data_6OVA
#
_entry.id 6OVA
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.387
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 6OVA pdb_00006ova 10.2210/pdb6ova/pdb
WWPDB D_1000241122 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2020-02-12
2 'Structure model' 1 1 2024-03-13
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Data collection'
2 2 'Structure model' 'Database references'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' chem_comp_atom
2 2 'Structure model' chem_comp_bond
3 2 'Structure model' database_2
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_database_2.pdbx_DOI'
2 2 'Structure model' '_database_2.pdbx_database_accession'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 6OVA
_pdbx_database_status.recvd_initial_deposition_date 2019-05-07
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site RCSB
_pdbx_database_status.process_site RCSB
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
_pdbx_database_status.status_code_nmr_data ?
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Skene, R.J.' 1 0000-0002-1482-6546
'Hoffman, I.D.' 2 0000-0003-2694-802X
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country UK
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev Bioorg.Med.Chem.Lett.
_citation.journal_id_ASTM BMCLE8
_citation.journal_id_CSD 1127
_citation.journal_id_ISSN 1464-3405
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 30
_citation.language ?
_citation.page_first 126963
_citation.page_last 126963
_citation.title
;Efficient synthesis of tert-butyl 3-cyano-3-cyclopropyl-2-oxopyrrolidine-4-carboxylates: Highly functionalized 2-pyrrolidinone enabling access to novel macrocyclic Tyk2 inhibitors.
;
_citation.year 2020
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1016/j.bmcl.2020.126963
_citation.pdbx_database_id_PubMed 31980341
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Sasaki, Y.' 1 ?
primary 'Tokuhara, H.' 2 ?
primary 'Ohba, Y.' 3 ?
primary 'Okabe, A.' 4 ?
primary 'Nakayama, M.' 5 ?
primary 'Nakagawa, H.' 6 ?
primary 'Skene, R.' 7 ?
primary 'Hoffman, I.' 8 ?
primary 'Zou, H.' 9 ?
primary 'Yoshida, M.' 10 ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Non-receptor tyrosine-protein kinase TYK2'
34844.863 1 2.7.10.2 ? 'residues 884-1176' ?
2 non-polymer syn '6-({4-[(3S)-3-cyano-3-cyclopropyl-2-oxopyrrolidin-1-yl]pyridin-2-yl}amino)-N,N-dimethylpyridine-3-carboxamide'
390.438 1 ? ? ? ?
3 water nat water
18.015 50 ? ? ? ?
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;MGSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIK
YKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRNLAARNVLLDNDRLVKIGD
FGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTV
LRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can
;MGSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIK
YKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRNLAARNVLLDNDRLVKIGD
FGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTV
LRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYHHHHHH
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2 '6-({4-[(3S)-3-cyano-3-cyclopropyl-2-oxopyrrolidin-1-yl]pyridin-2-yl}amino)-N,N-dimethylpyridine-3-carboxamide' N9G
3 water HOH
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MET n
1 2 GLY n
1 3 SER n
1 4 PRO n
1 5 ALA n
1 6 SER n
1 7 ASP n
1 8 PRO n
1 9 THR n
1 10 VAL n
1 11 PHE n
1 12 HIS n
1 13 LYS n
1 14 ARG n
1 15 TYR n
1 16 LEU n
1 17 LYS n
1 18 LYS n
1 19 ILE n
1 20 ARG n
1 21 ASP n
1 22 LEU n
1 23 GLY n
1 24 GLU n
1 25 GLY n
1 26 HIS n
1 27 PHE n
1 28 GLY n
1 29 LYS n
1 30 VAL n
1 31 SER n
1 32 LEU n
1 33 TYR n
1 34 CYS n
1 35 TYR n
1 36 ASP n
1 37 PRO n
1 38 THR n
1 39 ASN n
1 40 ASP n
1 41 GLY n
1 42 THR n
1 43 GLY n
1 44 GLU n
1 45 MET n
1 46 VAL n
1 47 ALA n
1 48 VAL n
1 49 LYS n
1 50 ALA n
1 51 LEU n
1 52 LYS n
1 53 ALA n
1 54 ASP n
1 55 CYS n
1 56 GLY n
1 57 PRO n
1 58 GLN n
1 59 HIS n
1 60 ARG n
1 61 SER n
1 62 GLY n
1 63 TRP n
1 64 LYS n
1 65 GLN n
1 66 GLU n
1 67 ILE n
1 68 ASP n
1 69 ILE n
1 70 LEU n
1 71 ARG n
1 72 THR n
1 73 LEU n
1 74 TYR n
1 75 HIS n
1 76 GLU n
1 77 HIS n
1 78 ILE n
1 79 ILE n
1 80 LYS n
1 81 TYR n
1 82 LYS n
1 83 GLY n
1 84 CYS n
1 85 CYS n
1 86 GLU n
1 87 ASP n
1 88 GLN n
1 89 GLY n
1 90 GLU n
1 91 LYS n
1 92 SER n
1 93 LEU n
1 94 GLN n
1 95 LEU n
1 96 VAL n
1 97 MET n
1 98 GLU n
1 99 TYR n
1 100 VAL n
1 101 PRO n
1 102 LEU n
1 103 GLY n
1 104 SER n
1 105 LEU n
1 106 ARG n
1 107 ASP n
1 108 TYR n
1 109 LEU n
1 110 PRO n
1 111 ARG n
1 112 HIS n
1 113 SER n
1 114 ILE n
1 115 GLY n
1 116 LEU n
1 117 ALA n
1 118 GLN n
1 119 LEU n
1 120 LEU n
1 121 LEU n
1 122 PHE n
1 123 ALA n
1 124 GLN n
1 125 GLN n
1 126 ILE n
1 127 CYS n
1 128 GLU n
1 129 GLY n
1 130 MET n
1 131 ALA n
1 132 TYR n
1 133 LEU n
1 134 HIS n
1 135 SER n
1 136 GLN n
1 137 HIS n
1 138 TYR n
1 139 ILE n
1 140 HIS n
1 141 ARG n
1 142 ASN n
1 143 LEU n
1 144 ALA n
1 145 ALA n
1 146 ARG n
1 147 ASN n
1 148 VAL n
1 149 LEU n
1 150 LEU n
1 151 ASP n
1 152 ASN n
1 153 ASP n
1 154 ARG n
1 155 LEU n
1 156 VAL n
1 157 LYS n
1 158 ILE n
1 159 GLY n
1 160 ASP n
1 161 PHE n
1 162 GLY n
1 163 LEU n
1 164 ALA n
1 165 LYS n
1 166 ALA n
1 167 VAL n
1 168 PRO n
1 169 GLU n
1 170 GLY n
1 171 HIS n
1 172 GLU n
1 173 TYR n
1 174 TYR n
1 175 ARG n
1 176 VAL n
1 177 ARG n
1 178 GLU n
1 179 ASP n
1 180 GLY n
1 181 ASP n
1 182 SER n
1 183 PRO n
1 184 VAL n
1 185 PHE n
1 186 TRP n
1 187 TYR n
1 188 ALA n
1 189 PRO n
1 190 GLU n
1 191 CYS n
1 192 LEU n
1 193 LYS n
1 194 GLU n
1 195 TYR n
1 196 LYS n
1 197 PHE n
1 198 TYR n
1 199 TYR n
1 200 ALA n
1 201 SER n
1 202 ASP n
1 203 VAL n
1 204 TRP n
1 205 SER n
1 206 PHE n
1 207 GLY n
1 208 VAL n
1 209 THR n
1 210 LEU n
1 211 TYR n
1 212 GLU n
1 213 LEU n
1 214 LEU n
1 215 THR n
1 216 HIS n
1 217 CYS n
1 218 ASP n
1 219 SER n
1 220 SER n
1 221 GLN n
1 222 SER n
1 223 PRO n
1 224 PRO n
1 225 THR n
1 226 LYS n
1 227 PHE n
1 228 LEU n
1 229 GLU n
1 230 LEU n
1 231 ILE n
1 232 GLY n
1 233 ILE n
1 234 ALA n
1 235 GLN n
1 236 GLY n
1 237 GLN n
1 238 MET n
1 239 THR n
1 240 VAL n
1 241 LEU n
1 242 ARG n
1 243 LEU n
1 244 THR n
1 245 GLU n
1 246 LEU n
1 247 LEU n
1 248 GLU n
1 249 ARG n
1 250 GLY n
1 251 GLU n
1 252 ARG n
1 253 LEU n
1 254 PRO n
1 255 ARG n
1 256 PRO n
1 257 ASP n
1 258 LYS n
1 259 CYS n
1 260 PRO n
1 261 CYS n
1 262 GLU n
1 263 VAL n
1 264 TYR n
1 265 HIS n
1 266 LEU n
1 267 MET n
1 268 LYS n
1 269 ASN n
1 270 CYS n
1 271 TRP n
1 272 GLU n
1 273 THR n
1 274 GLU n
1 275 ALA n
1 276 SER n
1 277 PHE n
1 278 ARG n
1 279 PRO n
1 280 THR n
1 281 PHE n
1 282 GLU n
1 283 ASN n
1 284 LEU n
1 285 ILE n
1 286 PRO n
1 287 ILE n
1 288 LEU n
1 289 LYS n
1 290 THR n
1 291 VAL n
1 292 HIS n
1 293 GLU n
1 294 LYS n
1 295 TYR n
1 296 HIS n
1 297 HIS n
1 298 HIS n
1 299 HIS n
1 300 HIS n
1 301 HIS n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 301
_entity_src_gen.gene_src_common_name Human
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene TYK2
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'unidentified baculovirus'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10469
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ? 'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
N9G non-polymer .
