data_6OYT # _entry.id 6OYT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6OYT pdb_00006oyt 10.2210/pdb6oyt/pdb WWPDB D_1000241580 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OYT _pdbx_database_status.recvd_initial_deposition_date 2019-05-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Marcotte, D.J.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 10740 _citation.page_last 10756 _citation.title 'Rational Design and Optimization of a Novel Class of Macrocyclic Apoptosis Signal-Regulating Kinase 1 Inhibitors.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.9b01206 _citation.pdbx_database_id_PubMed 31710475 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Himmelbauer, M.K.' 1 ? primary 'Xin, Z.' 2 ? primary 'Jones, J.H.' 3 ? primary 'Enyedy, I.' 4 ? primary 'King, K.' 5 ? primary 'Marcotte, D.J.' 6 ? primary 'Murugan, P.' 7 ? primary 'Santoro, J.C.' 8 ? primary 'Hesson, T.' 9 ? primary 'Spilker, K.' 10 ? primary 'Johnson, J.L.' 11 ? primary 'Luzzio, M.J.' 12 ? primary 'Gilfillan, R.' 13 ? primary 'de Turiso, F.G.' 14 0000-0001-9736-0907 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 97.770 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6OYT _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.510 _cell.length_a_esd ? _cell.length_b 73.590 _cell.length_b_esd ? _cell.length_c 95.140 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OYT _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase kinase kinase 5' 31702.111 4 2.7.11.25 ? ? ? 2 non-polymer syn '5-(4-cyclopropyl-1H-imidazol-1-yl)-2-fluoro-4-methyl-N-{6-[4-(propan-2-yl)-4H-1,2,4-triazol-3-yl]pyridin-2-yl}benzamide' 445.492 4 ? ? ? ? 3 non-polymer syn 'ACETATE ION' 59.044 9 ? ? ? ? 4 water nat water 18.015 79 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Apoptosis signal-regulating kinase 1,ASK-1,MAPK/ERK kinase kinase 5,MEKK 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFS ENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGT SKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPE SMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFS ENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGT SKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPE SMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKHHHHHH ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 SER n 1 4 ASP n 1 5 LEU n 1 6 LEU n 1 7 GLU n 1 8 TYR n 1 9 ASP n 1 10 TYR n 1 11 GLU n 1 12 TYR n 1 13 ASP n 1 14 GLU n 1 15 ASN n 1 16 GLY n 1 17 ASP n 1 18 ARG n 1 19 VAL n 1 20 VAL n 1 21 LEU n 1 22 GLY n 1 23 LYS n 1 24 GLY n 1 25 THR n 1 26 TYR n 1 27 GLY n 1 28 ILE n 1 29 VAL n 1 30 TYR n 1 31 ALA n 1 32 GLY n 1 33 ARG n 1 34 ASP n 1 35 LEU n 1 36 SER n 1 37 ASN n 1 38 GLN n 1 39 VAL n 1 40 ARG n 1 41 ILE n 1 42 ALA n 1 43 ILE n 1 44 LYS n 1 45 GLU n 1 46 ILE n 1 47 PRO n 1 48 GLU n 1 49 ARG n 1 50 ASP n 1 51 SER n 1 52 ARG n 1 53 TYR n 1 54 SER n 1 55 GLN n 1 56 PRO n 1 57 LEU n 1 58 HIS n 1 59 GLU n 1 60 GLU n 1 61 ILE n 1 62 ALA n 1 63 LEU n 1 64 HIS n 1 65 LYS n 1 66 HIS n 1 67 LEU n 1 68 LYS n 1 69 HIS n 1 70 LYS n 1 71 ASN n 1 72 ILE n 1 73 VAL n 1 74 GLN n 1 75 TYR n 1 76 LEU n 1 77 GLY n 1 78 SER n 1 79 PHE n 1 80 SER n 1 81 GLU n 1 82 ASN n 1 83 GLY n 1 84 PHE n 1 85 ILE n 1 86 LYS n 1 87 ILE n 1 88 PHE n 1 89 MET n 1 90 GLU n 1 91 GLN n 1 92 VAL n 1 93 PRO n 1 94 GLY n 1 95 GLY n 1 96 SER n 1 97 LEU n 1 98 SER n 1 99 ALA n 1 100 LEU n 1 101 LEU n 1 102 ARG n 1 103 SER n 1 104 LYS n 1 105 TRP n 1 106 GLY n 1 107 PRO n 1 108 LEU n 1 109 LYS n 1 110 ASP n 1 111 ASN n 1 112 GLU n 1 113 GLN n 1 114 THR n 1 115 ILE n 1 116 GLY n 1 117 PHE n 1 118 TYR n 1 119 THR n 1 120 LYS n 1 121 GLN n 1 122 ILE n 1 123 LEU n 1 124 GLU n 1 125 GLY n 1 126 LEU n 1 127 LYS n 1 128 TYR n 1 129 LEU n 1 130 HIS n 1 131 ASP n 1 132 ASN n 1 133 GLN n 1 134 ILE n 1 135 VAL n 1 136 HIS n 1 137 ARG n 1 138 ASP n 1 139 ILE n 1 140 LYS n 1 141 GLY n 1 142 ASP n 1 143 ASN n 1 144 VAL n 1 145 LEU n 1 146 ILE n 1 147 ASN n 1 148 THR n 1 149 TYR n 1 150 SER n 1 151 GLY n 1 152 VAL n 1 153 LEU n 1 154 LYS n 1 155 ILE n 1 156 SER n 1 157 ASP n 1 158 PHE n 1 159 GLY n 1 160 THR n 1 161 SER n 1 162 LYS n 1 163 ARG n 1 164 LEU n 1 165 ALA n 1 166 GLY n 1 167 ILE n 1 168 ASN n 1 169 PRO n 1 170 CYS n 1 171 THR n 1 172 GLU n 1 173 THR n 1 174 PHE n 1 175 THR n 1 176 GLY n 1 177 THR n 1 178 LEU n 1 179 GLN n 1 180 TYR n 1 181 MET n 1 182 ALA n 1 183 PRO n 1 184 GLU n 1 185 ILE n 1 186 ILE n 1 187 ASP n 1 188 LYS n 1 189 GLY n 1 190 PRO n 1 191 ARG n 1 192 GLY n 1 193 TYR n 1 194 GLY n 1 195 LYS n 1 196 ALA n 1 197 ALA n 1 198 ASP n 1 199 ILE n 1 200 TRP n 1 201 SER n 1 202 LEU n 1 203 GLY n 1 204 CYS n 1 205 THR n 1 206 ILE n 1 207 ILE n 1 208 GLU n 1 209 MET n 1 210 ALA n 1 211 THR n 1 212 GLY n 1 213 LYS n 1 214 PRO n 1 215 PRO n 1 216 PHE n 1 217 TYR n 1 218 GLU n 1 219 LEU n 1 220 GLY n 1 221 GLU n 1 222 PRO n 1 223 GLN n 1 224 ALA n 1 225 ALA n 1 226 MET n 1 227 PHE n 1 228 LYS n 1 229 VAL n 1 230 GLY n 1 231 MET n 1 232 PHE n 1 233 LYS n 1 234 VAL n 1 235 HIS n 