN A 16 ? ? -78.60 -77.37 137 40 LYS A 17 ? ? 173.18 84.32 138 40 LEU A 30 ? ? -90.28 -61.44 139 41 SER A 2 ? ? -174.04 82.74 140 41 ASN A 16 ? ? -67.83 -76.27 141 41 LYS A 17 ? ? 175.92 84.09 142 42 SER A 2 ? ? -165.22 68.84 143 42 ASN A 16 ? ? -65.71 -75.60 144 42 LYS A 17 ? ? 173.67 85.53 145 42 ARG A 32 ? ? -109.01 67.50 146 43 SER A 2 ? ? -161.34 80.48 147 43 ASN A 16 ? ? -64.66 -74.27 148 43 LYS A 17 ? ? 175.46 84.49 149 43 LEU A 30 ? ? -90.49 -65.02 150 44 SER A 2 ? ? -156.54 62.74 151 44 ASN A 16 ? ? -71.50 -73.48 152 44 LYS A 17 ? ? 175.43 86.04 153 45 SER A 2 ? ? -173.08 74.37 154 45 ASN A 16 ? ? -67.10 -74.19 155 45 LYS A 17 ? ? 174.63 86.53 156 46 SER A 2 ? ? -175.51 76.62 157 46 ASN A 16 ? ? -70.00 -76.92 158 46 LYS A 17 ? ? 174.64 86.61 159 46 ARG A 32 ? ? -151.72 -86.58 160 47 SER A 2 ? ? -159.90 51.08 161 47 ASN A 16 ? ? -70.35 -74.07 162 47 LYS A 17 ? ? 175.77 83.70 163 48 SER A 2 ? ? -168.71 80.53 164 48 ASN A 16 ? ? -74.60 -77.74 165 48 LYS A 17 ? ? 173.95 86.23 166 49 SER A 2 ? ? -169.59 84.81 167 49 ASN A 16 ? ? -69.37 -73.77 168 49 LYS A 17 ? ? 175.10 85.43 169 50 SER A 2 ? ? -169.60 78.52 170 50 ASN A 16 ? ? -73.50 -75.21 171 50 LYS A 17 ? ? 177.74 84.35 172 50 GLU A 31 ? ? -79.82 -71.45 # _pdbx_nmr_ensemble.entry_id 6OFA _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 50 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6OFA _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '300 uM Wasabi Receptor Toxin, 90% H2O/10% D2O' '90% H2O/10% D2O' water solution ? 2 '300 uM Wasabi Receptor Toxin, 100% D2O' '100% D2O' deuterium solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Wasabi Receptor Toxin' 300 ? uM 'natural abundance' 2 'Wasabi Receptor Toxin' 300 ? uM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions _pdbx_nmr_exptl_sample_conditions.pH_err 0 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H COSY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic 4 1 2 '2D 1H-1H COSY' 1 isotropic 5 1 2 '2D 1H-1H TOCSY' 1 isotropic 6 1 2 '2D 1H-1H NOESY' 1 isotropic 7 1 2 '2D 1H-13C HSQC aliphatic' 1 isotropic 8 1 2 '2D 1H-13C HSQC aromatic' 1 isotropic # _pdbx_nmr_refine.entry_id 6OFA _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARIA ? ;LINGE, O'DONOGHUE AND NILGES ; 2 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 6 'peak picking' 'CcpNmr Analysis' ? CCPN 3 collection TopSpin ? 'Bruker Biospin' 4 'data analysis' PSVS ? 'Bhattacharya and Montelione' 5 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 LEU N N N N 127 LEU CA C N S 128 LEU C C N N 129 LEU O O N N 130 LEU CB C N N 131 LEU CG C N N 132 LEU CD1 C N N 133 LEU CD2 C N N 134 LEU OXT O N N 135 LEU H H N N 136 LEU H2 H N N 137 LEU HA H N N 138 LEU HB2 H N N 139 LEU HB3 H N N 140 LEU HG H N N 141 LEU HD11 H N N 142 LEU HD12 H N N 143 LEU HD13 H N N 144 LEU HD21 H N N 145 LEU HD22 H N N 146 LEU HD23 H N N 147 LEU HXT H N N 148 LYS N N N N 149 LYS CA C N S 150 LYS C C N N 151 LYS O O N N 152 LYS CB C N N 153 LYS CG C N N 154 LYS CD C N N 155 LYS CE C N N 156 LYS NZ N N N 157 LYS OXT O N N 158 LYS H H N N 159 LYS H2 H N N 160 LYS HA H N N 161 LYS HB2 H N N 