data_6OGH # _entry.id 6OGH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.325 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6OGH WWPDB D_1000240626 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Structure of apo-AeOBP22' _pdbx_database_related.db_id 6OG0 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OGH _pdbx_database_status.recvd_initial_deposition_date 2019-04-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jones, D.N.' 1 0000-0002-7586-3543 'Wang, J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 3300 _citation.page_last 3300 _citation.title 'Aedes aegypti Odorant Binding Protein 22 selectively binds fatty acids through a conformational change in its C-terminal tail.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-020-60242-9 _citation.pdbx_database_id_PubMed 32094450 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, J.' 1 ? primary 'Murphy, E.J.' 2 ? primary 'Nix, J.C.' 3 ? primary 'Jones, D.N.M.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 92.78 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6OGH _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.964 _cell.length_a_esd ? _cell.length_b 42.843 _cell.length_b_esd ? _cell.length_c 49.320 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OGH _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man AAEL005772-PA 14400.319 1 ? ? ? ? 2 non-polymer syn 'CADMIUM ION' 112.411 2 ? ? ? ? 3 non-polymer syn 'COBALT (II) ION' 58.933 1 ? ? ? ? 4 non-polymer syn 'LINOLEIC ACID' 280.445 1 ? ? ? ? 5 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305 1 ? ? ? ? 6 water nat water 18.015 151 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Odorant binding protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEE VRTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _entity_poly.pdbx_seq_one_letter_code_can ;MEFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEE VRTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PHE n 1 4 THR n 1 5 VAL n 1 6 SER n 1 7 THR n 1 8 THR n 1 9 GLU n 1 10 ASP n 1 11 LEU n 1 12 GLN n 1 13 ARG n 1 14 TYR n 1 15 ARG n 1 16 THR n 1 17 GLU n 1 18 CYS n 1 19 VAL n 1 20 SER n 1 21 SER n 1 22 LEU n 1 23 ASN n 1 24 ILE n 1 25 PRO n 1 26 ALA n 1 27 ASP n 1 28 TYR n 1 29 VAL n 1 30 GLU n 1 31 LYS n 1 32 PHE n 1 33 LYS n 1 34 LYS n 1 35 TRP n 1 36 GLU n 1 37 PHE n 1 38 PRO n 1 39 GLU n 1 40 ASP n 1 41 ASP n 1 42 THR n 1 43 THR n 1 44 MET n 1 45 CYS n 1 46 TYR n 1 47 ILE n 1 48 LYS n 1 49 CYS n 1 50 VAL n 1 51 PHE n 1 52 ASN n 1 53 LYS n 1 54 MET n 1 55 GLN n 1 56 LEU n 1 57 PHE n 1 58 ASP n 1 59 ASP n 1 60 THR n 1 61 GLU n 1 62 GLY n 1 63 PRO n 1 64 LEU n 1 65 VAL n 1 66 ASP n 1 67 ASN n 1 68 LEU n 1 69 VAL n 1 70 HIS n 1 71 GLN n 1 72 LEU n 1 73 ALA n 1 74 HIS n 1 75 GLY n 1 76 ARG n 1 77 ASP n 1 78 ALA n 1 79 GLU n 1 80 GLU n 1 81 VAL n 1 82 ARG n 1 83 THR n 1 84 GLU n 1 85 VAL n 1 86 LEU n 1 87 LYS n 1 88 CYS n 1 89 VAL n 1 90 ASP n 1 91 LYS n 1 92 ASN n 1 93 THR n 1 94 ASP n 1 95 ASN n 1 96 ASN n 1 97 ALA n 1 98 CYS n 1 99 HIS n 1 100 TRP n 1 101 ALA n 1 102 PHE n 1 103 ARG n 1 104 GLY n 1 105 PHE n 1 106 LYS n 1 107 CYS n 1 108 PHE n 1 109 GLN n 1 110 LYS n 1 111 ASN n 1 112 ASN n 1 113 LEU n 1 114 SER n 1 115 LEU n 1 116 ILE n 1 117 LYS n 1 118 ALA n 1 119 SER n 1 120 ILE n 1 121 LYS n 1 122 LYS n 1 123 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 123 _entity_src_gen.gene_src_common_name 'Yellowfever mosquito' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene '5567053, AAEL005772' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue 'Antennal cDNA' _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aedes