'6-({4-[(3S)-3-cyano-3-cyclopropyl-2-oxopyrrolidin-1-yl]pyridin-2-yl}amino)-N,N-dimethylpyridine-3-carboxamide' ? 'C21 H22 N6 O2'
390.438
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 MET 1 882 ? ? ? A . n
A 1 2 GLY 2 883 ? ? ? A . n
A 1 3 SER 3 884 ? ? ? A . n
A 1 4 PRO 4 885 ? ? ? A . n
A 1 5 ALA 5 886 ? ? ? A . n
A 1 6 SER 6 887 ? ? ? A . n
A 1 7 ASP 7 888 888 ASP ASP A . n
A 1 8 PRO 8 889 889 PRO PRO A . n
A 1 9 THR 9 890 890 THR THR A . n
A 1 10 VAL 10 891 891 VAL VAL A . n
A 1 11 PHE 11 892 892 PHE PHE A . n
A 1 12 HIS 12 893 893 HIS HIS A . n
A 1 13 LYS 13 894 894 LYS LYS A . n
A 1 14 ARG 14 895 895 ARG ARG A . n
A 1 15 TYR 15 896 896 TYR TYR A . n
A 1 16 LEU 16 897 897 LEU LEU A . n
A 1 17 LYS 17 898 898 LYS LYS A . n
A 1 18 LYS 18 899 899 LYS LYS A . n
A 1 19 ILE 19 900 900 ILE ILE A . n
A 1 20 ARG 20 901 901 ARG ARG A . n
A 1 21 ASP 21 902 902 ASP ASP A . n
A 1 22 LEU 22 903 903 LEU LEU A . n
A 1 23 GLY 23 904 904 GLY GLY A . n
A 1 24 GLU 24 905 905 GLU GLU A . n
A 1 25 GLY 25 906 906 GLY GLY A . n
A 1 26 HIS 26 907 907 HIS HIS A . n
A 1 27 PHE 27 908 908 PHE PHE A . n
A 1 28 GLY 28 909 909 GLY GLY A . n
A 1 29 LYS 29 910 910 LYS LYS A . n
A 1 30 VAL 30 911 911 VAL VAL A . n
A 1 31 SER 31 912 912 SER SER A . n
A 1 32 LEU 32 913 913 LEU LEU A . n
A 1 33 TYR 33 914 914 TYR TYR A . n
A 1 34 CYS 34 915 915 CYS CYS A . n
A 1 35 TYR 35 916 916 TYR TYR A . n
A 1 36 ASP 36 917 917 ASP ASP A . n
A 1 37 PRO 37 918 918 PRO PRO A . n
A 1 38 THR 38 919 919 THR THR A . n
A 1 39 ASN 39 920 920 ASN ASN A . n
A 1 40 ASP 40 921 921 ASP ASP A . n
A 1 41 GLY 41 922 922 GLY GLY A . n
A 1 42 THR 42 923 923 THR THR A . n
A 1 43 GLY 43 924 924 GLY GLY A . n
A 1 44 GLU 44 925 925 GLU GLU A . n
A 1 45 MET 45 926 926 MET MET A . n
A 1 46 VAL 46 927 927 VAL VAL A . n
A 1 47 ALA 47 928 928 ALA ALA A . n
A 1 48 VAL 48 929 929 VAL VAL A . n
A 1 49 LYS 49 930 930 LYS LYS A . n
A 1 50 ALA 50 931 931 ALA ALA A . n
A 1 51 LEU 51 932 932 LEU LEU A . n
A 1 52 LYS 52 933 933 LYS LYS A . n
A 1 53 ALA 53 934 ? ? ? A . n
A 1 54 ASP 54 935 ? ? ? A . n
A 1 55 CYS 55 936 ? ? ? A . n
A 1 56 GLY 56 937 ? ? ? A . n
A 1 57 PRO 57 938 ? ? ? A . n
A 1 58 GLN 58 939 ? ? ? A . n
A 1 59 HIS 59 940 ? ? ? A . n
A 1 60 ARG 60 941 ? ? ? A . n
A 1 61 SER 61 942 942 SER SER A . n
A 1 62 GLY 62 943 943 GLY GLY A . n
A 1 63 TRP 63 944 944 TRP TRP A . n
A 1 64 LYS 64 945 945 LYS LYS A . n
A 1 65 GLN 65 946 946 GLN GLN A . n
A 1 66 GLU 66 947 947 GLU GLU A . n
A 1 67 ILE 67 948 948 ILE ILE A . n
A 1 68 ASP 68 949 949 ASP ASP A . n
A 1 69 ILE 69 950 950 ILE ILE A . n
A 1 70 LEU 70 951 951 LEU LEU A . n
A 1 71 ARG 71 952 952 ARG ARG A . n
A 1 72 THR 72 953 953 THR THR A . n
A 1 73 LEU 73 954 954 LEU LEU A . n
A 1 74 TYR 74 955 955 TYR TYR A . n
A 1 75 HIS 75 956 956 HIS HIS A . n
A 1 76 GLU 76 957 957 GLU GLU A . n
A 1 77 HIS 77 958 958 HIS HIS A . n
A 1 78 ILE 78 959 959 ILE ILE A . n
A 1 79 ILE 79 960 960 ILE ILE A . n
A 1 80 LYS 80 961 961 LYS LYS A . n
A 1 81 TYR 81 962 962 TYR TYR A . n
A 1 82 LYS 82 963 963 LYS LYS A . n
A 1 83 GLY 83 964 964 GLY GLY A . n
A 1 84 CYS 84 965 965 CYS CYS A . n
A 1 85 CYS 85 966 966 CYS CYS A . n
A 1 86 GLU 86 967 967 GLU GLU A . n
A 1 87 ASP 87 968 ? ? ? A . n
A 1 88 GLN 88 969 ? ? ? A . n
A 1 89 GLY 89 970 ? ? ? A . n
A 1 90 GLU 90 971 ? ? ? A . n
A 1 91 LYS 91 972 ? ? ? A . n
A 1 92 SER 92 973 973 SER SER A . n
A 1 93 LEU 93 974 974 LEU LEU A . n
A 1 94 GLN 94 975 975 GLN GLN A . n
A 1 95 LEU 95 976 976 LEU LEU A . n
A 1 96 VAL 96 977 977 VAL VAL A . n
A 1 97 MET 97 978 978 MET MET A . n
A 1 98 GLU 98 979 979 GLU GLU A . n
A 1 99 TYR 99 980 980 TYR TYR A . n
A 1 100 VAL 100 981 981 VAL VAL A . n
A 1 101 PRO 101 982 982 PRO PRO A . n
A 1 102 LEU 102 983 983 LEU LEU A . n
A 1 103 GLY 103 984 984 GLY GLY A . n
A 1 104 SER 104 985 985 SER SER A . n
A 1 105 LEU 105 986 986 LEU LEU A . n
A 1 106 ARG 106 987 987 ARG ARG A . n
A 1 107 ASP 107 988 988 ASP ASP A . n
A 1 108 TYR 108 989 989 TYR TYR A . n
A 1 109 LEU 109 990 990 LEU LEU A . n
A 1 110 PRO 110 991 991 PRO PRO A . n
A 1 111 ARG 111 992 992 ARG ARG A . n
A 1 112 HIS 112 993 993 HIS HIS A . n
A 1 113 SER 113 994 994 SER SER A . n
A 1 114 ILE 114 995 995 ILE ILE A . n
A 1 115 GLY 115 996 996 GLY GLY A . n
A 1 116 LEU 116 997 997 LEU LEU A . n
A 1 117 ALA 117 998 998 ALA ALA A . n
A 1 118 GLN 118 999 999 GLN GLN A . n
A 1 119 LEU 119 1000 1000 LEU LEU A . n
A 1 120 LEU 120 1001 1001 LEU LEU A . n
A 1 121 LEU 121 1002 1002 LEU LEU A . n
A 1 122 PHE 122 1003 1003 PHE PHE A . n
A 1 123 ALA 123 1004 1004 ALA ALA A . n
A 1 124 GLN 124 1005 1005 GLN GLN A . n
A 1 125 GLN 125 1006 1006 GLN GLN A . n
A 1 126 ILE 126 1007 1007 ILE ILE A . n
A 1 127 CYS 127 1008 1008 CYS CYS A . n
A 1 128 GLU 128 1009 1009 GLU GLU A . n
A 1 129 GLY 129 1010 1010 GLY GLY A . n
A 1 130 MET 130 1011 1011 MET MET A . n
A 1 131 ALA 131 1012 1012 ALA ALA A . n
A 1 132 TYR 132 1013 1013 TYR TYR A . n
A 1 133 LEU 133 1014 1014 LEU LEU A . n
A 1 134 HIS 134 1015 1015 HIS HIS A . n
A 1 135 SER 135 1016 1016 SER SER A . n
A 1 136 GLN 136 1017 1017 GLN GLN A . n
A 1 137 HIS 137 1018 1018 HIS HIS A . n
A 1 138 TYR 138 1019 1019 TYR TYR A . n
A 1 139 ILE 139 1020 1020 ILE ILE A . n
A 1 140 HIS 140 1021 1021 HIS HIS A . n
A 1 141 ARG 141 1022 1022 ARG ARG A . n
A 1 142 ASN 142 1023 1023 ASN ASN A . n
A 1 143 LEU 143 1024 1024 LEU LEU A . n
A 1 144 ALA 144 1025 1025 ALA ALA A . n
A 1 145 ALA 145 1026 1026 ALA ALA A . n
A 1 146 ARG 146 1027 1027 ARG ARG A . n
A 1 147 ASN 147 1028 1028 ASN ASN A . n
A 1 148 VAL 148 1029 1029 VAL VAL A . n
A 1 149 LEU 149 1030 1030 LEU LEU A . n
A 1 150 LEU 150 1031 1031 LEU LEU A . n
A 1 151 ASP 151 1032 1032 ASP ASP A . n
A 1 152 ASN 152 1033 1033 ASN ASN A . n
A 1 153 ASP 153 1034 1034 ASP ASP A . n
A 1 154 ARG 154 1035 1035 ARG ARG A . n
A 1 155 LEU 155 1036 1036 LEU LEU A . n
A 1 156 VAL 156 1037 1037 VAL VAL A . n
A 1 157 LYS 157 1038 1038 LYS LYS A . n
A 1 158 ILE 158 1039 1039 ILE ILE A . n
A 1 159 GLY 159 1040 1040 GLY GLY A . n
A 1 160 ASP 160 1041 1041 ASP ASP A . n
A 1 161 PHE 161 1042 1042 PHE PHE A . n
A 1 162 GLY 162 1043 1043 GLY GLY A . n
A 1 163 LEU 163 1044 1044 LEU LEU A . n
A 1 164 ALA 164 1045 1045 ALA ALA A . n
A 1 165 LYS 165 1046 1046 LYS LYS A . n
A 1 166 ALA 166 1047 1047 ALA ALA A . n
A 1 167 VAL 167 1048 1048 VAL VAL A . n
A 1 168 PRO 168 1049 1049 PRO PRO A . n
A 1 169 GLU 169 1050 1050 GLU GLU A . n
A 1 170 GLY 170 1051 1051 GLY GLY A . n
A 1 171 HIS 171 1052 1052 HIS HIS A . n
A 1 172 GLU 172 1053 1053 GLU GLU A . n
A 1 173 TYR 173 1054 1054 TYR TYR A . n
A 1 174 TYR 174 1055 1055 TYR TYR A . n
A 1 175 ARG 175 1056 1056 ARG ARG A . n
A 1 176 VAL 176 1057 1057 VAL VAL A . n
A 1 177 ARG 177 1058 1058 ARG ARG A . n
A 1 178 GLU 178 1059 1059 GLU GLU A . n
A 1 179 ASP 179 1060 1060 ASP ASP A . n
A 1 180 GLY 180 1061 1061 GLY GLY A . n
A 1 181 ASP 181 1062 1062 ASP ASP A . n
A 1 182 SER 182 1063 1063 SER SER A . n
A 1 183 PRO 183 1064 1064 PRO PRO A . n