1 236 PRO n 1 237 GLU n 1 238 ILE n 1 239 PRO n 1 240 GLU n 1 241 SER n 1 242 MET n 1 243 SER n 1 244 ALA n 1 245 GLU n 1 246 ALA n 1 247 LYS n 1 248 ALA n 1 249 PHE n 1 250 ILE n 1 251 LEU n 1 252 LYS n 1 253 CYS n 1 254 PHE n 1 255 GLU n 1 256 PRO n 1 257 ASP n 1 258 PRO n 1 259 ASP n 1 260 LYS n 1 261 ARG n 1 262 ALA n 1 263 CYS n 1 264 ALA n 1 265 ASN n 1 266 ASP n 1 267 LEU n 1 268 LEU n 1 269 VAL n 1 270 ASP n 1 271 GLU n 1 272 PHE n 1 273 LEU n 1 274 LYS n 1 275 HIS n 1 276 HIS n 1 277 HIS n 1 278 HIS n 1 279 HIS n 1 280 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 280 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP3K5, ASK1, MAPKKK5, MEKK5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code M3K5_HUMAN _struct_ref.pdbx_db_accession Q99683 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSE NGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTS KRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPES MSAEAKAFILKCFEPDPDKRACANDLLVDEFLK ; _struct_ref.pdbx_align_begin 667 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6OYT A 2 ? 274 ? Q99683 667 ? 939 ? 667 939 2 1 6OYT B 2 ? 274 ? Q99683 667 ? 939 ? 667 939 3 1 6OYT C 2 ? 274 ? Q99683 667 ? 939 ? 667 939 4 1 6OYT D 2 ? 274 ? Q99683 667 ? 939 ? 667 939 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6OYT MET A 1 ? UNP Q99683 ? ? 'initiating methionine' 666 1 1 6OYT HIS A 275 ? UNP Q99683 ? ? 'expression tag' 940 2 1 6OYT HIS A 276 ? UNP Q99683 ? ? 'expression tag' 941 3 1 6OYT HIS A 277 ? UNP Q99683 ? ? 'expression tag' 942 4 1 6OYT HIS A 278 ? UNP Q99683 ? ? 'expression tag' 943 5 1 6OYT HIS A 279 ? UNP Q99683 ? ? 'expression tag' 944 6 1 6OYT HIS A 280 ? UNP Q99683 ? ? 'expression tag' 945 7 2 6OYT MET B 1 ? UNP Q99683 ? ? 'initiating methionine' 666 8 2 6OYT HIS B 275 ? UNP Q99683 ? ? 'expression tag' 940 9 2 6OYT HIS B 276 ? UNP Q99683 ? ? 'expression tag' 941 10 2 6OYT HIS B 277 ? UNP Q99683 ? ? 'expression tag' 942 11 2 6OYT HIS B 278 ? UNP Q99683 ? ? 'expression tag' 943 12 2 6OYT HIS B 279 ? UNP Q99683 ? ? 'expression tag' 944 13 2 6OYT HIS B 280 ? UNP Q99683 ? ? 'expression tag' 945 14 3 6OYT MET C 1 ? UNP Q99683 ? ? 'initiating methionine' 666 15 3 6OYT HIS C 275 ? UNP Q99683 ? ? 'expression tag' 940 16 3 6OYT HIS C 276 ? UNP Q99683 ? ? 'expression tag' 941 17 3 6OYT HIS C 277 ? UNP Q99683 ? ? 'expression tag' 942 18 3 6OYT HIS C 278 ? UNP Q99683 ? ? 'expression tag' 943 19 3 6OYT HIS C 279 ? UNP Q99683 ? ? 'expression tag' 944 20 3 6OYT HIS C 280 ? UNP Q99683 ? ? 'expression tag' 945 21 4 6OYT MET D 1 ? UNP Q99683 ? ? 'initiating methionine' 666 22 4 6OYT HIS D 275 ? UNP Q99683 ? ? 'expression tag' 940 23 4 6OYT HIS D 276 ? UNP Q99683 ? ? 'expression tag' 941 24 4 6OYT HIS D 277 ? UNP Q99683 ? ? 'expression tag' 942 25 4 6OYT HIS D 278 ? UNP Q99683 ? ? 'expression tag' 943 26 4 6OYT HIS D 279 ? UNP Q99683 ? ? 'expression tag' 944 27 4 6OYT HIS D 280 ? UNP Q99683 ? ? 'expression tag' 945 28 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NJV non-polymer . '5-(4-cyclopropyl-1H-imidazol-1-yl)-2-fluoro-4-methyl-N-{6-[4-(propan-2-yl)-4H-1,2,4-triazol-3-yl]pyridin-2-yl}benzamide' 'Selonsertib; GS-4997' 'C24 H24 F N7 O' 445.492 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OYT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Na Acetate pH 5.5, 2% PEG4K and 30% polyacrylic acid.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6OYT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.82 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 51795 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.8 _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.82 _reflns_shell.d_res_low 2.98 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 7763 _reflns_shell.percent_possible_all 86 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs .78 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.572 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 191.550 _refine.B_iso_mean 74.0106 _refine.B_iso_min 15.970 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OYT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8240 _refine.ls_d_res_low 47.1330 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 27942 _refine.ls_number_reflns_R_free 1397 _refine.ls_number_reflns_R_work 26545 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.3600 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2349 _refine.ls_R_factor_R_free 0.2896 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2321 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4BF2 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.8300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8240 _refine_hist.d_res_low 47.1330 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 7556 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 949 _refine_hist.pdbx_B_iso_mean_ligand 49.07 _refine_hist.pdbx_B_iso_mean_solvent 50.17 _refine_hist.pdbx_number_atoms_protein 7309 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 168 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2525 6.122 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2525 6.122 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 2525 6.122 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 2525 6.122 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8240 2.9250 2546 . 