162 LYS HB3 H N N 163 LYS HG2 H N N 164 LYS HG3 H N N 165 LYS HD2 H N N 166 LYS HD3 H N N 167 LYS HE2 H N N 168 LYS HE3 H N N 169 LYS HZ1 H N N 170 LYS HZ2 H N N 171 LYS HZ3 H N N 172 LYS HXT H N N 173 MET N N N N 174 MET CA C N S 175 MET C C N N 176 MET O O N N 177 MET CB C N N 178 MET CG C N N 179 MET SD S N N 180 MET CE C N N 181 MET OXT O N N 182 MET H H N N 183 MET H2 H N N 184 MET HA H N N 185 MET HB2 H N N 186 MET HB3 H N N 187 MET HG2 H N N 188 MET HG3 H N N 189 MET HE1 H N N 190 MET HE2 H N N 191 MET HE3 H N N 192 MET HXT H N N 193 PHE N N N N 194 PHE CA C N S 195 PHE C C N N 196 PHE O O N N 197 PHE CB C N N 198 PHE CG C Y N 199 PHE CD1 C Y N 200 PHE CD2 C Y N 201 PHE CE1 C Y N 202 PHE CE2 C Y N 203 PHE CZ C Y N 204 PHE OXT O N N 205 PHE H H N N 206 PHE H2 H N N 207 PHE HA H N N 208 PHE HB2 H N N 209 PHE HB3 H N N 210 PHE HD1 H N N 211 PHE HD2 H N N 212 PHE HE1 H N N 213 PHE HE2 H N N 214 PHE HZ H N N 215 PHE HXT H N N 216 PRO N N N N 217 PRO CA C N S 218 PRO C C N N 219 PRO O O N N 220 PRO CB C N N 221 PRO CG C N N 222 PRO CD C N N 223 PRO OXT O N N 224 PRO H H N N 225 PRO HA H N N 226 PRO HB2 H N N 227 PRO HB3 H N N 228 PRO HG2 H N N 229 PRO HG3 H N N 230 PRO HD2 H N N 231 PRO HD3 H N N 232 PRO HXT H N N 233 SER N N N N 234 SER CA C N S 235 SER C C N N 236 SER O O N N 237 SER CB C N N 238 SER OG O N N 239 SER OXT O N N 240 SER H H N N 241 SER H2 H N N 242 SER HA H N N 243 SER HB2 H N N 244 SER HB3 H N N 245 SER HG H N N 246 SER HXT H N N 247 TYR N N N N 248 TYR CA C N S 249 TYR C C N N 250 TYR O O N N 251 TYR CB C N N 252 TYR CG C Y N 253 TYR CD1 C Y N 254 TYR CD2 C Y N 255 TYR CE1 C Y N 256 TYR CE2 C Y N 257 TYR CZ C Y N 258 TYR OH O N N 259 TYR OXT O N N 260 TYR H H N N 261 TYR H2 H N N 262 TYR HA H N N 263 TYR HB2 H N N 264 TYR HB3 H N N 265 TYR HD1 H N N 266 TYR HD2 H N N 267 TYR HE1 H N N 268 TYR HE2 H N N 269 TYR HH H N N 270 TYR HXT H N N 271 VAL N N N N 272 VAL CA C N S 273 VAL C C N N 274 VAL O O N N 275 VAL CB C N N 276 VAL CG1 C N N 277 VAL CG2 C N N 278 VAL OXT O N N 279 VAL H H N N 280 VAL H2 H N N 281 VAL HA H N N 282 VAL HB H N N 283 VAL HG11 H N N 284 VAL HG12 H N N 285 VAL HG13 H N N 286 VAL HG21 H N N 287 VAL HG22 H N N 288 VAL HG23 H N N 289 VAL HXT H N N 290 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 LEU N CA sing N N 120 LEU N H sing N N 121 LEU N H2 sing N N 122 LEU CA C sing N N 123 LEU CA CB sing N N 124 LEU CA HA sing N N 125 LEU C O doub N N 126 LEU C OXT sing N N 127 LEU CB CG sing N N 128 LEU CB HB2 sing N N 129 LEU CB HB3 sing N N 130 LEU CG CD1 sing N N 131 LEU CG CD2 sing N N 132 LEU CG HG sing N N 133 LEU CD1 HD11 sing N N 134 LEU CD1 HD12 sing N N 135 LEU CD1 HD13 sing N N 136 LEU CD2 HD21 sing N N 137 LEU CD2 HD22 sing N N 138 LEU CD2 HD23 sing N N 139 LEU OXT HXT sing N N 140 LYS N CA sing N N 141 LYS N H sing N N 142 LYS N H2 sing N N 143 LYS CA C sing N N 144 LYS CA CB sing N N 145 LYS CA HA sing N N 146 LYS C O doub N N 147 LYS C OXT sing N N 148 LYS CB CG sing N N 149 LYS CB HB2 sing N N 150 LYS CB HB3 sing N N 151 LYS CG CD sing N N 152 LYS CG HG2 sing N N 153 LYS CG HG3 sing N N 154 LYS CD CE sing N N 155 LYS