A 1 184 VAL 184 1065 1065 VAL VAL A . n
A 1 185 PHE 185 1066 1066 PHE PHE A . n
A 1 186 TRP 186 1067 1067 TRP TRP A . n
A 1 187 TYR 187 1068 1068 TYR TYR A . n
A 1 188 ALA 188 1069 1069 ALA ALA A . n
A 1 189 PRO 189 1070 1070 PRO PRO A . n
A 1 190 GLU 190 1071 1071 GLU GLU A . n
A 1 191 CYS 191 1072 1072 CYS CYS A . n
A 1 192 LEU 192 1073 1073 LEU LEU A . n
A 1 193 LYS 193 1074 1074 LYS LYS A . n
A 1 194 GLU 194 1075 1075 GLU GLU A . n
A 1 195 TYR 195 1076 1076 TYR TYR A . n
A 1 196 LYS 196 1077 1077 LYS LYS A . n
A 1 197 PHE 197 1078 1078 PHE PHE A . n
A 1 198 TYR 198 1079 1079 TYR TYR A . n
A 1 199 TYR 199 1080 1080 TYR TYR A . n
A 1 200 ALA 200 1081 1081 ALA ALA A . n
A 1 201 SER 201 1082 1082 SER SER A . n
A 1 202 ASP 202 1083 1083 ASP ASP A . n
A 1 203 VAL 203 1084 1084 VAL VAL A . n
A 1 204 TRP 204 1085 1085 TRP TRP A . n
A 1 205 SER 205 1086 1086 SER SER A . n
A 1 206 PHE 206 1087 1087 PHE PHE A . n
A 1 207 GLY 207 1088 1088 GLY GLY A . n
A 1 208 VAL 208 1089 1089 VAL VAL A . n
A 1 209 THR 209 1090 1090 THR THR A . n
A 1 210 LEU 210 1091 1091 LEU LEU A . n
A 1 211 TYR 211 1092 1092 TYR TYR A . n
A 1 212 GLU 212 1093 1093 GLU GLU A . n
A 1 213 LEU 213 1094 1094 LEU LEU A . n
A 1 214 LEU 214 1095 1095 LEU LEU A . n
A 1 215 THR 215 1096 1096 THR THR A . n
A 1 216 HIS 216 1097 1097 HIS HIS A . n
A 1 217 CYS 217 1098 1098 CYS CYS A . n
A 1 218 ASP 218 1099 1099 ASP ASP A . n
A 1 219 SER 219 1100 1100 SER SER A . n
A 1 220 SER 220 1101 1101 SER SER A . n
A 1 221 GLN 221 1102 1102 GLN GLN A . n
A 1 222 SER 222 1103 1103 SER SER A . n
A 1 223 PRO 223 1104 1104 PRO PRO A . n
A 1 224 PRO 224 1105 1105 PRO PRO A . n
A 1 225 THR 225 1106 1106 THR THR A . n
A 1 226 LYS 226 1107 1107 LYS LYS A . n
A 1 227 PHE 227 1108 1108 PHE PHE A . n
A 1 228 LEU 228 1109 1109 LEU LEU A . n
A 1 229 GLU 229 1110 1110 GLU GLU A . n
A 1 230 LEU 230 1111 1111 LEU LEU A . n
A 1 231 ILE 231 1112 1112 ILE ILE A . n
A 1 232 GLY 232 1113 ? ? ? A . n
A 1 233 ILE 233 1114 ? ? ? A . n
A 1 234 ALA 234 1115 1115 ALA ALA A . n
A 1 235 GLN 235 1116 1116 GLN GLN A . n
A 1 236 GLY 236 1117 1117 GLY GLY A . n
A 1 237 GLN 237 1118 1118 GLN GLN A . n
A 1 238 MET 238 1119 1119 MET MET A . n
A 1 239 THR 239 1120 1120 THR THR A . n
A 1 240 VAL 240 1121 1121 VAL VAL A . n
A 1 241 LEU 241 1122 1122 LEU LEU A . n
A 1 242 ARG 242 1123 1123 ARG ARG A . n
A 1 243 LEU 243 1124 1124 LEU LEU A . n
A 1 244 THR 244 1125 1125 THR THR A . n
A 1 245 GLU 245 1126 1126 GLU GLU A . n
A 1 246 LEU 246 1127 1127 LEU LEU A . n
A 1 247 LEU 247 1128 1128 LEU LEU A . n
A 1 248 GLU 248 1129 1129 GLU GLU A . n
A 1 249 ARG 249 1130 1130 ARG ARG A . n
A 1 250 GLY 250 1131 1131 GLY GLY A . n
A 1 251 GLU 251 1132 1132 GLU GLU A . n
A 1 252 ARG 252 1133 1133 ARG ARG A . n
A 1 253 LEU 253 1134 1134 LEU LEU A . n
A 1 254 PRO 254 1135 1135 PRO PRO A . n
A 1 255 ARG 255 1136 1136 ARG ARG A . n
A 1 256 PRO 256 1137 1137 PRO PRO A . n
A 1 257 ASP 257 1138 1138 ASP ASP A . n
A 1 258 LYS 258 1139 1139 LYS LYS A . n
A 1 259 CYS 259 1140 1140 CYS CYS A . n
A 1 260 PRO 260 1141 1141 PRO PRO A . n
A 1 261 CYS 261 1142 1142 CYS CYS A . n
A 1 262 GLU 262 1143 1143 GLU GLU A . n
A 1 263 VAL 263 1144 1144 VAL VAL A . n
A 1 264 TYR 264 1145 1145 TYR TYR A . n
A 1 265 HIS 265 1146 1146 HIS HIS A . n
A 1 266 LEU 266 1147 1147 LEU LEU A . n
A 1 267 MET 267 1148 1148 MET MET A . n
A 1 268 LYS 268 1149 1149 LYS LYS A . n
A 1 269 ASN 269 1150 1150 ASN ASN A . n
A 1 270 CYS 270 1151 1151 CYS CYS A . n
A 1 271 TRP 271 1152 1152 TRP TRP A . n
A 1 272 GLU 272 1153 1153 GLU GLU A . n
A 1 273 THR 273 1154 1154 THR THR A . n
A 1 274 GLU 274 1155 1155 GLU GLU A . n
A 1 275 ALA 275 1156 1156 ALA ALA A . n
A 1 276 SER 276 1157 1157 SER SER A . n
A 1 277 PHE 277 1158 1158 PHE PHE A . n
A 1 278 ARG 278 1159 1159 ARG ARG A . n
A 1 279 PRO 279 1160 1160 PRO PRO A . n
A 1 280 THR 280 1161 1161 THR THR A . n
A 1 281 PHE 281 1162 1162 PHE PHE A . n
A 1 282 GLU 282 1163 1163 GLU GLU A . n
A 1 283 ASN 283 1164 1164 ASN ASN A . n
A 1 284 LEU 284 1165 1165 LEU LEU A . n
A 1 285 ILE 285 1166 1166 ILE ILE A . n
A 1 286 PRO 286 1167 1167 PRO PRO A . n
A 1 287 ILE 287 1168 1168 ILE ILE A . n
A 1 288 LEU 288 1169 1169 LEU LEU A . n
A 1 289 LYS 289 1170 1170 LYS LYS A . n
A 1 290 THR 290 1171 1171 THR THR A . n
A 1 291 VAL 291 1172 1172 VAL VAL A . n
A 1 292 HIS 292 1173 1173 HIS HIS A . n
A 1 293 GLU 293 1174 1174 GLU GLU A . n
A 1 294 LYS 294 1175 1175 LYS LYS A . n
A 1 295 TYR 295 1176 ? ? ? A . n
A 1 296 HIS 296 1177 ? ? ? A . n
A 1 297 HIS 297 1178 ? ? ? A . n
A 1 298 HIS 298 1179 ? ? ? A . n
A 1 299 HIS 299 1180 ? ? ? A . n
A 1 300 HIS 300 1181 ? ? ? A . n
A 1 301 HIS 301 1182 ? ? ? A . n
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 N9G 1 1200 1200 N9G LIG A .
C 3 HOH 1 1301 1228 HOH HOH A .
C 3 HOH 2 1302 1211 HOH HOH A .
C 3 HOH 3 1303 1234 HOH HOH A .
C 3 HOH 4 1304 1254 HOH HOH A .
C 3 HOH 5 1305 1215 HOH HOH A .
C 3 HOH 6 1306 1202 HOH HOH A .
C 3 HOH 7 1307 1242 HOH HOH A .
C 3 HOH 8 1308 1214 HOH HOH A .
C 3 HOH 9 1309 1201 HOH HOH A .
C 3 HOH 10 1310 1208 HOH HOH A .
C 3 HOH 11 1311 1207 HOH HOH A .
C 3 HOH 12 1312 1256 HOH HOH A .
C 3 HOH 13 1313 1243 HOH HOH A .
C 3 HOH 14 1314 1253 HOH HOH A .
C 3 HOH 15 1315 1235 HOH HOH A .
C 3 HOH 16 1316 1212 HOH HOH A .
C 3 HOH 17 1317 1223 HOH HOH A .
C 3 HOH 18 1318 1241 HOH HOH A .
C 3 HOH 19 1319 1225 HOH HOH A .
C 3 HOH 20 1320 1252 HOH HOH A .
C 3 HOH 21 1321 1247 HOH HOH A .
C 3 HOH 22 1322 1218 HOH HOH A .
C 3 HOH 23 1323 1224 HOH HOH A .
C 3 HOH 24 1324 1213 HOH HOH A .
C 3 HOH 25 1325 1222 HOH HOH A .
C 3 HOH 26 1326 1204 HOH HOH A .
C 3 HOH 27 1327 1232 HOH HOH A .
C 3 HOH 28 1328 1206 HOH HOH A .
C 3 HOH 29 1329 1240 HOH HOH A .
C 3 HOH 30 1330 1257 HOH HOH A .
C 3 HOH 31 1331 1245 HOH HOH A .
C 3 HOH 32 1332 1230 HOH HOH A .
C 3 HOH 33 1333 1248 HOH HOH A .
C 3 HOH 34 1334 1249 HOH HOH A .
C 3 HOH 35 1335 1219 HOH HOH A .
C 3 HOH 36 1336 1226 HOH HOH A .
C 3 HOH 37 1337 1231 HOH HOH A .
C 3 HOH 38 1338 1237 HOH HOH A .
C 3 HOH 39 1339 1229 HOH HOH A .
C 3 HOH 40 1340 1258 HOH HOH A .
C 3 HOH 41 1341 1246 HOH HOH A .
C 3 HOH 42 1342 1244 HOH HOH A .
C 3 HOH 43 1343 1250 HOH HOH A .
C 3 HOH 44 1344 1227 HOH HOH A .
C 3 HOH 45 1345 1238 HOH HOH A .
C 3 HOH 46 1346 1251 HOH HOH A .
C 3 HOH 47 1347 1236 HOH HOH A .
C 3 HOH 48 1348 1255 HOH HOH A .
C 3 HOH 49 1349 1233 HOH HOH A .
C 3 HOH 50 1350 1239 HOH HOH A .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 A GLU 1050 ? CG ? A GLU 169 CG
2 1 Y 1 A GLU 1050 ? CD ? A GLU 169 CD
3 1 Y 1 A GLU 1050 ? OE1 ? A GLU 169 OE1
4 1 Y 1 A GLU 1050 ? OE2 ? A GLU 169 OE2
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2
? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.1 3
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 90.000
_cell.angle_beta_esd ?
_cell.angle_gamma 120.000
_cell.angle_gamma_esd ?
_cell.entry_id 6OVA
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 48.073
_cell.length_a_esd ?
_cell.length_b 48.073
_cell.length_b_esd ?