127 2419 89.0000 . . . 0.3845 0.0000 0.3408 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 2.9250 3.0421 2781 . 139 2642 98.0000 . . . 0.3643 0.0000 0.3074 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.0421 3.1805 2787 . 139 2648 98.0000 . . . 0.3206 0.0000 0.2810 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.1805 3.3481 2816 . 141 2675 98.0000 . . . 0.2760 0.0000 0.2658 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.3481 3.5578 2787 . 140 2647 99.0000 . . . 0.2797 0.0000 0.2461 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.5578 3.8324 2815 . 140 2675 99.0000 . . . 0.2981 0.0000 0.2251 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 3.8324 4.2179 2828 . 142 2686 99.0000 . . . 0.2581 0.0000 0.2041 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 4.2179 4.8277 2845 . 142 2703 99.0000 . . . 0.2392 0.0000 0.1862 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 4.8277 6.0803 2847 . 142 2705 99.0000 . . . 0.2808 0.0000 0.2183 . . . . . . 10 . . . 'X-RAY DIFFRACTION' 6.0803 47.1395 2890 . 145 2745 98.0000 . . . 0.3187 0.0000 0.2318 . . . . . . 10 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or resid 720 through 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 2 ;(chain B and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 841 or resid 860 through 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 3 ;(chain C and (resid 671 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 through 880 or resid 900 through 938)) ; 1 4 ;(chain D and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A LEU 6 . A GLU 7 . A LEU 671 A GLU 672 ? ;(chain A and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or resid 720 through 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 1 2 A MET 1 . A LYS 274 . A MET 666 A LYS 939 ? ;(chain A and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or resid 720 through 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 1 3 A MET 1 . A LYS 274 . A MET 666 A LYS 939 ? ;(chain A and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or resid 720 through 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 1 4 A MET 1 . A LYS 274 . A MET 666 A LYS 939 ? ;(chain A and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or resid 720 through 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 1 5 A MET 1 . A LYS 274 . A MET 666 A LYS 939 ? ;(chain A and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or resid 720 through 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 2 1 B LEU 6 . B GLU 7 . B LEU 671 B GLU 672 ? ;(chain B and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 841 or resid 860 through 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 2 2 B LEU 5 . B LYS 274 . B LEU 670 B LYS 939 ? ;(chain B and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 841 or resid 860 through 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 2 3 B LEU 5 . B LYS 274 . B LEU 670 B LYS 939 ? ;(chain B and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 841 or resid 860 through 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 2 4 B LEU 5 . B LYS 274 . B LEU 670 B LYS 939 ? ;(chain B and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 841 or resid 860 through 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 2 5 B LEU 5 . B LYS 274 . B LEU 670 B LYS 939 ? ;(chain B and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 841 or resid 860 through 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 3 1 C LEU 6 . C GLY 22 . C LEU 671 C GLY 687 ? ;(chain C and (resid 671 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 through 880 or resid 900 through 938)) ; 1 3 2 C LYS 23 . C LYS 23 . C LYS 688 C LYS 688 ? ;(chain C and (resid 671 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 through 880 or resid 900 through 938)) ; 1 3 3 C LEU 6 . C LEU 273 . C LEU 671 C LEU 938 ? ;(chain C and (resid 671 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 through 880 or resid 900 through 938)) ; 1 3 4 C LEU 6 . C LEU 273 . C LEU 671 C LEU 938 ? ;(chain C and (resid 671 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 through 880 or resid 900 through 938)) ; 1 3 5 C LEU 6 . C LEU 273 . C LEU 671 C LEU 938 ? ;(chain C and (resid 671 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 through 880 or resid 900 through 938)) ; 1 3 6 C LEU 6 . C LEU 273 . C LEU 671 C LEU 938 ? ;(chain C and (resid 671 through 687 or (resid 688 and (name N or name CA or name C or name O or name CB )) or resid 689 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 828 or (resid 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 through 880 or resid 900 through 938)) ; 1 4 1 D LEU 6 . D GLU 7 . D LEU 671 D GLU 672 ? ;(chain