aegypti' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7159 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET13a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q1HRL7_AEDAE _struct_ref.pdbx_db_accession Q1HRL7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EFTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFNKMQLFDDTEGPLVDNLVHQLAHGRDAEEV RTEVLKCVDKNTDNNACHWAFRGFKCFQKNNLSLIKASIKKD ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6OGH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1HRL7 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 123 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6OGH _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q1HRL7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CO non-polymer . 'COBALT (II) ION' ? 'Co 2' 58.933 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EIC non-polymer . 'LINOLEIC ACID' '9,12-LINOLEIC ACID' 'C18 H32 O2' 280.445 EPE non-polymer . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OGH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.09 _exptl_crystal.description plate _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350 12 w/v, 0.1M sodium HEPES, 4mM cadmium chloride, 4mM cobalt chloride, 4mM magnesium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'VariMax Cu-HF' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 200K-A' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 17.38 _reflns.entry_id 6OGH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.85 _reflns.d_resolution_low 27.95 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10076 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.92 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.3 _reflns.pdbx_Rmerge_I_obs 0.0651 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 45.41 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06736 _reflns.pdbx_Rpim_I_all 0.01717 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.85 _reflns_shell.d_res_low 1.916 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 28.57 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 987 _reflns_shell.percent_possible_all 99.70 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.106 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 14 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.1101 _reflns_shell.pdbx_Rpim_I_all 0.02926 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.998 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.10 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.03 _refine.aniso_B[2][2] -0.08 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.18 _refine.B_iso_max ? _refine.B_iso_mean 21.116 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.935 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OGH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.85 _refine.ls_d_res_low 28.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9084 _refine.ls_number_reflns_R_free 1009 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.86 _refine.ls_percent_reflns_R_free 10.