_cell.length_c 475.025
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 12
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 6OVA
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 178
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'P 61 2 2'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 6OVA
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 2.50
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 50.74
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH 6
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 293
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '15% PEG 5000 MME, and 100 mM Sodium Citrate (pH 6.0)'
_exptl_crystal_grow.pdbx_pH_range ?
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details ?
_diffrn_detector.detector CCD
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'ADSC QUANTUM 315r'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2014-02-06
_diffrn_detector.pdbx_frequency ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.976
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'ALS BEAMLINE 5.0.3'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.976
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline 5.0.3
_diffrn_source.pdbx_synchrotron_site ALS
#
_reflns.B_iso_Wilson_estimate ?
_reflns.entry_id 6OVA
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 2.500
_reflns.d_resolution_low 50.000
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 12106
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 95.800
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 9.300
_reflns.pdbx_Rmerge_I_obs 0.078
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 10.200
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared 1.004
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all ?
_reflns.pdbx_Rpim_I_all ?
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all 112859
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half ?
_reflns.pdbx_R_split ?
#
loop_
_reflns_shell.d_res_high
_reflns_shell.d_res_low
_reflns_shell.meanI_over_sigI_all
_reflns_shell.meanI_over_sigI_obs
_reflns_shell.number_measured_all
_reflns_shell.number_measured_obs
_reflns_shell.number_possible
_reflns_shell.number_unique_all
_reflns_shell.number_unique_obs
_reflns_shell.percent_possible_all
_reflns_shell.percent_possible_obs
_reflns_shell.Rmerge_F_all
_reflns_shell.Rmerge_F_obs
_reflns_shell.Rmerge_I_all
_reflns_shell.Rmerge_I_obs
_reflns_shell.meanI_over_sigI_gt
_reflns_shell.meanI_over_uI_all
_reflns_shell.meanI_over_uI_gt
_reflns_shell.number_measured_gt
_reflns_shell.number_unique_gt
_reflns_shell.percent_possible_gt
_reflns_shell.Rmerge_F_gt
_reflns_shell.Rmerge_I_gt
_reflns_shell.pdbx_redundancy
_reflns_shell.pdbx_Rsym_value
_reflns_shell.pdbx_chi_squared
_reflns_shell.pdbx_netI_over_sigmaI_all
_reflns_shell.pdbx_netI_over_sigmaI_obs
_reflns_shell.pdbx_Rrim_I_all
_reflns_shell.pdbx_Rpim_I_all
_reflns_shell.pdbx_rejects
_reflns_shell.pdbx_ordinal
_reflns_shell.pdbx_diffrn_id
_reflns_shell.pdbx_CC_half
_reflns_shell.pdbx_R_split
2.500 2.540 ? ? ? ? ? ? 382 63.700 ? ? ? ? 0.297 ? ? ? ? ? ? ? ? 5.600 ? 1.071 ? ? ? ? ? 1 1 ? ?
2.540 2.590 ? ? ? ? ? ? 453 76.500 ? ? ? ? 0.378 ? ? ? ? ? ? ? ? 6.300 ? 1.036 ? ? ? ? ? 2 1 ? ?
2.590 2.640 ? ? ? ? ? ? 494 82.600 ? ? ? ? 0.361 ? ? ? ? ? ? ? ? 7.600 ? 0.961 ? ? ? ? ? 3 1 ? ?
2.640 2.690 ? ? ? ? ? ? 549 89.600 ? ? ? ? 0.349 ? ? ? ? ? ? ? ? 8.100 ? 0.970 ? ? ? ? ? 4 1 ? ?
2.690 2.750 ? ? ? ? ? ? 591 99.800 ? ? ? ? 0.338 ? ? ? ? ? ? ? ? 8.500 ? 0.982 ? ? ? ? ? 5 1 ? ?
2.750 2.820 ? ? ? ? ? ? 614 100.000 ? ? ? ? 0.337 ? ? ? ? ? ? ? ? 9.300 ? 0.991 ? ? ? ? ? 6 1 ? ?
2.820 2.890 ? ? ? ? ? ? 589 100.000 ? ? ? ? 0.255 ? ? ? ? ? ? ? ? 10.000 ? 1.018 ? ? ? ? ? 7 1 ? ?
2.890 2.960 ? ? ? ? ? ? 622 100.000 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 10.200 ? 0.996 ? ? ? ? ? 8 1 ? ?
2.960 3.050 ? ? ? ? ? ? 606 100.000 ? ? ? ? 0.178 ? ? ? ? ? ? ? ? 10.100 ? 1.011 ? ? ? ? ? 9 1 ? ?
3.050 3.150 ? ? ? ? ? ? 600 100.000 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 10.500 ? 1.006 ? ? ? ? ? 10 1 ? ?
3.150 3.260 ? ? ? ? ? ? 623 100.000 ? ? ? ? 0.149 ? ? ? ? ? ? ? ? 10.300 ? 0.989 ? ? ? ? ? 11 1 ? ?
3.260 3.390 ? ? ? ? ? ? 619 100.000 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 10.300 ? 1.015 ? ? ? ? ? 12 1 ? ?
3.390 3.550 ? ? ? ? ? ? 620 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 10.000 ? 1.026 ? ? ? ? ? 13 1 ? ?
3.550 3.730 ? ? ? ? ? ? 639 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 10.300 ? 1.003 ? ? ? ? ? 14 1 ? ?
3.730 3.970 ? ? ? ? ? ? 637 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 10.100 ? 1.002 ? ? ? ? ? 15 1 ? ?
3.970 4.270 ? ? ? ? ? ? 629 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 9.900 ? 1.011 ? ? ? ? ? 16 1 ? ?
4.270 4.700 ? ? ? ? ? ? 657 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 9.900 ? 0.989 ? ? ? ? ? 17 1 ? ?
4.700 5.380 ? ? ? ? ? ? 666 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 9.600 ? 1.013 ? ? ? ? ? 18 1 ? ?
5.380 6.780 ? ? ? ? ? ? 693 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 9.200 ? 1.054 ? ? ? ? ? 19 1 ? ?
6.780 50.000 ? ? ? ? ? ? 823 99.800 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 8.200 ? 0.973 ? ? ? ? ? 20 1 ? ?
#
_refine.aniso_B[1][1] 0.4800
_refine.aniso_B[1][2] 0.2400
_refine.aniso_B[1][3] 0.0000
_refine.aniso_B[2][2] 0.4800
_refine.aniso_B[2][3] 0.0000
_refine.aniso_B[3][3] -1.5600
_refine.B_iso_max 200.570
_refine.B_iso_mean 73.3010
_refine.B_iso_min 40.360
_refine.correlation_coeff_Fo_to_Fc 0.9620
_refine.correlation_coeff_Fo_to_Fc_free 0.9440
_refine.details 'U VALUES : WITH TLS ADDED'
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 6OVA
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 2.5000
_refine.ls_d_res_low 24.1700
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 11364
_refine.ls_number_reflns_R_free 574
_refine.ls_number_reflns_R_work ?
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 95.6200
_refine.ls_percent_reflns_R_free 4.8000
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.1995
_refine.ls_R_factor_R_free 0.2509
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.1968
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details ?
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 0.000
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model ?
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details RANDOM
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R 0.5310
_refine.pdbx_overall_ESU_R_Free 0.2920
_refine.pdbx_solvent_vdw_probe_radii 1.2000
_refine.pdbx_solvent_ion_probe_radii 0.8000
_refine.pdbx_solvent_shrinkage_radii 0.8000
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B 24.6730
_refine.overall_SU_ML 0.2530
_refine.overall_SU_R_Cruickshank_DPI 0.5247
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id final
_refine_hist.details ?
_refine_hist.d_res_high 2.5000
_refine_hist.d_res_low 24.1700
_refine_hist.number_atoms_solvent 50
_refine_hist.number_atoms_total 2306
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total 273
_refine_hist.pdbx_B_iso_mean_ligand 69.36
_refine_hist.pdbx_B_iso_mean_solvent 67.04
_refine_hist.pdbx_number_atoms_protein 2227
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 29
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? 0.005 0.012 2323 ? r_bond_refined_d ? ?
'X-RAY DIFFRACTION' ? 1.378 1.659 3146 ? r_angle_refined_deg ? ?
'X-RAY DIFFRACTION' ? 6.739 5.000 271 ? r_dihedral_angle_1_deg ? ?
'X-RAY DIFFRACTION' ? 36.591 21.694 124 ? r_dihedral_angle_2_deg ? ?
'X-RAY DIFFRACTION' ? 17.453 15.000 401 ? r_dihedral_angle_3_deg ? ?
'X-RAY DIFFRACTION' ? 22.181 15.000 15 ? r_dihedral_angle_4_deg ? ?
'X-RAY DIFFRACTION' ? 0.106 0.200 283 ? r_chiral_restr ? ?
'X-RAY DIFFRACTION' ? 0.006 0.020 1776 ? r_gen_planes_refined ? ?
#
_refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_ls_shell.d_res_high 2.5040
_refine_ls_shell.d_res_low 2.5690
_refine_ls_shell.number_reflns_all 571
_refine_ls_shell.number_reflns_obs ?
_refine_ls_shell.number_reflns_R_free 29
_refine_ls_shell.number_reflns_R_work 542
_refine_ls_shell.percent_reflns_obs 66.9400
_refine_ls_shell.percent_reflns_R_free ?
_refine_ls_shell.R_factor_all ?
_refine_ls_shell.R_factor_obs ?
_refine_ls_shell.R_factor_R_free 0.4200
_refine_ls_shell.R_factor_R_free_error 0.0000
_refine_ls_shell.R_factor_R_work 0.4170
_refine_ls_shell.redundancy_reflns_all ?
_refine_ls_shell.redundancy_reflns_obs ?
_refine_ls_shell.wR_factor_all ?
_refine_ls_shell.wR_factor_obs ?
_refine_ls_shell.wR_factor_R_free ?
_refine_ls_shell.wR_factor_R_work ?
_refine_ls_shell.pdbx_total_number_of_bins_used 20
_refine_ls_shell.pdbx_phase_error ?
_refine_ls_shell.pdbx_fsc_work ?
_refine_ls_shell.pdbx_fsc_free ?
#
_struct.entry_id 6OVA
_struct.title 'Crystal Structure of TYK2 with novel pyrrolidinone inhibitor'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 6OVA
_struct_keywords.text 'Inhibitor, Complex, TRANSFERASE-TRANSFERASE INHIBITOR complex'
_struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code TYK2_HUMAN
_struct_ref.pdbx_db_accession P29597
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;SPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYK
GCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFG
LAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLR
LTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKY
;
_struct_ref.pdbx_align_begin 884
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 6OVA
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 3
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 295
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession P29597
_struct_ref_seq.db_align_beg 884
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 1176
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 884
_struct_ref_seq.pdbx_auth_seq_align_end 1176
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 6OVA MET A 1 ? UNP P29597 ? ? 'initiating methionine' 882 1
1 6OVA GLY A 2 ? UNP P29597 ? ? 'expression tag' 883 2
1 6OVA SER A 135 ? UNP P29597 ALA 1016 conflict 1016 3
1 6OVA ASN A 142 ? UNP P29597 ASP 1023 conflict 1023 4
1 6OVA HIS A 296 ? UNP P29597 ? ? 'expression tag' 1177 5
1 6OVA HIS A 297 ? UNP P29597 ? ? 'expression tag' 1178 6
1 6OVA HIS A 298 ? UNP P29597 ? ? 'expression tag' 1179 7
1 6OVA HIS A 299 ? UNP P29597 ? ? 'expression tag' 1180 8
1 6OVA HIS A 300 ? UNP P29597 ? ? 'expression tag' 1181 9
1 6OVA HIS A 301 ? UNP P29597 ? ? 'expression tag' 1182 10
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_and_software_defined_assembly
_pdbx_struct_assembly.method_details PISA
_pdbx_struct_assembly.oligomeric_details monomeric
_pdbx_struct_assembly.oligomeric_count 1
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 0 ?