D and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 4 2 D MET 1 . M ACT . . D MET 666 D ACT 1001 ? ;(chain D and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 4 3 D MET 1 . M ACT . . D MET 666 D ACT 1001 ? ;(chain D and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 4 4 D MET 1 . M ACT . . D MET 666 D ACT 1001 ? ;(chain D and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; 1 4 5 D MET 1 . M ACT . . D MET 666 D ACT 1001 ? ;(chain D and ((resid 671 through 672 and (name N or name CA or name C or name O or name CB )) or resid 673 through 712 or (resid 720 through 721 and (name N or name CA or name C or name O or name CB )) or resid 722 through 723 or (resid 724 and (name N or name CA or name C or name O or name CB )) or resid 725 through 727 or (resid 728 and (name N or name CA or name C or name O or name CB )) or resid 729 or (resid 730 and (name N or name CA or name C or name O or name CB )) or resid 731 through 766 or (resid 767 and (name N or name CA or name C or name O or name CB )) or resid 768 through 774 or (resid 775 through 776 and (name N or name CA or name C or name O or name CB )) or resid 777 through 827 or (resid 828 through 829 and (name N or name CA or name C or name O or name CB )) or resid 859 or (resid 860 through 862 and (name N or name CA or name C or name O or name CB )) or resid 863 through 875 or (resid 876 and (name N or name CA or name C or name O or name CB )) or resid 877 or (resid 878 and (name N or name CA or name C or name O or name CB )) or resid 879 through 880 or resid 900 through 909 or (resid 910 through 911 and (name N or name CA or name C or name O or name CB )) or resid 912 through 935 or (resid 936 and (name N or name CA or name C or name O or name CB )) or resid 937 through 938)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6OYT _struct.title 'ASK1 kinase domain in complex with GS-4997' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OYT _struct_keywords.text 'ASK1 MAP3K5, Transferase-Transferase Inhibitor complex' _struct_keywords.pdbx_keywords 'Transferase/Transferase Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 3 ? G N N 2 ? H N N 3 ? I N N 3 ? J N N 3 ? K N N 2 ? L N N 3 ? M N N 3 ? N N N 2 ? O N N 3 ? P N N 3 ? Q N N 3 ? R N N 4 ? S N N 4 ? T N N 4 ? U N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 56 ? HIS A 66 ? PRO A 721 HIS A 731 1 ? 11 HELX_P HELX_P2 AA2 LEU A 97 ? LYS A 104 ? LEU A 762 LYS A 769 1 ? 8 HELX_P HELX_P3 AA3 ASN A 111 ? ASN A 132 ? ASN A 776 ASN A 797 1 ? 22 HELX_P HELX_P4 AA4 LYS A 195 ? GLY A 212 ? LYS A 860 GLY A 877 1 ? 18 HELX_P HELX_P5 AA5 SER A 243 ? PHE A 254 ? SER A 908 PHE A 919 1 ? 12 HELX_P HELX_P6 AA6 ASP A 257 ? ARG A 261 ? ASP A 922 ARG A 926 5 ? 5 HELX_P HELX_P7 AA7 CYS A 263 ? VAL A 269 ? CYS A 928 VAL A 934 1 ? 7 HELX_P HELX_P8 AA8 ASP A 270 ? LYS A 274 ? ASP A 935 LYS A 939 5 ? 5 HELX_P HELX_P9 AA9 GLN B 55 ? LYS B 65 ? GLN B 720 LYS B 730 1 ? 11 HELX_P HELX_P10 AB1 LEU B 97 ? LYS B 104 ? LEU B 762 LYS B 769 1 ? 8 HELX_P HELX_P11 AB2 ASN B 111 ? ASN B 132 ? ASN B 776 ASN B 797 1 ? 22 HELX_P HELX_P12 AB3 THR B 177 ? MET B 181 ? THR B 842 MET B 846 5 ? 5 HELX_P HELX_P13 AB4 LYS B 195 ? GLY B 212 ? LYS B 860 GLY B 877 1 ? 18 HELX_P HELX_P14 AB5 MET B 226 ? PHE B 232 ? MET B 891 PHE B 897 1 ? 7 HELX_P HELX_P15 AB6 SER B 243 ? PHE B 254 ? SER B 908 PHE B 919 1 ? 12 HELX_P HELX_P16 AB7 CYS B 263 ? VAL B 269 ? CYS B 928 VAL B 934 1 ? 7 HELX_P HELX_P17 AB8 ASP C 50 ? LYS C 65 ? ASP C 715 LYS C 730 1 ? 16 HELX_P HELX_P18 AB9 LEU C 97 ? LYS C 104 ? LEU C 762 LYS C 769 1 ? 8 HELX_P HELX_P19 AC1 ASN C 111 ? ASN C 132 ? ASN C 776 ASN C 797 1 ? 22 HELX_P HELX_P20 AC2 ALA C 182 ? LYS C 188 ? ALA C 847 LYS C 853 1 ? 7 HELX_P HELX_P21 AC3 LYS C 195 ? GLY C 212 ? LYS C 860 GLY C 877 1 ? 18 HELX_P HELX_P22 AC4 SER C 243 ? PHE C 254 ? SER C 908 PHE C 919 1 ? 12 HELX_P HELX_P23 AC5 CYS C 263 ? VAL C 269 ? CYS C 928 VAL C 934 1 ? 7 HELX_P HELX_P24 AC6 GLN D 55 ? HIS D 66 ? GLN D 720 HIS D 731 1 ? 12 HELX_P HELX_P25 AC7 LEU D 97 ? LYS D 104 ? LEU D 762 LYS D 769 1 ? 8 HELX_P HELX_P26 AC8 ASN D 111 ? ASN D 132 ? ASN D 776 ASN D 797 1 ? 22 HELX_P HELX_P27 AC9 GLY D 194 ? GLY D 212 ? GLY D 859 GLY D 877 1 ? 19 HELX_P HELX_P28 AD1 PRO D 222 ? PHE D 232 ? PRO D 887 PHE D 897 1 ? 11 HELX_P HELX_P29 AD2 SER D 243 ? PHE D 254 ? SER D 908 PHE D 919 1 ? 12 HELX_P HELX_P30 AD3 CYS D 263 ? VAL D 269 ? CYS D 928 VAL D 934 1 ? 7 HELX_P HELX_P31 AD4 ASP D 270 ? LYS D 274 ? ASP D 935 LYS D 939 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 3 ? AA4 ? 2 ? AA5 ? 3 ? AA6 ? 5 ? AA7 ? 3 ? AA8 ? 2 ? AA9 ? 3 ? AB1 ? 5 ? AB2 ? 3 ? AB3 ? 2 ? AB4 ? 3 ? AB5 ? 5 ? AB6 ? 