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.16975 _refine.ls_R_factor_R_free 0.20630 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.16583 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.170 _refine.pdbx_overall_ESU_R_Free 0.144 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.455 _refine.overall_SU_ML 0.066 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 28.00 _refine_hist.number_atoms_solvent 151 _refine_hist.number_atoms_total 1175 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 986 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.012 1085 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.018 1030 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.063 1.670 1466 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.381 1.611 2356 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.493 5.000 128 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.758 22.727 66 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.602 15.000 189 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 24.047 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.065 0.200 138 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 1248 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 264 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.989 1.869 503 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.987 1.861 502 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.584 2.780 634 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.585 2.790 635 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.368 2.120 582 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.367 2.124 583 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 2.298 3.108 833 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.255 23.875 1304 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.254 23.898 1305 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.849 _refine_ls_shell.d_res_low 1.897 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 74 _refine_ls_shell.number_reflns_R_work 634 _refine_ls_shell.percent_reflns_obs 98.74 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.292 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.192 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6OGH _struct.title 'Structure of Aedes aegypti OBP22 in the complex with linoleic acid' _struct.pdbx_descriptor AAEL005772-PA _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OGH _struct_keywords.text 'Odorant binding protein, Chemo-sensory signaling, Lipid binding, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? ASN A 23 ? THR A 7 ASN A 23 1 ? 17 HELX_P HELX_P2 AA2 PRO A 25 ? LYS A 34 ? PRO A 25 LYS A 34 1 ? 10 HELX_P HELX_P3 AA3 ASP A 40 ? MET A 54 ? ASP A 40 MET A 54 1 ? 15 HELX_P HELX_P4 AA4 LEU A 64 ? ALA A 73 ? LEU A 64 ALA A 73 1 ? 10 HELX_P HELX_P5 AA5 ASP A 77 ? CYS A 88 ? ASP A 77 CYS A 88 1 ? 12 HELX_P HELX_P6 AA6 ASN A 96 ? ILE A 120 ? ASN A 96 ILE A 120 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 18 A CYS 49 1_555 ? ? ? ? ? ? ? 2.350 ? disulf2 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 45 A CYS 98 1_555 ? ? ? ? ? ? ? 2.182 ? disulf3 disulf ? ? A CYS 88 SG ? ? ? 1_555 A CYS 107 SG ? ? A CYS 88 A CYS 107 1_555 ? ? ? ? ? ? ? 2.233 ? metalc1 metalc ? ? A GLU 39 OE1 ? ? ? 1_555 B CD . CD ? ? A GLU 39 A CD 201 1_555 ? ? ? ? ? ? ? 2.215 ? metalc2 metalc ? ? A GLU 39 OE2 ? ? ? 1_555 B CD . CD ? ? A GLU 39 A CD 201 1_555 ? ? ? ? ? ? ? 2.644 ? metalc3 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 C CD . CD ? ? A ASP 66 A CD 202 1_555 ? ? ? ? ? ? ? 2.504 ? metalc4 metalc ? ? A ASP 66 OD2 ? ? ? 1_555 C CD . CD ? ? A ASP 66 A CD 202 1_555 ? ? ? ? ? ? ? 2.538 ? metalc5 metalc ? ? A HIS 70 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 70 A CD 202 1_555 ? ? ? ? ? ? ? 2.207 ? metalc6 metalc ? ? A HIS 74 ND1 ? ? ? 1_555 D CO . CO ? ? A HIS 74 A CO 203 1_555 ? ? ? ? ? ? ? 2.335 ? metalc7 metalc ? ? A ASP 123 OD1 ? ? ? 1_555 D CO . CO ? ? A ASP 123 A CO 203 1_555 ? ? ? ? ? ? ? 2.061 ? metalc8 metalc ? ? A ASP 123 OD2 ? ? ? 1_555 D CO . CO ? ? A ASP 123 A CO 203 1_555 ? ? ? ? ? ? ? 