1 MORE 0 ?
1 'SSA (A^2)' 13410 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B,C
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support none
_pdbx_struct_assembly_auth_evidence.details ?
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 HIS A 12 ? ARG A 14 ? HIS A 893 ARG A 895 5 ? 3
HELX_P HELX_P2 AA2 LYS A 64 ? ARG A 71 ? LYS A 945 ARG A 952 1 ? 8
HELX_P HELX_P3 AA3 LEU A 105 ? LEU A 109 ? LEU A 986 LEU A 990 1 ? 5
HELX_P HELX_P4 AA4 PRO A 110 ? HIS A 112 ? PRO A 991 HIS A 993 5 ? 3
HELX_P HELX_P5 AA5 GLY A 115 ? GLN A 136 ? GLY A 996 GLN A 1017 1 ? 22
HELX_P HELX_P6 AA6 ALA A 144 ? ARG A 146 ? ALA A 1025 ARG A 1027 5 ? 3
HELX_P HELX_P7 AA7 PRO A 183 ? TYR A 187 ? PRO A 1064 TYR A 1068 5 ? 5
HELX_P HELX_P8 AA8 ALA A 188 ? GLU A 194 ? ALA A 1069 GLU A 1075 1 ? 7
HELX_P HELX_P9 AA9 TYR A 199 ? THR A 215 ? TYR A 1080 THR A 1096 1 ? 17
HELX_P HELX_P10 AB1 ASP A 218 ? GLN A 221 ? ASP A 1099 GLN A 1102 5 ? 4
HELX_P HELX_P11 AB2 SER A 222 ? LEU A 230 ? SER A 1103 LEU A 1111 1 ? 9
HELX_P HELX_P12 AB3 GLN A 235 ? ARG A 249 ? GLN A 1116 ARG A 1130 1 ? 15
HELX_P HELX_P13 AB4 PRO A 260 ? TRP A 271 ? PRO A 1141 TRP A 1152 1 ? 12
HELX_P HELX_P14 AB5 GLU A 274 ? ARG A 278 ? GLU A 1155 ARG A 1159 5 ? 5
HELX_P HELX_P15 AB6 THR A 280 ? LYS A 294 ? THR A 1161 LYS A 1175 1 ? 15
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 5 ?
AA2 ? 3 ?
AA3 ? 2 ?
AA4 ? 2 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA1 3 4 ? anti-parallel
AA1 4 5 ? anti-parallel
AA2 1 2 ? anti-parallel
AA2 2 3 ? anti-parallel
AA3 1 2 ? anti-parallel
AA4 1 2 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 LEU A 16 ? GLY A 25 ? LEU A 897 GLY A 906
AA1 2 GLY A 28 ? TYR A 35 ? GLY A 909 TYR A 916
AA1 3 GLU A 44 ? LEU A 51 ? GLU A 925 LEU A 932
AA1 4 LEU A 93 ? GLU A 98 ? LEU A 974 GLU A 979
AA1 5 TYR A 81 ? CYS A 85 ? TYR A 962 CYS A 966
AA2 1 GLY A 103 ? SER A 104 ? GLY A 984 SER A 985
AA2 2 VAL A 148 ? LEU A 150 ? VAL A 1029 LEU A 1031
AA2 3 VAL A 156 ? ILE A 158 ? VAL A 1037 ILE A 1039
AA3 1 TYR A 138 ? ILE A 139 ? TYR A 1019 ILE A 1020
AA3 2 LYS A 165 ? ALA A 166 ? LYS A 1046 ALA A 1047
AA4 1 TYR A 173 ? ARG A 175 ? TYR A 1054 ARG A 1056
AA4 2 LYS A 196 ? TYR A 198 ? LYS A 1077 TYR A 1079
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N LYS A 17 ? N LYS A 898 O CYS A 34 ? O CYS A 915
AA1 2 3 N TYR A 35 ? N TYR A 916 O GLU A 44 ? O GLU A 925
AA1 3 4 N ALA A 47 ? N ALA A 928 O MET A 97 ? O MET A 978
AA1 4 5 O VAL A 96 ? O VAL A 977 N LYS A 82 ? N LYS A 963
AA2 1 2 N GLY A 103 ? N GLY A 984 O LEU A 150 ? O LEU A 1031
AA2 2 3 N LEU A 149 ? N LEU A 1030 O LYS A 157 ? O LYS A 1038
AA3 1 2 N ILE A 139 ? N ILE A 1020 O LYS A 165 ? O LYS A 1046
AA4 1 2 N TYR A 174 ? N TYR A 1055 O PHE A 197 ? O PHE A 1078
#
_struct_site.id AC1
_struct_site.pdbx_evidence_code Software
_struct_site.pdbx_auth_asym_id A
_struct_site.pdbx_auth_comp_id N9G
_struct_site.pdbx_auth_seq_id 1200
_struct_site.pdbx_auth_ins_code ?
_struct_site.pdbx_num_residues 15
_struct_site.details 'binding site for residue N9G A 1200'
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 15 LEU A 22 ? LEU A 903 . ? 1_555 ?
2 AC1 15 GLY A 25 ? GLY A 906 . ? 1_555 ?
3 AC1 15 VAL A 30 ? VAL A 911 . ? 1_555 ?
4 AC1 15 ALA A 47 ? ALA A 928 . ? 1_555 ?
5 AC1 15 LYS A 49 ? LYS A 930 . ? 1_555 ?
6 AC1 15 ILE A 79 ? ILE A 960 . ? 1_555 ?
7 AC1 15 GLU A 98 ? GLU A 979 . ? 1_555 ?
8 AC1 15 TYR A 99 ? TYR A 980 . ? 1_555 ?
9 AC1 15 VAL A 100 ? VAL A 981 . ? 1_555 ?
10 AC1 15 PRO A 101 ? PRO A 982 . ? 1_555 ?
11 AC1 15 GLY A 103 ? GLY A 984 . ? 1_555 ?
12 AC1 15 ASP A 107 ? ASP A 988 . ? 1_555 ?
13 AC1 15 ARG A 146 ? ARG A 1027 . ? 1_555 ?
14 AC1 15 ASN A 147 ? ASN A 1028 . ? 1_555 ?
15 AC1 15 ASP A 160 ? ASP A 1041 . ? 1_555 ?
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 ASN A 1023 ? ? -152.42 41.35
2 1 ASP A 1041 ? ? 38.71 89.63
3 1 LYS A 1139 ? ? 82.63 1.69
#
loop_
_pdbx_refine_tls.pdbx_refine_id
_pdbx_refine_tls.id
_pdbx_refine_tls.details
_pdbx_refine_tls.method
_pdbx_refine_tls.origin_x
_pdbx_refine_tls.origin_y
_pdbx_refine_tls.origin_z
_pdbx_refine_tls.T[1][1]
_pdbx_refine_tls.T[2][2]
_pdbx_refine_tls.T[3][3]
_pdbx_refine_tls.T[1][2]
_pdbx_refine_tls.T[1][3]
_pdbx_refine_tls.T[2][3]
_pdbx_refine_tls.L[1][1]
_pdbx_refine_tls.L[2][2]
_pdbx_refine_tls.L[3][3]
_pdbx_refine_tls.L[1][2]
_pdbx_refine_tls.L[1][3]
_pdbx_refine_tls.L[2][3]
_pdbx_refine_tls.S[1][1]
_pdbx_refine_tls.S[2][2]
_pdbx_refine_tls.S[3][3]
_pdbx_refine_tls.S[1][2]
_pdbx_refine_tls.S[1][3]
_pdbx_refine_tls.S[2][3]
_pdbx_refine_tls.S[2][1]
_pdbx_refine_tls.S[3][1]
_pdbx_refine_tls.S[3][2]
'X-RAY DIFFRACTION' 1 ? refined 26.140 -16.325 -5.872 0.5019 0.1041 0.1866 0.1374 -0.0137 -0.0434 1.1087 1.2051 3.1310 -1.0998
-0.6636 1.0678 0.2146 -0.1215 -0.0931 0.0735 0.0864 -0.0118 -0.2062 0.4927 0.0243
'X-RAY DIFFRACTION' 2 ? refined 26.169 -9.905 4.000 0.3251 0.1403 0.2780 0.0248 -0.0054 0.0020 0.3387 0.9502 4.3619 -0.4885
-0.4000 -0.1857 0.0464 -0.0724 0.0260 0.0141 0.0124 0.1043 -0.1943 0.0276 0.2367
'X-RAY DIFFRACTION' 3 ? refined 32.011 -25.645 18.727 0.6044 0.4288 0.1629 0.3429 0.0037 0.1703 2.1466 0.8525 4.8734 1.3199
-0.5299 0.0901 -0.6288 -0.0486 0.6774 -0.2738 0.3050 0.2561 -0.3603 0.9153 1.4223
'X-RAY DIFFRACTION' 4 ? refined 23.754 -9.534 16.001 0.3197 0.1273 0.3069 0.0068 -0.0167 -0.0444 0.0351 0.0977 4.7213 0.0573
-0.4069 -0.6676 0.0066 -0.0403 0.0337 -0.0124 -0.0056 0.0190 0.0031 -0.1391 0.1675
'X-RAY DIFFRACTION' 5 ? refined 16.868 -18.359 23.990 0.3149 0.3203 0.3182 -0.0274 0.0035 0.0180 0.0135 0.3778 4.5590 -0.0516
0.1390 -1.2274 0.0135 0.0744 -0.0878 -0.0300 0.0485 -0.0835 -0.1882 0.5653 -0.5078
'X-RAY DIFFRACTION' 6 ? refined 21.471 -18.215 31.523 0.2158 0.3750 0.2302 0.0064 -0.0140 -0.0662 0.0247 0.1725 5.4909 -0.0332
0.1432 -0.9637 0.0109 0.0401 -0.0510 -0.0764 0.0471 -0.0065 -0.0628 0.3973 -0.0239
#
loop_
_pdbx_refine_tls_group.pdbx_refine_id
_pdbx_refine_tls_group.id
_pdbx_refine_tls_group.refine_tls_id
_pdbx_refine_tls_group.beg_auth_asym_id
_pdbx_refine_tls_group.beg_auth_seq_id
_pdbx_refine_tls_group.end_auth_asym_id
_pdbx_refine_tls_group.end_auth_seq_id
_pdbx_refine_tls_group.selection_details
_pdbx_refine_tls_group.beg_label_asym_id
_pdbx_refine_tls_group.beg_label_seq_id
_pdbx_refine_tls_group.end_label_asym_id
_pdbx_refine_tls_group.end_label_seq_id
_pdbx_refine_tls_group.selection
'X-RAY DIFFRACTION' 1 1 A 888 A 933 ? ? ? ? ? ?