3 ? AB7 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA8 1 2 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AB1 1 2 ? anti-parallel AB1 2 3 ? anti-parallel AB1 3 4 ? anti-parallel AB1 4 5 ? anti-parallel AB2 1 2 ? anti-parallel AB2 2 3 ? anti-parallel AB3 1 2 ? anti-parallel AB4 1 2 ? anti-parallel AB4 2 3 ? anti-parallel AB5 1 2 ? anti-parallel AB5 2 3 ? anti-parallel AB5 3 4 ? anti-parallel AB5 4 5 ? anti-parallel AB6 1 2 ? anti-parallel AB6 2 3 ? anti-parallel AB7 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 8 ? TYR A 10 ? TYR A 673 TYR A 675 AA1 2 ILE A 28 ? ASP A 34 ? ILE A 693 ASP A 699 AA1 3 VAL A 20 ? LYS A 23 ? VAL A 685 LYS A 688 AA2 1 TYR A 8 ? TYR A 10 ? TYR A 673 TYR A 675 AA2 2 ILE A 28 ? ASP A 34 ? ILE A 693 ASP A 699 AA2 3 ARG A 40 ? PRO A 47 ? ARG A 705 PRO A 712 AA2 4 PHE A 84 ? GLU A 90 ? PHE A 749 GLU A 755 AA2 5 TYR A 75 ? GLU A 81 ? TYR A 740 GLU A 746 AA3 1 GLY A 94 ? SER A 96 ? GLY A 759 SER A 761 AA3 2 VAL A 144 ? ASN A 147 ? VAL A 809 ASN A 812 AA3 3 LEU A 153 ? ILE A 155 ? LEU A 818 ILE A 820 AA4 1 ILE A 134 ? VAL A 135 ? ILE A 799 VAL A 800 AA4 2 LYS A 162 ? ARG A 163 ? LYS A 827 ARG A 828 AA5 1 TYR B 8 ? TYR B 10 ? TYR B 673 TYR B 675 AA5 2 ILE B 28 ? ASP B 34 ? ILE B 693 ASP B 699 AA5 3 VAL B 20 ? LYS B 23 ? VAL B 685 LYS B 688 AA6 1 TYR B 8 ? TYR B 10 ? TYR B 673 TYR B 675 AA6 2 ILE B 28 ? ASP B 34 ? ILE B 693 ASP B 699 AA6 3 ARG B 40 ? ILE B 46 ? ARG B 705 ILE B 711 AA6 4 PHE B 84 ? GLU B 90 ? PHE B 749 GLU B 755 AA6 5 TYR B 75 ? GLU B 81 ? TYR B 740 GLU B 746 AA7 1 GLY B 94 ? SER B 96 ? GLY B 759 SER B 761 AA7 2 VAL B 144 ? ASN B 147 ? VAL B 809 ASN B 812 AA7 3 LEU B 153 ? ILE B 155 ? LEU B 818 ILE B 820 AA8 1 ILE B 134 ? VAL B 135 ? ILE B 799 VAL B 800 AA8 2 LYS B 162 ? ARG B 163 ? LYS B 827 ARG B 828 AA9 1 TYR C 8 ? TYR C 10 ? TYR C 673 TYR C 675 AA9 2 ILE C 28 ? ASP C 34 ? ILE C 693 ASP C 699 AA9 3 VAL C 20 ? LYS C 23 ? VAL C 685 LYS C 688 AB1 1 TYR C 8 ? TYR C 10 ? TYR C 673 TYR C 675 AB1 2 ILE C 28 ? ASP C 34 ? ILE C 693 ASP C 699 AB1 3 ARG C 40 ? PRO C 47 ? ARG C 705 PRO C 712 AB1 4 PHE C 84 ? GLU C 90 ? PHE C 749 GLU C 755 AB1 5 TYR C 75 ? GLU C 81 ? TYR C 740 GLU C 746 AB2 1 GLY C 94 ? SER C 96 ? GLY C 759 SER C 761 AB2 2 VAL C 144 ? ASN C 147 ? VAL C 809 ASN C 812 AB2 3 LEU C 153 ? ILE C 155 ? LEU C 818 ILE C 820 AB3 1 ILE C 134 ? VAL C 135 ? ILE C 799 VAL C 800 AB3 2 LYS C 162 ? ARG C 163 ? LYS C 827 ARG C 828 AB4 1 TYR D 8 ? TYR D 10 ? TYR D 673 TYR D 675 AB4 2 ILE D 28 ? ASP D 34 ? ILE D 693 ASP D 699 AB4 3 VAL D 20 ? LYS D 23 ? VAL D 685 LYS D 688 AB5 1 TYR D 8 ? TYR D 10 ? TYR D 673 TYR D 675 AB5 2 ILE D 28 ? ASP D 34 ? ILE D 693 ASP D 699 AB5 3 ARG D 40 ? PRO D 47 ? ARG D 705 PRO D 712 AB5 4 PHE D 84 ? GLU D 90 ? PHE D 749 GLU D 755 AB5 5 TYR D 75 ? GLU D 81 ? TYR D 740 GLU D 746 AB6 1 GLY D 94 ? SER D 96 ? GLY D 759 SER D 761 AB6 2 VAL D 144 ? ASN D 147 ? VAL D 809 ASN D 812 AB6 3 LEU D 153 ? ILE D 155 ? LEU D 818 ILE D 820 AB7 1 ILE D 134 ? VAL D 135 ? ILE D 799 VAL D 800 AB7 2 LYS D 162 ? ARG D 163 ? LYS D 827 ARG D 828 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 9 ? N ASP A 674 O ARG A 33 ? O ARG A 698 AA1 2 3 O VAL A 29 ? O VAL A 694 N GLY A 22 ? N GLY A 687 AA2 1 2 N ASP A 9 ? N ASP A 674 O ARG A 33 ? O ARG A 698 AA2 2 3 N TYR A 30 ? N TYR A 695 O ILE A 43 ? O ILE A 708 AA2 3 4 N ALA A 42 ? N ALA A 707 O MET A 89 ? O MET A 754 AA2 4 5 O PHE A 84 ? O PHE A 749 N GLU A 81 ? N GLU A 746 AA3 1 2 N GLY A 95 ? N GLY A 760 O ILE A 146 ? O ILE A 811 AA3 2 3 N LEU A 145 ? N LEU A 810 O LYS A 154 ? O LYS A 819 AA4 1 2 N VAL A 135 ? N VAL A 800 O LYS A 162 ? O LYS A 827 AA5 1 2 N ASP B 9 ? N ASP B 674 O ARG B 33 ? O ARG B 698 AA5 2 3 O VAL B 29 ? O VAL B 694 N GLY B 22 ? N GLY B 687 AA6 1 2 N ASP B 9 ? N ASP B 674 O ARG B 33 ? O ARG B 698 AA6 2 3 N TYR B 30 ? N TYR B 695 O ILE B 43 ? O ILE B 708 AA6 3 4 N ALA B 42 ? N ALA B 707 O MET B 89 ? O MET B 754 AA6 4 5 O PHE B 88 ? O PHE B 753 N LEU B 76 ? N LEU B 741 AA7 1 2 N GLY B 95 ? N GLY B 760 O ILE B 146 ? O ILE B 811 AA7 2 3 N LEU B 145 ? N LEU B 810 O LYS B 154 ? O LYS B 819 AA8 1 2 N VAL B 135 ? N VAL B 800 O LYS B 162 ? O LYS B 827 AA9 1 2 N ASP C 9 ? N ASP C 674 O ARG C 33 ? O ARG C 698 AA9 2 3 O VAL C 29 ? O VAL C 694 N GLY C 22 ? N GLY C 687 AB1 1 2 N ASP C 9 ? N ASP C 674 O ARG C 33 ? O ARG C 698 AB1 2 3 N TYR C 30 ? N TYR C 695 O ILE C 43 ? O ILE C 708 AB1 3 4 N ALA C 42 ? N ALA C 707 O MET C 89 ? O MET C 754 AB1 4 5 O PHE C 88 ? O PHE C 753 N GLY C 77 ? N GLY C 742 AB2 1 2 N GLY C 95 ? N GLY C 760 O ILE C 146 ? O ILE C 811 AB2 2 3 N LEU C 145 ? N LEU C 810 O LYS C 154 ? O LYS C 819 AB3 1 2 N VAL C 135 ? N VAL C 800 O LYS C 162 ? O LYS C 827 AB4 1 2 N ASP D 9 ? N ASP D 674 O ARG D 33 ? O ARG D 698 AB4 2 3 O VAL D 29 ? O VAL D 694 N LEU D 21 ? N LEU D 686 AB5 1 2 N ASP D 9 ? N ASP D 674 O ARG D 33 ? O ARG D 698 AB5 2 3 N TYR D 30 ? N TYR D 695 O ILE D 43 ? O ILE D 708 AB5 3 4 N ALA D 42 ? N ALA D 707 O MET D 89 ? O MET D 754 AB5 4 5 O PHE D 88 ? O PHE D 753 N GLY D 77 ? N GLY D 742 AB6 1 2 N GLY D 95 ? N GLY D 760 O ILE D 146 ? O ILE D 811 AB6 2 3 N LEU D 145 ? N LEU D 810 O LYS D 154 ? O LYS D 819 AB7 1 2 N VAL D 135 ? N VAL D 800 O LYS D 162 ? O LYS D 827 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NJV 1001 ? 18 'binding site for residue NJV A 1001' AC2 Software A ACT 1002 ? 2 'binding site for residue ACT A 1002' AC3 Software B NJV 1001 ? 