2.702 ? metalc9 metalc ? ? C CD . CD ? ? ? 1_555 G HOH . O ? ? A CD 202 A HOH 407 1_555 ? ? ? ? ? ? ? 2.271 ? metalc10 metalc ? ? D CO . CO ? ? ? 1_555 G HOH . O ? ? A CO 203 A HOH 328 1_555 ? ? ? ? ? ? ? 2.056 ? metalc11 metalc ? ? D CO . CO ? ? ? 1_555 G HOH . O ? ? A CO 203 A HOH 414 1_555 ? ? ? ? ? ? ? 2.164 ? metalc12 metalc ? ? D CO . CO ? ? ? 1_555 G HOH . O ? ? A CO 203 A HOH 360 1_555 ? ? ? ? ? ? ? 2.208 ? metalc13 metalc ? ? A GLU 9 OE1 ? ? ? 1_555 C CD . CD ? ? A GLU 9 A CD 202 4_555 ? ? ? ? ? ? ? 2.317 ? metalc14 metalc ? ? A GLU 9 OE2 ? ? ? 1_555 C CD . CD ? ? A GLU 9 A CD 202 4_555 ? ? ? ? ? ? ? 2.369 ? metalc15 metalc ? ? A ASP 41 OD1 ? ? ? 1_555 B CD . CD ? ? A ASP 41 A CD 201 2_556 ? ? ? ? ? ? ? 2.256 ? metalc16 metalc ? ? A ASP 41 OD2 ? ? ? 1_555 B CD . CD ? ? A ASP 41 A CD 201 2_556 ? ? ? ? ? ? ? 2.505 ? metalc17 metalc ? ? A GLU 80 OE1 ? ? ? 1_555 B CD . CD ? ? A GLU 80 A CD 201 4_546 ? ? ? ? ? ? ? 2.583 ? metalc18 metalc ? ? A GLU 80 OE2 ? ? ? 1_555 B CD . CD ? ? A GLU 80 A CD 201 4_546 ? ? ? ? ? ? ? 2.296 ? metalc19 metalc ? ? A HIS 99 NE2 ? ? ? 1_555 B CD . CD ? ? A HIS 99 A CD 201 2_556 ? ? ? ? ? ? ? 2.365 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ASP A 58 ? PHE A 57 ASP A 58 AA1 2 GLY A 62 ? PRO A 63 ? GLY A 62 PRO A 63 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ASP _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 58 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 58 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 62 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 62 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CD 201 ? 4 'binding site for residue CD A 201' AC2 Software A CD 202 ? 5 'binding site for residue CD A 202' AC3 Software A CO 203 ? 5 'binding site for residue CO A 203' AC4 Software A EIC 204 ? 11 'binding site for residue EIC A 204' AC5 Software A EPE 205 ? 12 'binding site for residue EPE A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 39 ? GLU A 39 . ? 1_555 ? 2 AC1 4 ASP A 41 ? ASP A 41 . ? 2_556 ? 3 AC1 4 GLU A 80 ? GLU A 80 . ? 4_556 ? 4 AC1 4 HIS A 99 ? HIS A 99 . ? 2_556 ? 5 AC2 5 GLU A 9 ? GLU A 9 . ? 4_545 ? 6 AC2 5 ASP A 66 ? ASP A 66 . ? 1_555 ? 7 AC2 5 HIS A 70 ? HIS A 70 . ? 1_555 ? 8 AC2 5 HOH G . ? HOH A 382 . ? 1_555 ? 9 AC2 5 HOH G . ? HOH A 407 . ? 1_555 ? 10 AC3 5 HIS A 74 ? HIS A 74 . ? 1_555 ? 11 AC3 5 ASP A 123 ? ASP A 123 . ? 1_555 ? 12 AC3 5 HOH G . ? HOH A 328 . ? 1_555 ? 13 AC3 5 HOH G . ? HOH A 360 . ? 1_555 ? 14 AC3 5 HOH G . ? HOH A 414 . ? 1_555 ? 15 AC4 11 ARG A 15 ? ARG A 15 . ? 1_555 ? 16 AC4 11 PHE A 37 ? PHE A 37 . ? 1_555 ? 17 AC4 11 TYR A 46 ? TYR A 46 . ? 1_555 ? 18 AC4 11 ILE A 47 ? ILE A 47 . ? 1_555 ? 19 AC4 11 VAL A 85 ? VAL A 85 . ? 1_555 ? 20 AC4 11 CYS A 88 ? CYS A 88 . ? 1_555 ? 21 AC4 11 GLY A 104 ? GLY A 104 . ? 1_555 ? 22 AC4 11 SER A 119 ? SER A 119 . ? 1_555 ? 23 AC4 11 ILE A 120 ? ILE A 120 . ? 1_555 ? 24 AC4 11 HOH G . ? HOH A 329 . ? 1_555 ? 25 AC4 11 HOH G . ? HOH A 345 . ? 1_555 ? 26 AC5 12 GLU A 36 ? GLU A 36 . ? 4_546 ? 27 AC5 12 PHE A 37 ? PHE A 37 . ? 4_546 ? 28 AC5 12 GLU A 39 ? GLU A 39 . ? 4_546 ? 29 AC5 12 ARG A 76 ? ARG A 76 . ? 1_555 ? 30 AC5 12 GLU A 80 ? GLU A 80 . ? 1_555 ? 31 AC5 12 GLU A 84 ? GLU A 84 . ? 1_555 ? 32 AC5 12 ASN A 111 ? ASN A 111 . ? 1_555 ? 33 AC5 12 ASN A 112 ? ASN A 112 . ? 1_555 ? 34 AC5 12 SER A 114 ? SER A 114 . ? 1_555 ? 35 AC5 12 LEU A 115 ? LEU A 115 . ? 1_555 ? 36 AC5 12 HOH G . ? HOH A 310 . ? 4_546 ? 37 AC5 12 HOH G . ? HOH A 371 . ? 