'X-RAY DIFFRACTION' 2 2 A 942 A 984 ? ? ? ? ? ?
'X-RAY DIFFRACTION' 3 3 A 985 A 1008 ? ? ? ? ? ?
'X-RAY DIFFRACTION' 4 4 A 1009 A 1059 ? ? ? ? ? ?
'X-RAY DIFFRACTION' 5 5 A 1060 A 1110 ? ? ? ? ? ?
'X-RAY DIFFRACTION' 6 6 A 1111 A 1175 ? ? ? ? ? ?
#
_pdbx_phasing_MR.entry_id 6OVA
_pdbx_phasing_MR.method_rotation ?
_pdbx_phasing_MR.method_translation ?
_pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO'
_pdbx_phasing_MR.R_factor ?
_pdbx_phasing_MR.R_rigid_body ?
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ?
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic ?
_pdbx_phasing_MR.d_res_high_rotation 6.540
_pdbx_phasing_MR.d_res_low_rotation 41.950
_pdbx_phasing_MR.d_res_high_translation 6.540
_pdbx_phasing_MR.d_res_low_translation 41.950
_pdbx_phasing_MR.packing ?
_pdbx_phasing_MR.reflns_percent_rotation ?
_pdbx_phasing_MR.reflns_percent_translation ?
_pdbx_phasing_MR.sigma_F_rotation ?
_pdbx_phasing_MR.sigma_F_translation ?
_pdbx_phasing_MR.sigma_I_rotation ?
_pdbx_phasing_MR.sigma_I_translation ?
#
_phasing.method MR
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A MET 882 ? A MET 1
2 1 Y 1 A GLY 883 ? A GLY 2
3 1 Y 1 A SER 884 ? A SER 3
4 1 Y 1 A PRO 885 ? A PRO 4
5 1 Y 1 A ALA 886 ? A ALA 5
6 1 Y 1 A SER 887 ? A SER 6
7 1 Y 1 A ALA 934 ? A ALA 53
8 1 Y 1 A ASP 935 ? A ASP 54
9 1 Y 1 A CYS 936 ? A CYS 55
10 1 Y 1 A GLY 937 ? A GLY 56
11 1 Y 1 A PRO 938 ? A PRO 57
12 1 Y 1 A GLN 939 ? A GLN 58
13 1 Y 1 A HIS 940 ? A HIS 59
14 1 Y 1 A ARG 941 ? A ARG 60
15 1 Y 1 A ASP 968 ? A ASP 87
16 1 Y 1 A GLN 969 ? A GLN 88
17 1 Y 1 A GLY 970 ? A GLY 89
18 1 Y 1 A GLU 971 ? A GLU 90
19 1 Y 1 A LYS 972 ? A LYS 91
20 1 Y 1 A GLY 1113 ? A GLY 232
21 1 Y 1 A ILE 1114 ? A ILE 233
22 1 Y 1 A TYR 1176 ? A TYR 295
23 1 Y 1 A HIS 1177 ? A HIS 296
24 1 Y 1 A HIS 1178 ? A HIS 297
25 1 Y 1 A HIS 1179 ? A HIS 298
26 1 Y 1 A HIS 1180 ? A HIS 299
27 1 Y 1 A HIS 1181 ? A HIS 300
28 1 Y 1 A HIS 1182 ? A HIS 301
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
ALA N N N N 1
ALA CA C N S 2
ALA C C N N 3
ALA O O N N 4
ALA CB C N N 5
ALA OXT O N N 6
ALA H H N N 7
ALA H2 H N N 8
ALA HA H N N 9
ALA HB1 H N N 10
ALA HB2 H N N 11
ALA HB3 H N N 12
ALA HXT H N N 13
ARG N N N N 14
ARG CA C N S 15
ARG C C N N 16
ARG O O N N 17
ARG CB C N N 18
ARG CG C N N 19
ARG CD C N N 20
ARG NE N N N 21
ARG CZ C N N 22
ARG NH1 N N N 23
ARG NH2 N N N 24
ARG OXT O N N 25
ARG H H N N 26
ARG H2 H N N 27
ARG HA H N N 28
ARG HB2 H N N 29
ARG HB3 H N N 30
ARG HG2 H N N 31
ARG HG3 H N N 32
ARG HD2 H N N 33
ARG HD3 H N N 34
ARG HE H N N 35
ARG HH11 H N N 36
ARG HH12 H N N 37
ARG HH21 H N N 38
ARG HH22 H N N 39
ARG HXT H N N 40
ASN N N N N 41
ASN CA C N S 42
ASN C C N N 43
ASN O O N N 44
ASN CB C N N 45
ASN CG C N N 46
ASN OD1 O N N 47
ASN ND2 N N N 48
ASN OXT O N N 49
ASN H H N N 50
ASN H2 H N N 51
ASN HA H N N 52
ASN HB2 H N N 53
ASN HB3 H N N 54
ASN HD21 H N N 55
ASN HD22 H N N 56
ASN HXT H N N 57
ASP N N N N 58
ASP CA C N S 59
ASP C C N N 60
ASP O O N N 61
ASP CB C N N 62
ASP CG C N N 63
ASP OD1 O N N 64
ASP OD2 O N N 65
ASP OXT O N N 66
ASP H H N N 67
ASP H2 H N N 68
ASP HA H N N 69
ASP HB2 H N N 70
ASP HB3 H N N 71
ASP HD2 H N N 72
ASP HXT H N N 73
CYS N N N N 74
CYS CA C N R 75
CYS C C N N 76
CYS O O N N 77
CYS CB C N N 78
CYS SG S N N 79
CYS OXT O N N 80
CYS H H N N 81
CYS H2 H N N 82
CYS HA H N N 83
CYS HB2 H N N 84
CYS HB3 H N N 85
CYS HG H N N 86
CYS HXT H N N 87
GLN N N N N 88
GLN CA C N S 89
GLN C C N N 90
GLN O O N N 91
GLN CB C N N 92
GLN CG C N N 93
GLN CD C N N 94
GLN OE1 O N N 95
GLN NE2 N N N 96
GLN OXT O N N 97
GLN H H N N 98
GLN H2 H N N 99
GLN HA H N N 100
GLN HB2 H N N 101
GLN HB3 H N N 102
GLN HG2 H N N 103
GLN HG3 H N N 104
GLN HE21 H N N 105
GLN HE22 H N N 106
GLN HXT H N N 107
GLU N N N N 108
GLU CA C N S 109
GLU C C N N 110
GLU O O N N 111
GLU CB C N N 112
GLU CG C N N 113
GLU CD C N N 114
GLU OE1 O N N 115
GLU OE2 O N N 116
GLU OXT O N N 117
GLU H H N N 118
GLU H2 H N N 119
GLU HA H N N 120
GLU HB2 H N N 121
GLU HB3 H N N 122
GLU HG2 H N N 123
GLU HG3 H N N 124
GLU HE2 H N N 125
GLU HXT H N N 126
GLY N N N N 127
GLY CA C N N 128
GLY C C N N 129
GLY O O N N 130
GLY OXT O N N 131
GLY H H N N 132
GLY H2 H N N 133
GLY HA2 H N N 134
GLY HA3 H N N 135
GLY HXT H N N 136
HIS N N N N 137
HIS CA C N S 138
HIS C C N N 139
HIS O O N N 140
HIS CB C N N 141
HIS CG C Y N 142
HIS ND1 N Y N 143
HIS CD2 C Y N 144
HIS CE1 C Y N 145
HIS NE2 N Y N 146
HIS OXT O N N 147
HIS H H N N 148
HIS H2 H N N 149
HIS HA H N N 150
HIS HB2 H N N 151
HIS HB3 H N N 152
HIS HD1 H N N 153
HIS HD2 H N N 154
HIS HE1 H N N 155
HIS HE2 H N N 156
HIS HXT H N N 157
HOH O O N N 158
HOH H1 H N N 159
HOH H2 H N N 160
ILE N N N N 161
ILE CA C N S 162
ILE C C N N 163
ILE O O N N 164
ILE CB C N S 165
ILE CG1 C N N 166
ILE CG2 C N N 167
ILE CD1 C N N 168
ILE OXT O N N 169
ILE H H N N 170
ILE H2 H N N 171
ILE HA H N N 172
ILE HB H N N 173
ILE HG12 H N N 174
ILE HG13 H N N 175
ILE HG21 H N N 176
ILE HG22 H N N 177
ILE HG23 H N N 178
ILE HD11 H N N 179
ILE HD12 H N N 180
ILE HD13 H N N 181
ILE HXT H N N 182
LEU N N N N 183
LEU CA C N S 184
LEU C C N N 185
LEU O O N N 186
LEU CB C N N 187
LEU CG C N N 188
LEU CD1 C N N 189
LEU CD2 C N N 190
LEU OXT O N N 191
LEU H H N N 192
LEU H2 H N N 193
LEU HA H N N 194
LEU HB2 H N N 195
LEU HB3 H N N 196
LEU HG H N N 197
LEU HD11 H N N 198
LEU HD12 H N N 199
LEU HD13 H N N 200
LEU HD21 H N N 201
LEU HD22 H N N 202
LEU HD23 H N N 203
LEU HXT H N N 204
LYS N N N N 205
LYS CA C N S 206
LYS C C N N 207
LYS O O N N 208
LYS CB C N N 209
LYS CG C N N 210
LYS CD C N N 211
LYS CE C N N 212
LYS NZ N N N 213
LYS OXT O N N 214
LYS H H N N 215
LYS H2 H N N 216
LYS HA H N N 217
LYS HB2 H N N 218
LYS HB3 H N N 219
LYS HG2 H N N 220
LYS HG3 H N N 221
LYS HD2 H N N 222
LYS HD3 H N N 223
LYS HE2 H N N 224
LYS HE3 H N N 225
LYS HZ1 H N N 226
LYS HZ2 H N N 227
LYS HZ3 H N N 228
LYS HXT H N N 229
MET N N N N 230
MET CA C N S 231
MET C C N N 232
MET O O N N 233
MET CB C N N 234
MET CG C N N 235
MET SD S N N 236
MET CE C N N 237
MET OXT O N N 238
MET H H N N 239
MET H2 H N N 240
MET HA H N N 241
MET HB2 H N N 242
MET HB3 H N N 243
MET HG2 H N N 244
MET HG3 H N N 245
MET HE1 H N N 246
MET HE2 H N N 247
MET HE3 H N N 248
MET HXT H N N 249
N9G C4 C N N 250
N9G C6 C Y N 251
N9G C7 C Y N 252
N9G C8 C Y N 253
N9G C13 C Y N 254
N9G C15 C Y N 255
N9G C20 C N S 256
N9G C21 C N N 257
N9G C24 C N N 258
N9G C26 C N N 259
N9G C1 C N N 260
N9G N2 N N N 261
N9G C3 C N N 262
N9G O5 O N N 263
N9G C9 C Y N 264
N9G N10 N N N 265
N9G C11 C Y N 266
N9G C12 C Y N 267
N9G C14 C Y N 268
N9G N16 N Y N 269
N9G N17 N N N 270
N9G C18 C N N 271
N9G C19 C N N 272
N9G N22 N N N 273
N9G C23 C N N 274
N9G C25 C N N 275
N9G O27 O N N 276
N9G N28 N Y N 277
N9G C29 C Y N 278
N9G H1 H N N 279
N9G H2 H N N 280
N9G H3 H N N 281
N9G H4 H N N 282
N9G H5 H N N 283
N9G H6 H N N 284
N9G H7 H N N 285