CD HD2 sing N N 156 LYS CD HD3 sing N N 157 LYS CE NZ sing N N 158 LYS CE HE2 sing N N 159 LYS CE HE3 sing N N 160 LYS NZ HZ1 sing N N 161 LYS NZ HZ2 sing N N 162 LYS NZ HZ3 sing N N 163 LYS OXT HXT sing N N 164 MET N CA sing N N 165 MET N H sing N N 166 MET N H2 sing N N 167 MET CA C sing N N 168 MET CA CB sing N N 169 MET CA HA sing N N 170 MET C O doub N N 171 MET C OXT sing N N 172 MET CB CG sing N N 173 MET CB HB2 sing N N 174 MET CB HB3 sing N N 175 MET CG SD sing N N 176 MET CG HG2 sing N N 177 MET CG HG3 sing N N 178 MET SD CE sing N N 179 MET CE HE1 sing N N 180 MET CE HE2 sing N N 181 MET CE HE3 sing N N 182 MET OXT HXT sing N N 183 PHE N CA sing N N 184 PHE N H sing N N 185 PHE N H2 sing N N 186 PHE CA C sing N N 187 PHE CA CB sing N N 188 PHE CA HA sing N N 189 PHE C O doub N N 190 PHE C OXT sing N N 191 PHE CB CG sing N N 192 PHE CB HB2 sing N N 193 PHE CB HB3 sing N N 194 PHE CG CD1 doub Y N 195 PHE CG CD2 sing Y N 196 PHE CD1 CE1 sing Y N 197 PHE CD1 HD1 sing N N 198 PHE CD2 CE2 doub Y N 199 PHE CD2 HD2 sing N N 200 PHE CE1 CZ doub Y N 201 PHE CE1 HE1 sing N N 202 PHE CE2 CZ sing Y N 203 PHE CE2 HE2 sing N N 204 PHE CZ HZ sing N N 205 PHE OXT HXT sing N N 206 PRO N CA sing N N 207 PRO N CD sing N N 208 PRO N H sing N N 209 PRO CA C sing N N 210 PRO CA CB sing N N 211 PRO CA HA sing N N 212 PRO C O doub N N 213 PRO C OXT sing N N 214 PRO CB CG sing N N 215 PRO CB HB2 sing N N 216 PRO CB HB3 sing N N 217 PRO CG CD sing N N 218 PRO CG HG2 sing N N 219 PRO CG HG3 sing N N 220 PRO CD HD2 sing N N 221 PRO CD HD3 sing N N 222 PRO OXT HXT sing N N 223 SER N CA sing N N 224 SER N H sing N N 225 SER N H2 sing N N 226 SER CA C sing N N 227 SER CA CB sing N N 228 SER CA HA sing N N 229 SER C O doub N N 230 SER C OXT sing N N 231 SER CB OG sing N N 232 SER CB HB2 sing N N 233 SER CB HB3 sing N N 234 SER OG HG sing N N 235 SER OXT HXT sing N N 236 TYR N CA sing N N 237 TYR N H sing N N 238 TYR N H2 sing N N 239 TYR CA C sing N N 240 TYR CA CB sing N N 241 TYR CA HA sing N N 242 TYR C O doub N N 243 TYR C OXT sing N N 244 TYR CB CG sing N N 245 TYR CB HB2 sing N N 246 TYR CB HB3 sing N N 247 TYR CG CD1 doub Y N 248 TYR CG CD2 sing Y N 249 TYR CD1 CE1 sing Y N 250 TYR CD1 HD1 sing N N 251 TYR CD2 CE2 doub Y N 252 TYR CD2 HD2 sing N N 253 TYR CE1 CZ doub Y N 254 TYR CE1 HE1 sing N N 255 TYR CE2 CZ sing Y N 256 TYR CE2 HE2 sing N N 257 TYR CZ OH sing N N 258 TYR OH HH sing N N 259 TYR OXT HXT sing N N 260 VAL N CA sing N N 261 VAL N H sing N N 262 VAL N H2 sing N N 263 VAL CA C sing N N 264 VAL CA CB sing N N 265 VAL CA HA sing N N 266 VAL C O doub N N 267 VAL C OXT sing N N 268 VAL CB CG1 sing N N 269 VAL CB CG2 sing N N 270 VAL CB HB sing N N 271 VAL CG1 HG11 sing N N 272 VAL CG1 HG12 sing N N 273 VAL CG1 HG13 sing N N 274 VAL CG2 HG21 sing N N 275 VAL CG2 HG22 sing N N 276 VAL CG2 HG23 sing N N 277 VAL OXT HXT sing N N 278 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' 'R35 NS105038' 1 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' 'R37 NS065071' 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6OFA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_