1_555 ? # _atom_sites.entry_id 6OGH _atom_sites.fract_transf_matrix[1][1] 0.017869 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000868 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023341 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020300 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CD CO H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ASP 123 123 123 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CD 1 201 1 CD CD A . C 2 CD 1 202 2 CD CD A . D 3 CO 1 203 2 CO CO A . E 4 EIC 1 204 1 EIC EIC A . F 5 EPE 1 205 1 EPE EPE A . G 6 HOH 1 301 237 HOH HOH A . G 6 HOH 2 302 148 HOH HOH A . G 6 HOH 3 303 115 HOH HOH A . G 6 HOH 4 304 105 HOH HOH A . G 6 HOH 5 305 223 HOH HOH A . G 6 HOH 6 306 143 HOH HOH A . G 6 HOH 7 307 5 HOH HOH A . G 6 HOH 8 308 141 HOH HOH A . G 6 HOH 9 309 19 HOH HOH A . G 6 HOH 10 310 160 HOH HOH A . G 6 HOH 11 311 24 HOH HOH A . G 6 HOH 12 312 197 HOH HOH A . G 6 HOH 13 313 145 HOH HOH A . G 6 HOH 14 314 112 HOH HOH A . G 6 HOH 15 315 196 HOH HOH A . G 6 HOH 16 316 157 HOH HOH A . G 6 HOH 17 317 205 HOH HOH A . G 6 HOH 18 318 12 HOH HOH A . G 6 HOH 19 319 154 HOH HOH A . G 6 HOH 20 320 152 HOH HOH A . G 6 HOH 21 321 22 HOH HOH A . G 6 HOH 22 322 18 HOH HOH A . G 6 HOH 23 323 189 HOH HOH A . G 6 HOH 24 324 214 HOH HOH A . G 6 HOH 25 325 185 HOH HOH A . G 6 HOH 26 326 144 HOH HOH A . G 6 HOH 27 327 229 HOH HOH A . G 6 HOH 28 328 231 HOH HOH A . G 6 HOH 29 329 101 HOH HOH A . G 6 HOH 30 330 122 HOH HOH A . G 6 HOH 31 331 219 HOH HOH A . G 6 HOH 32 332 213 HOH HOH A . G 6 HOH 33 333 33 HOH HOH A . G 6 HOH 34 334 27 HOH HOH A . G 6 HOH 35 335 99 HOH HOH A . G 6 HOH 36 336 173 HOH HOH A . G 6 HOH 37 337 76 HOH HOH A . G 6 HOH 38 338 235 HOH HOH A . G 6 HOH 39 339 70 HOH HOH A . G 6 HOH 40 340 216 HOH HOH A . G 6 HOH 41 341 228 HOH HOH A . G 6 HOH 42 342 110 HOH HOH A . G 6 HOH 43 343 73 HOH HOH A . G 6 HOH 44 344 150 HOH HOH A . G 6 HOH 45 345 98 HOH HOH A . G 6 HOH 46 346 1 HOH HOH A . G 6 HOH 47 347 181 HOH HOH A . G 6 HOH 48 348 114 HOH HOH A . G 6 HOH 49 349 48 HOH HOH A . G 6 HOH 50 350 13 HOH HOH A . G 6 HOH 51 351 21 HOH HOH A . G 6 HOH 52 352 108 HOH HOH A . G 6 HOH 53 353 194 HOH HOH A . G 6 HOH 54 354 187 HOH HOH A . G 6 HOH 55 355 234 HOH HOH A . G 6 HOH 56 356 41 HOH HOH A . G 6 HOH 57 357 212 HOH HOH A . G 6 HOH 58 358 106 HOH HOH A . G 6 HOH 59 359 53 HOH HOH A . G 6 HOH 60 360 167 HOH HOH A . G 6 HOH 61 361 3 HOH HOH A . G 6 HOH 62 362 4 HOH HOH A . G 6 HOH 63 363 9 HOH HOH A . G 6 HOH 64 364 139 HOH HOH A . G 6 HOH 65 365 104 HOH HOH A . G 6 HOH 66 366 49 HOH HOH A . G 6 HOH 67 367 26 HOH HOH A . G 6 HOH 68 368 68 HOH HOH A . G 6 HOH 69 369 188 HOH HOH A . G 6 HOH 70 370 15 HOH HOH A . G 6 HOH 71 371 32 HOH HOH A . G 6 HOH 72 372 124 HOH HOH A . G 6 HOH 73 373 233 HOH HOH A . G 6 HOH 74 374 45 HOH HOH A . G 6 HOH 75 375 147 HOH HOH A . G 6 HOH 76 376 2 HOH HOH A . G 6 HOH 77 377 130 HOH HOH A . G 6 HOH 78 378 170 HOH HOH A . G 6 HOH 79 379 123 HOH HOH A . G 6 HOH 80 380 97 HOH HOH A . G 6 HOH 81 381 35 HOH HOH A . G 6 HOH 82 382 202 HOH HOH A . G 6 HOH 83 383 198 HOH HOH A . G 6 HOH 84 384 7 HOH HOH A . G 6 HOH 85 385 28 HOH HOH A . G 6 HOH 86 386 191 HOH HOH A . G 6 HOH 87 387 43 HOH HOH A . G 6 HOH 88 388 103 HOH HOH A . G 6 HOH 89 389 88 HOH HOH A . G 6 HOH 90 390 10 HOH HOH A . G 6 HOH 91 391 230 HOH HOH A . G 6 HOH 92 392 62 HOH HOH A . G 6 HOH 93 393 36 HOH HOH A . G 6 HOH 94 394 206 HOH HOH A . G 6 HOH 95 395 14 HOH HOH A . G 6 HOH 96 396 23 HOH HOH A . G 6 HOH 97 397 117 HOH HOH A . G 6 HOH 98 398 184 HOH HOH A . G 6 HOH 99 399 199 HOH HOH A . G 6 HOH 100 400 8 HOH HOH A . G 6 HOH 101 401 100 HOH HOH A . G 6 HOH 102 402 102 HOH HOH A . G 6 HOH 103 403 169 HOH HOH A . G 6 HOH 104 404 135 