N9G H8 H N N 286
N9G H9 H N N 287
N9G H10 H N N 288
N9G H11 H N N 289
N9G H12 H N N 290
N9G H13 H N N 291
N9G H14 H N N 292
N9G H15 H N N 293
N9G H16 H N N 294
N9G H17 H N N 295
N9G H18 H N N 296
N9G H19 H N N 297
N9G H20 H N N 298
N9G H21 H N N 299
N9G H22 H N N 300
PHE N N N N 301
PHE CA C N S 302
PHE C C N N 303
PHE O O N N 304
PHE CB C N N 305
PHE CG C Y N 306
PHE CD1 C Y N 307
PHE CD2 C Y N 308
PHE CE1 C Y N 309
PHE CE2 C Y N 310
PHE CZ C Y N 311
PHE OXT O N N 312
PHE H H N N 313
PHE H2 H N N 314
PHE HA H N N 315
PHE HB2 H N N 316
PHE HB3 H N N 317
PHE HD1 H N N 318
PHE HD2 H N N 319
PHE HE1 H N N 320
PHE HE2 H N N 321
PHE HZ H N N 322
PHE HXT H N N 323
PRO N N N N 324
PRO CA C N S 325
PRO C C N N 326
PRO O O N N 327
PRO CB C N N 328
PRO CG C N N 329
PRO CD C N N 330
PRO OXT O N N 331
PRO H H N N 332
PRO HA H N N 333
PRO HB2 H N N 334
PRO HB3 H N N 335
PRO HG2 H N N 336
PRO HG3 H N N 337
PRO HD2 H N N 338
PRO HD3 H N N 339
PRO HXT H N N 340
SER N N N N 341
SER CA C N S 342
SER C C N N 343
SER O O N N 344
SER CB C N N 345
SER OG O N N 346
SER OXT O N N 347
SER H H N N 348
SER H2 H N N 349
SER HA H N N 350
SER HB2 H N N 351
SER HB3 H N N 352
SER HG H N N 353
SER HXT H N N 354
THR N N N N 355
THR CA C N S 356
THR C C N N 357
THR O O N N 358
THR CB C N R 359
THR OG1 O N N 360
THR CG2 C N N 361
THR OXT O N N 362
THR H H N N 363
THR H2 H N N 364
THR HA H N N 365
THR HB H N N 366
THR HG1 H N N 367
THR HG21 H N N 368
THR HG22 H N N 369
THR HG23 H N N 370
THR HXT H N N 371
TRP N N N N 372
TRP CA C N S 373
TRP C C N N 374
TRP O O N N 375
TRP CB C N N 376
TRP CG C Y N 377
TRP CD1 C Y N 378
TRP CD2 C Y N 379
TRP NE1 N Y N 380
TRP CE2 C Y N 381
TRP CE3 C Y N 382
TRP CZ2 C Y N 383
TRP CZ3 C Y N 384
TRP CH2 C Y N 385
TRP OXT O N N 386
TRP H H N N 387
TRP H2 H N N 388
TRP HA H N N 389
TRP HB2 H N N 390
TRP HB3 H N N 391
TRP HD1 H N N 392
TRP HE1 H N N 393
TRP HE3 H N N 394
TRP HZ2 H N N 395
TRP HZ3 H N N 396
TRP HH2 H N N 397
TRP HXT H N N 398
TYR N N N N 399
TYR CA C N S 400
TYR C C N N 401
TYR O O N N 402
TYR CB C N N 403
TYR CG C Y N 404
TYR CD1 C Y N 405
TYR CD2 C Y N 406
TYR CE1 C Y N 407
TYR CE2 C Y N 408
TYR CZ C Y N 409
TYR OH O N N 410
TYR OXT O N N 411
TYR H H N N 412
TYR H2 H N N 413
TYR HA H N N 414
TYR HB2 H N N 415
TYR HB3 H N N 416
TYR HD1 H N N 417
TYR HD2 H N N 418
TYR HE1 H N N 419
TYR HE2 H N N 420
TYR HH H N N 421
TYR HXT H N N 422
VAL N N N N 423
VAL CA C N S 424
VAL C C N N 425
VAL O O N N 426
VAL CB C N N 427
VAL CG1 C N N 428
VAL CG2 C N N 429
VAL OXT O N N 430
VAL H H N N 431
VAL H2 H N N 432
VAL HA H N N 433
VAL HB H N N 434
VAL HG11 H N N 435
VAL HG12 H N N 436
VAL HG13 H N N 437
VAL HG21 H N N 438
VAL HG22 H N N 439
VAL HG23 H N N 440
VAL HXT H N N 441
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
ALA N CA sing N N 1
ALA N H sing N N 2
ALA N H2 sing N N 3
ALA CA C sing N N 4
ALA CA CB sing N N 5
ALA CA HA sing N N 6
ALA C O doub N N 7
ALA C OXT sing N N 8
ALA CB HB1 sing N N 9
ALA CB HB2 sing N N 10
ALA CB HB3 sing N N 11
ALA OXT HXT sing N N 12
ARG N CA sing N N 13
ARG N H sing N N 14
ARG N H2 sing N N 15
ARG CA C sing N N 16
ARG CA CB sing N N 17
ARG CA HA sing N N 18
ARG C O doub N N 19
ARG C OXT sing N N 20
ARG CB CG sing N N 21
ARG CB HB2 sing N N 22
ARG CB HB3 sing N N 23
ARG CG CD sing N N 24
ARG CG HG2 sing N N 25
ARG CG HG3 sing N N 26
ARG CD NE sing N N 27
ARG CD HD2 sing N N 28
ARG CD HD3 sing N N 29
ARG NE CZ sing N N 30
ARG NE HE sing N N 31
ARG CZ NH1 sing N N 32
ARG CZ NH2 doub N N 33
ARG NH1 HH11 sing N N 34
ARG NH1 HH12 sing N N 35
ARG NH2 HH21 sing N N 36
ARG NH2 HH22 sing N N 37
ARG OXT HXT sing N N 38
ASN N CA sing N N 39
ASN N H sing N N 40
ASN N H2 sing N N 41
ASN CA C sing N N 42
ASN CA CB sing N N 43
ASN CA HA sing N N 44
ASN C O doub N N 45
ASN C OXT sing N N 46
ASN CB CG sing N N 47
ASN CB HB2 sing N N 48
ASN CB HB3 sing N N 49
ASN CG OD1 doub N N 50
ASN CG ND2 sing N N 51
ASN ND2 HD21 sing N N 52
ASN ND2 HD22 sing N N 53
ASN OXT HXT sing N N 54
ASP N CA sing N N 55
ASP N H sing N N 56
ASP N H2 sing N N 57
ASP CA C sing N N 58
ASP CA CB sing N N 59
ASP CA HA sing N N 60
ASP C O doub N N 61
ASP C OXT sing N N 62
ASP CB CG sing N N 63
ASP CB HB2 sing N N 64
ASP CB HB3 sing N N 65
ASP CG OD1 doub N N 66
ASP CG OD2 sing N N 67
ASP OD2 HD2 sing N N 68
ASP OXT HXT sing N N 69
CYS N CA sing N N 70
CYS N H sing N N 71
CYS N H2 sing N N 72
CYS CA C sing N N 73
CYS CA CB sing N N 74
CYS CA HA sing N N 75
CYS C O doub N N 76
CYS C OXT sing N N 77
CYS CB SG sing N N 78
CYS CB HB2 sing N N 79
CYS CB HB3 sing N N 80
CYS SG HG sing N N 81
CYS OXT HXT sing N N 82
GLN N CA sing N N 83
GLN N H sing N N 84
GLN N H2 sing N N 85
GLN CA C sing N N 86
GLN CA CB sing N N 87
GLN CA HA sing N N 88
GLN C O doub N N 89
GLN C OXT sing N N 90
GLN CB CG sing N N 91
GLN CB HB2 sing N N 92
GLN CB HB3 sing N N 93
GLN CG CD sing N N 94
GLN CG HG2 sing N N 95
GLN CG HG3 sing N N 96
GLN CD OE1 doub N N 97
GLN CD NE2 sing N N 98
GLN NE2 HE21 sing N N 99
GLN NE2 HE22 sing N N 100
GLN OXT HXT sing N N 101
GLU N CA sing N N 102
GLU N H sing N N 103
GLU N H2 sing N N 104
GLU CA C sing N N 105
GLU CA CB sing N N 106
GLU CA HA sing N N 107
GLU C O doub N N 108
GLU C OXT sing N N 109
GLU CB CG sing N N 110
GLU CB HB2 sing N N 111
GLU CB HB3 sing N N 112
GLU CG CD sing N N 113
GLU CG HG2 sing N N 114
GLU CG HG3 sing N N 115
GLU CD OE1 doub N N 116
GLU CD OE2 sing N N 117
GLU OE2 HE2 sing N N 118
GLU OXT HXT sing N N 119
GLY N CA sing N N 120
GLY N H sing N N 121
GLY N H2 sing N N 122
GLY CA C sing N N 123
GLY CA HA2 sing N N 124
GLY CA HA3 sing N N 125
GLY C O doub N N 126
GLY C OXT sing N N 127
GLY OXT HXT sing N N 128
HIS N CA sing N N 129
HIS N H sing N N 130
HIS N H2 sing N N 131
HIS CA C sing N N 132
HIS CA CB sing N N 133
HIS CA HA sing N N 134
HIS C O doub N N 135
HIS C OXT sing N N 136
HIS CB CG sing N N 137
HIS CB HB2 sing N N 138
HIS CB HB3 sing N N 139
HIS CG ND1 sing Y N 140
HIS CG CD2 doub Y N 141
HIS ND1 CE1 doub Y N 142
HIS ND1 HD1 sing N N 143
HIS CD2 NE2 sing Y N 144
HIS CD2 HD2 sing N N 145
HIS CE1 NE2 sing Y N 146
HIS CE1 HE1 sing N N 147
HIS NE2 HE2 sing N N 148
HIS OXT HXT sing N N 149
HOH O H1 sing N N 150
HOH O H2 sing N N 151
ILE N CA sing N N 152
ILE N H sing N N 153
ILE N H2 sing N N 154
ILE CA C sing N N 155
ILE CA CB sing N N 156
ILE CA HA sing N N 157
ILE C O doub N N 158
ILE C OXT sing N N 159
ILE CB CG1 sing N N 160
ILE CB CG2 sing N N 161
ILE CB HB sing N N 162
ILE CG1 CD1 sing N N 163
ILE CG1 HG12 sing N N 164
ILE CG1 HG13 sing N N 165
ILE CG2 HG21 sing N N 166
ILE CG2 HG22 sing N N 167
ILE CG2 HG23 sing N N 168
ILE CD1 HD11 sing N N 169
ILE CD1 HD12 sing N N 170
ILE CD1 HD13 sing N N 171
ILE OXT HXT sing N N 172
LEU N CA sing N N 173
LEU N H sing N N 174
LEU N H2 sing N N 175
LEU CA C sing N N 176
LEU CA CB sing N N 177
LEU CA HA sing N N 178
LEU C O doub N N 179