13 'binding site for residue NJV B 1001' AC4 Software B ACT 1003 ? 1 'binding site for residue ACT B 1003' AC5 Software B ACT 1004 ? 1 'binding site for residue ACT B 1004' AC6 Software C NJV 1001 ? 13 'binding site for residue NJV C 1001' AC7 Software C ACT 1002 ? 1 'binding site for residue ACT C 1002' AC8 Software D ACT 1001 ? 1 'binding site for residue ACT D 1001' AC9 Software D NJV 1002 ? 16 'binding site for residue NJV D 1002' AD1 Software D ACT 1003 ? 1 'binding site for residue ACT D 1003' AD2 Software D ACT 1004 ? 2 'binding site for residue ACT D 1004' AD3 Software D ACT 1005 ? 2 'binding site for residue ACT D 1005' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 18 LEU A 21 ? LEU A 686 . ? 1_555 ? 2 AC1 18 GLY A 22 ? GLY A 687 . ? 1_555 ? 3 AC1 18 LYS A 23 ? LYS A 688 . ? 1_555 ? 4 AC1 18 GLY A 24 ? GLY A 689 . ? 1_555 ? 5 AC1 18 VAL A 29 ? VAL A 694 . ? 1_555 ? 6 AC1 18 ALA A 42 ? ALA A 707 . ? 1_555 ? 7 AC1 18 LYS A 44 ? LYS A 709 . ? 1_555 ? 8 AC1 18 GLU A 90 ? GLU A 755 . ? 1_555 ? 9 AC1 18 GLN A 91 ? GLN A 756 . ? 1_555 ? 10 AC1 18 VAL A 92 ? VAL A 757 . ? 1_555 ? 11 AC1 18 GLY A 94 ? GLY A 759 . ? 1_555 ? 12 AC1 18 GLY A 95 ? GLY A 760 . ? 1_555 ? 13 AC1 18 ASP A 142 ? ASP A 807 . ? 1_555 ? 14 AC1 18 LEU A 145 ? LEU A 810 . ? 1_555 ? 15 AC1 18 SER A 156 ? SER A 821 . ? 1_555 ? 16 AC1 18 ASP A 157 ? ASP A 822 . ? 1_555 ? 17 AC1 18 TYR C 149 ? TYR C 814 . ? 1_555 ? 18 AC1 18 NJV K . ? NJV C 1001 . ? 1_555 ? 19 AC2 2 TRP A 200 ? TRP A 865 . ? 1_555 ? 20 AC2 2 SER A 201 ? SER A 866 . ? 1_555 ? 21 AC3 13 LEU B 21 ? LEU B 686 . ? 1_555 ? 22 AC3 13 VAL B 29 ? VAL B 694 . ? 1_555 ? 23 AC3 13 LYS B 44 ? LYS B 709 . ? 1_555 ? 24 AC3 13 GLU B 90 ? GLU B 755 . ? 1_555 ? 25 AC3 13 GLN B 91 ? GLN B 756 . ? 1_555 ? 26 AC3 13 VAL B 92 ? VAL B 757 . ? 1_555 ? 27 AC3 13 PRO B 93 ? PRO B 758 . ? 1_555 ? 28 AC3 13 GLY B 94 ? GLY B 759 . ? 1_555 ? 29 AC3 13 ASP B 142 ? ASP B 807 . ? 1_555 ? 30 AC3 13 LEU B 145 ? LEU B 810 . ? 1_555 ? 31 AC3 13 ASP B 157 ? ASP B 822 . ? 1_555 ? 32 AC3 13 TYR D 149 ? TYR D 814 . ? 1_555 ? 33 AC3 13 NJV N . ? NJV D 1002 . ? 1_555 ? 34 AC4 1 GLN B 38 ? GLN B 703 . ? 1_555 ? 35 AC5 1 LYS C 127 ? LYS C 792 . ? 1_555 ? 36 AC6 13 TYR A 149 ? TYR A 814 . ? 1_555 ? 37 AC6 13 NJV E . ? NJV A 1001 . ? 1_555 ? 38 AC6 13 LEU C 21 ? LEU C 686 . ? 1_555 ? 39 AC6 13 LYS C 44 ? LYS C 709 . ? 1_555 ? 40 AC6 13 VAL C 73 ? VAL C 738 . ? 1_555 ? 41 AC6 13 GLU C 90 ? GLU C 755 . ? 1_555 ? 42 AC6 13 GLN C 91 ? GLN C 756 . ? 1_555 ? 43 AC6 13 VAL C 92 ? VAL C 757 . ? 1_555 ? 44 AC6 13 PRO C 93 ? PRO C 758 . ? 1_555 ? 45 AC6 13 GLY C 94 ? GLY C 759 . ? 1_555 ? 46 AC6 13 ASP C 142 ? ASP C 807 . ? 1_555 ? 47 AC6 13 LEU C 145 ? LEU C 810 . ? 1_555 ? 48 AC6 13 ASP C 157 ? ASP C 822 . ? 1_555 ? 49 AC7 1 ASP C 34 ? ASP C 699 . ? 1_555 ? 50 AC8 1 ASP D 257 ? ASP D 922 . ? 1_555 ? 51 AC9 16 TYR B 149 ? TYR B 814 . ? 1_555 ? 52 AC9 16 NJV G . ? NJV B 1001 . ? 1_555 ? 53 AC9 16 LEU D 21 ? LEU D 686 . ? 1_555 ? 54 AC9 16 GLY D 22 ? GLY D 687 . ? 1_555 ? 55 AC9 16 VAL D 29 ? VAL D 694 . ? 1_555 ? 56 AC9 16 ALA D 42 ? ALA D 707 . ? 1_555 ? 57 AC9 16 LYS D 44 ? LYS D 709 . ? 1_555 ? 58 AC9 16 VAL D 73 ? VAL D 738 . ? 1_555 ? 59 AC9 16 GLU D 90 ? GLU D 755 . ? 1_555 ? 60 AC9 16 GLN D 91 ? GLN D 756 . ? 1_555 ? 61 AC9 16 VAL D 92 ? VAL D 757 . ? 1_555 ? 62 AC9 16 GLY D 94 ? GLY D 759 . ? 1_555 ? 63 AC9 16 ASP D 142 ? ASP D 807 . ? 1_555 ? 64 AC9 16 LEU D 145 ? LEU D 810 . ? 1_555 ? 65 AC9 16 SER D 156 ? SER D 821 . ? 1_555 ? 66 AC9 16 ASP D 157 ? ASP D 822 . ? 1_555 ? 67 AD1 1 ILE D 186 ? ILE D 851 . ? 1_555 ? 68 AD2 2 ASP D 34 ? ASP D 699 . ? 1_555 ? 69 AD2 2 ASN D 37 ? ASN D 702 . ? 1_555 ? 70 AD3 2 ARG D 49 ? ARG D 714 . ? 1_555 ? 71 AD3 2 SER D 54 ? SER D 719 . ? 1_555 ? # _atom_sites.entry_id 6OYT _atom_sites.fract_transf_matrix[1][1] 0.011559 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001578 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013589 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010608 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 666 666 MET MET A . n A 1 2 GLU 2 667 667 GLU GLU A . n A 1 3 SER 3 668 668 SER SER A . n A 1 4 ASP 4 669 669 ASP ASP A . n A 1 5 LEU 5 670 670 LEU LEU A . n A 1 6 LEU 6 671 671 LEU LEU A . n A 1 7 GLU 7 672 672 GLU GLU A . n A 1 8 TYR 8 673 673 TYR TYR A . n A 1 9 ASP 9 674 674 ASP ASP A . n A 1 10 TYR 10 675 675 TYR TYR A . n A 1 11 GLU 11 676 676 GLU GLU A . n A 1 12 TYR 12 677 677 TYR TYR A . n A 1 13 ASP 13 678 678 ASP ASP A . n A 1 14 GLU 14 679 679 GLU GLU A . n A 1 15 ASN 15 680 680 ASN ASN A . n A 1 16 GLY 16 681 681 GLY GLY A . n A 1 17 ASP 17 682 682 ASP ASP A . n A 1 18 ARG 18 683 683 ARG ARG A . n A 1 19 VAL 19 684 684 VAL VAL A . n A 1 20 VAL 20 685 685 VAL VAL A . n A 1 21 LEU 21 686 686 LEU LEU A . n A 1 22 GLY 22 687 687 GLY GLY A . n A 1 23 LYS 23 688 688 LYS LYS A . n A 1 24 GLY 24 689 689 GLY GLY A . n A 1 25 THR 25 690 690 THR THR A . n A 1 26 TYR 26 691 691 TYR TYR A . n A 1 27 GLY 27 692 692 GLY GLY A . n A 1 28 ILE 28 693 693 ILE ILE A . n