HOH HOH A . G 6 HOH 105 405 133 HOH HOH A . G 6 HOH 106 406 159 HOH HOH A . G 6 HOH 107 407 20 HOH HOH A . G 6 HOH 108 408 136 HOH HOH A . G 6 HOH 109 409 39 HOH HOH A . G 6 HOH 110 410 178 HOH HOH A . G 6 HOH 111 411 82 HOH HOH A . G 6 HOH 112 412 162 HOH HOH A . G 6 HOH 113 413 158 HOH HOH A . G 6 HOH 114 414 232 HOH HOH A . G 6 HOH 115 415 116 HOH HOH A . G 6 HOH 116 416 30 HOH HOH A . G 6 HOH 117 417 174 HOH HOH A . G 6 HOH 118 418 58 HOH HOH A . G 6 HOH 119 419 118 HOH HOH A . G 6 HOH 120 420 183 HOH HOH A . G 6 HOH 121 421 132 HOH HOH A . G 6 HOH 122 422 120 HOH HOH A . G 6 HOH 123 423 109 HOH HOH A . G 6 HOH 124 424 107 HOH HOH A . G 6 HOH 125 425 131 HOH HOH A . G 6 HOH 126 426 215 HOH HOH A . G 6 HOH 127 427 236 HOH HOH A . G 6 HOH 128 428 146 HOH HOH A . G 6 HOH 129 429 220 HOH HOH A . G 6 HOH 130 430 134 HOH HOH A . G 6 HOH 131 431 209 HOH HOH A . G 6 HOH 132 432 140 HOH HOH A . G 6 HOH 133 433 201 HOH HOH A . G 6 HOH 134 434 31 HOH HOH A . G 6 HOH 135 435 195 HOH HOH A . G 6 HOH 136 436 40 HOH HOH A . G 6 HOH 137 437 176 HOH HOH A . G 6 HOH 138 438 207 HOH HOH A . G 6 HOH 139 439 182 HOH HOH A . G 6 HOH 140 440 204 HOH HOH A . G 6 HOH 141 441 211 HOH HOH A . G 6 HOH 142 442 111 HOH HOH A . G 6 HOH 143 443 186 HOH HOH A . G 6 HOH 144 444 224 HOH HOH A . G 6 HOH 145 445 217 HOH HOH A . G 6 HOH 146 446 203 HOH HOH A . G 6 HOH 147 447 121 HOH HOH A . G 6 HOH 148 448 210 HOH HOH A . G 6 HOH 149 449 151 HOH HOH A . G 6 HOH 150 450 208 HOH HOH A . G 6 HOH 151 451 225 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 383 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 52.6 ? 2 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OD1 ? A ASP 41 ? A ASP 41 ? 1_555 40.4 ? 3 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OD1 ? A ASP 41 ? A ASP 41 ? 1_555 47.7 ? 4 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 37.2 ? 5 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 55.6 ? 6 OD1 ? A ASP 41 ? A ASP 41 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 9.6 ? 7 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 109.3 ? 8 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 57.9 ? 9 OD1 ? A ASP 41 ? A ASP 41 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 97.3 ? 10 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 106.9 ? 11 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 112.4 ? 12 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 61.1 ? 13 OD1 ? A ASP 41 ? A ASP 41 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 100.1 ? 14 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 109.7 ? 15 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 3.1 ? 16 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 56.0 ? 17 OE2 ? A GLU 39 ? A GLU 39 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 53.3 ? 18 OD1 ? A ASP 41 ? A ASP 41 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 15.6 ? 19 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 21.0 ? 20 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 92.4 ? 21 OE2 ? A GLU 80 ? A GLU 80 ? 1_555 CD ? B CD . ? A CD 201 ? 1_555 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 94.7 ? 22 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 51.8 ? 23 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 92.1 ? 24 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 86.5 ? 25 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 407 ? 1_555 83.7 ? 26 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 407 ? 1_555 85.9 ? 27 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 O ? G HOH . ? A HOH 407 ? 1_555 172.4 ? 