LEU C OXT sing N N 180
LEU CB CG sing N N 181
LEU CB HB2 sing N N 182
LEU CB HB3 sing N N 183
LEU CG CD1 sing N N 184
LEU CG CD2 sing N N 185
LEU CG HG sing N N 186
LEU CD1 HD11 sing N N 187
LEU CD1 HD12 sing N N 188
LEU CD1 HD13 sing N N 189
LEU CD2 HD21 sing N N 190
LEU CD2 HD22 sing N N 191
LEU CD2 HD23 sing N N 192
LEU OXT HXT sing N N 193
LYS N CA sing N N 194
LYS N H sing N N 195
LYS N H2 sing N N 196
LYS CA C sing N N 197
LYS CA CB sing N N 198
LYS CA HA sing N N 199
LYS C O doub N N 200
LYS C OXT sing N N 201
LYS CB CG sing N N 202
LYS CB HB2 sing N N 203
LYS CB HB3 sing N N 204
LYS CG CD sing N N 205
LYS CG HG2 sing N N 206
LYS CG HG3 sing N N 207
LYS CD CE sing N N 208
LYS CD HD2 sing N N 209
LYS CD HD3 sing N N 210
LYS CE NZ sing N N 211
LYS CE HE2 sing N N 212
LYS CE HE3 sing N N 213
LYS NZ HZ1 sing N N 214
LYS NZ HZ2 sing N N 215
LYS NZ HZ3 sing N N 216
LYS OXT HXT sing N N 217
MET N CA sing N N 218
MET N H sing N N 219
MET N H2 sing N N 220
MET CA C sing N N 221
MET CA CB sing N N 222
MET CA HA sing N N 223
MET C O doub N N 224
MET C OXT sing N N 225
MET CB CG sing N N 226
MET CB HB2 sing N N 227
MET CB HB3 sing N N 228
MET CG SD sing N N 229
MET CG HG2 sing N N 230
MET CG HG3 sing N N 231
MET SD CE sing N N 232
MET CE HE1 sing N N 233
MET CE HE2 sing N N 234
MET CE HE3 sing N N 235
MET OXT HXT sing N N 236
N9G O5 C4 doub N N 237
N9G N16 C15 doub Y N 238
N9G N16 C11 sing Y N 239
N9G C15 C14 sing Y N 240
N9G N10 C11 sing N N 241
N9G N10 C9 sing N N 242
N9G C11 C12 doub Y N 243
N9G C9 C8 doub Y N 244
N9G C9 N28 sing Y N 245
N9G C8 C7 sing Y N 246
N9G N28 C29 doub Y N 247
N9G C14 C13 doub Y N 248
N9G C7 C6 doub Y N 249
N9G C29 C6 sing Y N 250
N9G C6 C4 sing N N 251
N9G C4 N2 sing N N 252
N9G C12 C13 sing Y N 253
N9G C13 N17 sing N N 254
N9G N17 C18 sing N N 255
N9G N17 C26 sing N N 256
N9G C18 C19 sing N N 257
N9G C19 C20 sing N N 258
N9G N2 C1 sing N N 259
N9G N2 C3 sing N N 260
N9G C26 O27 doub N N 261
N9G C26 C20 sing N N 262
N9G C21 N22 trip N N 263
N9G C21 C20 sing N N 264
N9G C20 C23 sing N N 265
N9G C23 C25 sing N N 266
N9G C23 C24 sing N N 267
N9G C25 C24 sing N N 268
N9G C7 H1 sing N N 269
N9G C8 H2 sing N N 270
N9G C15 H3 sing N N 271
N9G C24 H4 sing N N 272
N9G C24 H5 sing N N 273
N9G C1 H6 sing N N 274
N9G C1 H7 sing N N 275
N9G C1 H8 sing N N 276
N9G C3 H9 sing N N 277
N9G C3 H10 sing N N 278
N9G C3 H11 sing N N 279
N9G N10 H12 sing N N 280
N9G C12 H13 sing N N 281
N9G C14 H14 sing N N 282
N9G C18 H15 sing N N 283
N9G C18 H16 sing N N 284
N9G C19 H17 sing N N 285
N9G C19 H18 sing N N 286
N9G C23 H19 sing N N 287
N9G C25 H20 sing N N 288
N9G C25 H21 sing N N 289
N9G C29 H22 sing N N 290
PHE N CA sing N N 291
PHE N H sing N N 292
PHE N H2 sing N N 293
PHE CA C sing N N 294
PHE CA CB sing N N 295
PHE CA HA sing N N 296
PHE C O doub N N 297
PHE C OXT sing N N 298
PHE CB CG sing N N 299
PHE CB HB2 sing N N 300
PHE CB HB3 sing N N 301
PHE CG CD1 doub Y N 302
PHE CG CD2 sing Y N 303
PHE CD1 CE1 sing Y N 304
PHE CD1 HD1 sing N N 305
PHE CD2 CE2 doub Y N 306
PHE CD2 HD2 sing N N 307
PHE CE1 CZ doub Y N 308
PHE CE1 HE1 sing N N 309
PHE CE2 CZ sing Y N 310
PHE CE2 HE2 sing N N 311
PHE CZ HZ sing N N 312
PHE OXT HXT sing N N 313
PRO N CA sing N N 314
PRO N CD sing N N 315
PRO N H sing N N 316
PRO CA C sing N N 317
PRO CA CB sing N N 318
PRO CA HA sing N N 319
PRO C O doub N N 320
PRO C OXT sing N N 321
PRO CB CG sing N N 322
PRO CB HB2 sing N N 323
PRO CB HB3 sing N N 324
PRO CG CD sing N N 325
PRO CG HG2 sing N N 326
PRO CG HG3 sing N N 327
PRO CD HD2 sing N N 328
PRO CD HD3 sing N N 329
PRO OXT HXT sing N N 330
SER N CA sing N N 331
SER N H sing N N 332
SER N H2 sing N N 333
SER CA C sing N N 334
SER CA CB sing N N 335
SER CA HA sing N N 336
SER C O doub N N 337
SER C OXT sing N N 338
SER CB OG sing N N 339
SER CB HB2 sing N N 340
SER CB HB3 sing N N 341
SER OG HG sing N N 342
SER OXT HXT sing N N 343
THR N CA sing N N 344
THR N H sing N N 345
THR N H2 sing N N 346
THR CA C sing N N 347
THR CA CB sing N N 348
THR CA HA sing N N 349
THR C O doub N N 350
THR C OXT sing N N 351
THR CB OG1 sing N N 352
THR CB CG2 sing N N 353
THR CB HB sing N N 354
THR OG1 HG1 sing N N 355
THR CG2 HG21 sing N N 356
THR CG2 HG22 sing N N 357
THR CG2 HG23 sing N N 358
THR OXT HXT sing N N 359
TRP N CA sing N N 360
TRP N H sing N N 361
TRP N H2 sing N N 362
TRP CA C sing N N 363
TRP CA CB sing N N 364
TRP CA HA sing N N 365
TRP C O doub N N 366
TRP C OXT sing N N 367
TRP CB CG sing N N 368
TRP CB HB2 sing N N 369
TRP CB HB3 sing N N 370
TRP CG CD1 doub Y N 371
TRP CG CD2 sing Y N 372
TRP CD1 NE1 sing Y N 373
TRP CD1 HD1 sing N N 374
TRP CD2 CE2 doub Y N 375
TRP CD2 CE3 sing Y N 376
TRP NE1 CE2 sing Y N 377
TRP NE1 HE1 sing N N 378
TRP CE2 CZ2 sing Y N 379
TRP CE3 CZ3 doub Y N 380
TRP CE3 HE3 sing N N 381
TRP CZ2 CH2 doub Y N 382
TRP CZ2 HZ2 sing N N 383
TRP CZ3 CH2 sing Y N 384
TRP CZ3 HZ3 sing N N 385
TRP CH2 HH2 sing N N 386
TRP OXT HXT sing N N 387
TYR N CA sing N N 388
TYR N H sing N N 389
TYR N H2 sing N N 390
TYR CA C sing N N 391
TYR CA CB sing N N 392
TYR CA HA sing N N 393
TYR C O doub N N 394
TYR C OXT sing N N 395
TYR CB CG sing N N 396
TYR CB HB2 sing N N 397
TYR CB HB3 sing N N 398
TYR CG CD1 doub Y N 399
TYR CG CD2 sing Y N 400
TYR CD1 CE1 sing Y N 401
TYR CD1 HD1 sing N N 402
TYR CD2 CE2 doub Y N 403
TYR CD2 HD2 sing N N 404
TYR CE1 CZ doub Y N 405
TYR CE1 HE1 sing N N 406
TYR CE2 CZ sing Y N 407
TYR CE2 HE2 sing N N 408
TYR CZ OH sing N N 409
TYR OH HH sing N N 410
TYR OXT HXT sing N N 411
VAL N CA sing N N 412
VAL N H sing N N 413
VAL N H2 sing N N 414
VAL CA C sing N N 415
VAL CA CB sing N N 416
VAL CA HA sing N N 417
VAL C O doub N N 418
VAL C OXT sing N N 419
VAL CB CG1 sing N N 420
VAL CB CG2 sing N N 421
VAL CB HB sing N N 422
VAL CG1 HG11 sing N N 423
VAL CG1 HG12 sing N N 424
VAL CG1 HG13 sing N N 425
VAL CG2 HG21 sing N N 426
VAL CG2 HG22 sing N N 427
VAL CG2 HG23 sing N N 428
VAL OXT HXT sing N N 429
#
_pdbx_entity_instance_feature.ordinal 1
_pdbx_entity_instance_feature.comp_id N9G
_pdbx_entity_instance_feature.asym_id ?
_pdbx_entity_instance_feature.seq_num ?
_pdbx_entity_instance_feature.auth_comp_id N9G
_pdbx_entity_instance_feature.auth_asym_id ?
_pdbx_entity_instance_feature.auth_seq_num ?
_pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION'
_pdbx_entity_instance_feature.details ?
#
_atom_sites.entry_id 6OVA
_atom_sites.fract_transf_matrix[1][1] 0.020802
_atom_sites.fract_transf_matrix[1][2] 0.012010
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] -0.000000
_atom_sites.fract_transf_matrix[2][2] 0.024020
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] -0.000000
_atom_sites.fract_transf_matrix[3][3] 0.002105
_atom_sites.fract_transf_vector[1] 0.000000
_atom_sites.fract_transf_vector[2] 0.000000
_atom_sites.fract_transf_vector[3] 0.000000
#
loop_
_atom_type.symbol
C
N
O
S
#
loop_