28 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 100.4 ? 29 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 80.6 ? 30 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 16.8 ? 31 O ? G HOH . ? A HOH 407 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 158.8 ? 32 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 100.8 ? 33 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 77.8 ? 34 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 20.9 ? 35 O ? G HOH . ? A HOH 407 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 154.4 ? 36 OE1 ? A GLU 9 ? A GLU 9 ? 1_555 CD ? C CD . ? A CD 202 ? 1_555 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 4.4 ? 37 ND1 ? A HIS 74 ? A HIS 74 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 91.6 ? 38 ND1 ? A HIS 74 ? A HIS 74 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 92.0 ? 39 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 53.0 ? 40 ND1 ? A HIS 74 ? A HIS 74 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 328 ? 1_555 163.0 ? 41 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 328 ? 1_555 82.3 ? 42 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 328 ? 1_555 96.8 ? 43 ND1 ? A HIS 74 ? A HIS 74 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 414 ? 1_555 95.4 ? 44 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 414 ? 1_555 156.5 ? 45 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 414 ? 1_555 148.5 ? 46 O ? G HOH . ? A HOH 328 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 414 ? 1_555 84.6 ? 47 ND1 ? A HIS 74 ? A HIS 74 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 360 ? 1_555 83.5 ? 48 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 360 ? 1_555 82.1 ? 49 OD2 ? A ASP 123 ? A ASP 123 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 360 ? 1_555 134.8 ? 50 O ? G HOH . ? A HOH 328 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 360 ? 1_555 80.1 ? 51 O ? G HOH . ? A HOH 414 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O ? G HOH . ? A HOH 360 ? 1_555 76.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-04-24 2 'Structure model' 1 1 2019-11-20 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2020-05-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_struct_conn_angle 2 2 'Structure model' struct_conn 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' citation 5 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_citation.country' 3 4 'Structure model' '_citation.journal_abbrev' 4 4 'Structure model' '_citation.journal_id_CSD' 5 4 'Structure model' '_citation.journal_id_ISSN' 6 4 'Structure model' '_citation.journal_volume' 7 4 'Structure model' '_citation.page_first' 8 4 'Structure model' '_citation.page_last' 9 4 'Structure model' '_citation.pdbx_database_id_DOI' 10 4 'Structure model' '_citation.pdbx_database_id_PubMed' 11 4 'Structure model' '_citation.title' 12 4 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 449 ? 6.10 . 2 1 O ? A HOH 450 ? 6.16 . 3 1 O ? A HOH 451 ? 6.86 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 122 ? CG ? A LYS 122 CG 2 1 Y 1 A LYS 122 ? CD ? A LYS 122 CD 3 1 Y 1 A LYS 122 ? CE ? A LYS 122 CE 4 1 Y 1 A LYS 122 ? NZ ? A LYS 122 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI121253 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CADMIUM ION' CD 3 'COBALT (II) ION' CO 4 'LINOLEIC ACID' EIC 5 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'fluorescence resonance energy transfer' _pdbx_struct_assembly_auth_evidence.details 'Fluorescence competition binding assays and NMR titrations support binding of lipid to protein' #