A 1 29 VAL 29 694 694 VAL VAL A . n A 1 30 TYR 30 695 695 TYR TYR A . n A 1 31 ALA 31 696 696 ALA ALA A . n A 1 32 GLY 32 697 697 GLY GLY A . n A 1 33 ARG 33 698 698 ARG ARG A . n A 1 34 ASP 34 699 699 ASP ASP A . n A 1 35 LEU 35 700 700 LEU LEU A . n A 1 36 SER 36 701 701 SER SER A . n A 1 37 ASN 37 702 702 ASN ASN A . n A 1 38 GLN 38 703 703 GLN GLN A . n A 1 39 VAL 39 704 704 VAL VAL A . n A 1 40 ARG 40 705 705 ARG ARG A . n A 1 41 ILE 41 706 706 ILE ILE A . n A 1 42 ALA 42 707 707 ALA ALA A . n A 1 43 ILE 43 708 708 ILE ILE A . n A 1 44 LYS 44 709 709 LYS LYS A . n A 1 45 GLU 45 710 710 GLU GLU A . n A 1 46 ILE 46 711 711 ILE ILE A . n A 1 47 PRO 47 712 712 PRO PRO A . n A 1 48 GLU 48 713 713 GLU GLU A . n A 1 49 ARG 49 714 714 ARG ARG A . n A 1 50 ASP 50 715 ? ? ? A . n A 1 51 SER 51 716 ? ? ? A . n A 1 52 ARG 52 717 ? ? ? A . n A 1 53 TYR 53 718 ? ? ? A . n A 1 54 SER 54 719 ? ? ? A . n A 1 55 GLN 55 720 720 GLN GLN A . n A 1 56 PRO 56 721 721 PRO PRO A . n A 1 57 LEU 57 722 722 LEU LEU A . n A 1 58 HIS 58 723 723 HIS HIS A . n A 1 59 GLU 59 724 724 GLU GLU A . n A 1 60 GLU 60 725 725 GLU GLU A . n A 1 61 ILE 61 726 726 ILE ILE A . n A 1 62 ALA 62 727 727 ALA ALA A . n A 1 63 LEU 63 728 728 LEU LEU A . n A 1 64 HIS 64 729 729 HIS HIS A . n A 1 65 LYS 65 730 730 LYS LYS A . n A 1 66 HIS 66 731 731 HIS HIS A . n A 1 67 LEU 67 732 732 LEU LEU A . n A 1 68 LYS 68 733 733 LYS LYS A . n A 1 69 HIS 69 734 734 HIS HIS A . n A 1 70 LYS 70 735 735 LYS LYS A . n A 1 71 ASN 71 736 736 ASN ASN A . n A 1 72 ILE 72 737 737 ILE ILE A . n A 1 73 VAL 73 738 738 VAL VAL A . n A 1 74 GLN 74 739 739 GLN GLN A . n A 1 75 TYR 75 740 740 TYR TYR A . n A 1 76 LEU 76 741 741 LEU LEU A . n A 1 77 GLY 77 742 742 GLY GLY A . n A 1 78 SER 78 743 743 SER SER A . n A 1 79 PHE 79 744 744 PHE PHE A . n A 1 80 SER 80 745 745 SER SER A . n A 1 81 GLU 81 746 746 GLU GLU A . n A 1 82 ASN 82 747 747 ASN ASN A . n A 1 83 GLY 83 748 748 GLY GLY A . n A 1 84 PHE 84 749 749 PHE PHE A . n A 1 85 ILE 85 750 750 ILE ILE A . n A 1 86 LYS 86 751 751 LYS LYS A . n A 1 87 ILE 87 752 752 ILE ILE A . n A 1 88 PHE 88 753 753 PHE PHE A . n A 1 89 MET 89 754 754 MET MET A . n A 1 90 GLU 90 755 755 GLU GLU A . n A 1 91 GLN 91 756 756 GLN GLN A . n A 1 92 VAL 92 757 757 VAL VAL A . n A 1 93 PRO 93 758 758 PRO PRO A . n A 1 94 GLY 94 759 759 GLY GLY A . n A 1 95 GLY 95 760 760 GLY GLY A . n A 1 96 SER 96 761 761 SER SER A . n A 1 97 LEU 97 762 762 LEU LEU A . n A 1 98 SER 98 763 763 SER SER A . n A 1 99 ALA 99 764 764 ALA ALA A . n A 1 100 LEU 100 765 765 LEU LEU A . n A 1 101 LEU 101 766 766 LEU LEU A . n A 1 102 ARG 102 767 767 ARG ARG A . n A 1 103 SER 103 768 768 SER SER A . n A 1 104 LYS 104 769 769 LYS LYS A . n A 1 105 TRP 105 770 770 TRP TRP A . n A 1 106 GLY 106 771 771 GLY GLY A . n A 1 107 PRO 107 772 772 PRO PRO A . n A 1 108 LEU 108 773 773 LEU LEU A . n A 1 109 LYS 109 774 774 LYS LYS A . n A 1 110 ASP 110 775 775 ASP ASP A . n A 1 111 ASN 111 776 776 ASN ASN A . n A 1 112 GLU 112 777 777 GLU GLU A . n A 1 113 GLN 113 778 778 GLN GLN A . n A 1 114 THR 114 779 779 THR THR A . n A 1 115 ILE 115 780 780 ILE ILE A . n A 1 116 GLY 116 781 781 GLY GLY A . n A 1 117 PHE 117 782 782 PHE PHE A . n A 1 118 TYR 118 783 783 TYR TYR A . n A 1 119 THR 119 784 784 THR THR A . n A 1 120 LYS 120 785 785 LYS LYS A . n A 1 121 GLN 121 786 786 GLN GLN A . n A 1 122 ILE 122 787 787 ILE ILE A . n A 1 123 LEU 123 788 788 LEU LEU A . n A 1 124 GLU 124 789 789 GLU GLU A . n A 1 125 GLY 125 790 790 GLY GLY A . n A 1 126 LEU 126 791 791 LEU LEU A . n A 1 127 LYS 127 792 792 LYS LYS A . n A 1 128 TYR 128 793 793 TYR TYR A . n A 1 129 LEU 129 794 794 LEU LEU A . n A 1 130 HIS 130 795 795 HIS HIS A . n A 1 131 ASP 131 796 796 ASP ASP A . n A 1 132 ASN 132 797 797 ASN ASN A . n A 1 133 GLN 133 798 798 GLN GLN A . n A 1 134 ILE 134 799 799 ILE ILE A . n A 1 135 VAL 135 800 800 VAL VAL A . n A 1 136 HIS 136 801 801 HIS HIS A . n A 1 137 ARG 137 802 802 ARG ARG A . n A 1 138 ASP 138 803 803 ASP ASP A . n A 1 139 ILE 139 804 804 ILE ILE A . n A 1 140 LYS 140 805 805 LYS LYS A . n A 1 141 GLY 141 806 806 GLY GLY A . n A 1 142 ASP 142 807 807 ASP ASP A . n A 1 143 ASN 143 808 808 ASN ASN A . n A 1 144 VAL 144 809 809 VAL VAL A . n A 1 145 LEU 145 810 810 LEU LEU A . n A 1 146 ILE 146 811 811 ILE ILE A . n A 1 147 ASN 147 812 812 ASN ASN A . n A 1 148 THR 148 813 813 THR THR A . n A 1 149 TYR 149 814 814 TYR TYR A . n A 1 150 SER 150 815 815 SER SER A . n A 1 151 GLY 151 816 816 GLY GLY A . n A 1 152 VAL 152 817 817 VAL VAL A . n A 1 153 LEU 153 818 818 LEU LEU A . n A 1 154 LYS 154 819 819 LYS LYS A . n A 1 155 ILE 155 820 820 ILE ILE A . n A 1 156 SER 156 821 821 SER SER A . n A 1 157 ASP 157 822 822 ASP ASP A . n A 1 158 PHE 158 823 823 PHE PHE A . n A 1 159 GLY 159 824 824 GLY GLY A . n A 1 160 THR 160 825 825 THR THR A . n A 1 161 SER 161 826 826 SER SER A . n A 1 162 LYS 162 827 827 LYS LYS A . n A 1 163 ARG 163 828 828 ARG ARG A . n A 1 164 LEU 164 829 829 LEU LEU A . n A 1 165 ALA 165 830 ? ? ? A . n A 1 166 GLY 166 831 ? ? ? A . n A 1 167 ILE 167 832 ? ? ? A . n A 1 168 ASN 168 833 ? ? ? A . n A 1 169 PRO 169 834 ? ? ? A . n A 1 170 CYS 170 835 ? ? ? A . n A 1 171 THR 171 836 ? ? ? A . n A 1 172 GLU 172 837 ? ? ? A . n A 1 173 THR 173 838 ? ? ? A . n A 1 174 PHE 174 839 ? ? ? A . n A 1 175 THR 175 840 ? ? ? A . n A 1 176 GLY 176 841 ? ? ? A . n A 1 177 THR 177 842 ? ? ? A . n A 1 178 LEU 178 843 ? ? ? A . n A 1 179 GLN 179 844 ? ? ? A . n A 1 180 TYR 180 845 ? ? ? A . n A 1 181 MET 181 846 ? ? ? A . n A 1 182 ALA 182 847 ? ? ? A . n A 1 183 PRO 183 848 ? ? ? A . n A 1 184 GLU 184 849 ? ? ? A . n A 1 185 ILE 185 850 ? ? ? A . n A 1 186 ILE 186 851 ? ? ? A . n A 1 187 ASP 187 852 ? ? ? A . n A 1 188 LYS 188 853 ? ? ? A . n A 1 189 GLY 189 854 ? ? ? A . n A 1 190 PRO 190 855 ? ? ? A . n A 1 191 ARG 191 856 ? ? ? A . n A 1 192 GLY 192 857 ? ? ? A . n A 1 193 TYR 193 858 ? ? ? A . n A 1 194 GLY 194 859 859 GLY GLY A . n A 1 195 LYS 195 860 860 LYS LYS A . n A 1 196 ALA 196 861 861 ALA ALA A . n A 1 197 ALA 197 862 862 ALA ALA A . n A 1 198 ASP 198 863 863 ASP ASP A . n A 1 199 ILE 199 864 864 ILE ILE A . n A 1 200 TRP 200 865 865 TRP TRP A . n A 1 201 SER 201 866 866 SER SER A . n A 1 202 LEU 202 867 867 LEU LEU A . n A 1 203 GLY 203 868 868 GLY GLY A . n A 1 204 CYS 204 869 869 CYS CYS A . n A 1 205 THR 205 870 870 THR THR A . n A 1 206 ILE 206 871 871 ILE ILE A . n A 1 207 ILE 207 872 872 ILE ILE A . n A 1 208 GLU 208 873 873 GLU GLU A . n A 1 209 MET 209 874 874 MET MET A . n A 1 210 ALA 210 875 875 ALA ALA A . n A 1 211 THR 211 876 876 THR THR A . n A 1 212 GLY 212 877 877 GLY GLY A . n A 1 213 LYS 213 878 878 LYS LYS A . n A 1 214 PRO 214 879 879 PRO PRO A . n A 1 215 PRO 215 880 880 PRO PRO A . n A 1 216 PHE 216 881 ? ? ? A . n A 1 217 TYR 217 882 ? ? ? A . n A 1 218 GLU 218 883 ? ? ? A . n A 1 219 LEU 219 884 ? ? ? A . n A 1 220 GLY 220 885 ? ? ? A . n A 1 221 GLU 221 886 ? ? ? A . n A 1 222 PRO 222 887 ? ? ? A . n A 1 223 GLN 223 888 ? ? ? A . n A 1 224 ALA 224 889 ? ? ? A . n A 1 225 ALA 225 890 ? ? ? A . n A 1 226 MET 226 891 ? ? ? A . n A 1 227 PHE 227 892 ? ? ? A . n A 1 228 LYS 228 893 ? ? ? A . n A 1 229 VAL 229 894 ? ? ? A . n A 1 230 GLY 230 895 ? ? ? A . n A 1 231 MET 231 896 ? ? ? A . n A 1 232 PHE 232 897 ? ? ? A . n A 1 233 LYS 233 898 ? ? ? A . n A 1 234 VAL 234 899 899 VAL VAL A . n A 1 235 HIS 235 900 900 HIS HIS A . n A 1 236 PRO 236 901 901 PRO PRO A . n A 1 237 GLU 237 902 902 GLU GLU A . n A 1 238 ILE 238 903 903 ILE ILE A . n A 1 239 PRO 239 904 904 PRO PRO A . n A 1 240 GLU 240 905 905 GLU GLU A . n A 1 241 SER 241 906 906 SER SER A . n A 1 242 MET 242 907 907 MET MET A . n A 1 243 SER 243 908 908 SER SER A . n A 1 244 ALA 244 909 909 ALA ALA A . n A 1 245 GLU 245 910 910 GLU GLU A . n A 1 246 ALA 246 911 911 ALA ALA A . n A 1 247 LYS 247 912 912 LYS LYS A . n A 1 248 ALA 248 913 913 ALA ALA A . n A 1 249 PHE 249 914 914 PHE PHE A . n A 1 250 ILE 250 915 915 ILE ILE A . n A 1 251 LEU 251 916 916 LEU LEU A . n A 1 252 LYS 252 917 917 LYS LYS A . n A 1 253 CYS 253 918 918 CYS CYS A . n A 1 254 PHE 254 919 919 PHE PHE A . n A 1 255 GLU 255 920 920 GLU GLU A . n A 1 256 PRO 256 921 921 PRO PRO A . n A 1 257 ASP 257 922 922 ASP ASP A . n A 1 258 PRO 258 923 923 PRO PRO A . n A 1 259 ASP 259 924 924 ASP ASP A . n A 1 260 LYS 260 925 925 LYS LYS A . n A 1 261 ARG 261 926 926 ARG ARG A . n A 1 262 ALA 262 927 927 ALA ALA A . n A 1 263 CYS 263 928 928 CYS CYS A . n A 1 264 ALA 264 929 929 ALA ALA A . n A 1 265 ASN 265 930 930 ASN ASN A . n A 1 266 ASP 266 931 931 ASP ASP A . n A 1 267 LEU 267 932 932 LEU LEU A . n A 1 268 LEU 268 933 933 LEU LEU A . n A 1 269 VAL 269 934 934 VAL VAL A . n A 1 270 ASP 270 935 935 ASP ASP A . n A 1 271 GLU 271 936 936 GLU GLU A . n A 1 272 PHE 272 937 937 PHE PHE A . n A 1 273 LEU 273 938 938 LEU LEU A . n A 1 274 LYS 274 939 939 LYS LYS A . n A 1 275 HIS 275 940 ? ? ? A . n A 1 276 HIS 276 941 ? ? ? A . n A 1 277 HIS 277 942 ? ? ? A . n A 1 278 HIS 278 943 ? ? ? A . n A 1 279 HIS 279 944 ? ? ? A . n A 1 280 HIS 280 945 ? ? ? A . n B 1 1 MET 1 666 ? ? ? B . n B 1 2 GLU 2 667 ? ? ? B . n B 1 3 SER 3 668 ? ? ? B . n B 1 4 ASP 4 669 ? ? ? B . n B 1 5 LEU 5 670 670 LEU LEU B . n B 1 6 LEU 6 671 671 LEU LEU B . n B 1 7 GLU 7 672 672 GLU GLU B . n B 1 8 TYR 8 673 673 TYR TYR B . n B 1 9 ASP 9 674 674 ASP ASP B . n B 1 10 TYR 10 675 675 TYR TYR B . n B 1 11 GLU 11 676 676 GLU GLU B . n B 1 12 TYR 12 677 677 TYR TYR B . n B 1 13 ASP 13 678 678 ASP ASP B . n B 1 14 GLU 14 679 679 GLU GLU B . n B 1 15 ASN 15 680 680 ASN ASN B . n B 1 16 GLY 16 681 681 GLY GLY B . n B 1 17 ASP 17 682 682 ASP ASP B . n B 1 18 ARG 18 683 683 ARG ARG B . n B 1 19 VAL 19 684 684 VAL VAL B . n B 1 20 VAL 20 685 685 VAL VAL B . n B 1 21 LEU 21 686 686 LEU LEU B . n B 1 22 GLY 22 687 687 GLY GLY B . n B 1 23 LYS 23 688 688 LYS LYS B . n B 1 24 GLY 24 689 689 GLY GLY B . n B 1 25 THR 25 690 690 THR THR B . n B 1 26 TYR 26 691 691 TYR TYR B . n B 1 27 GLY 27 692 692 GLY GLY B . n B 1 28 ILE 28 693 693 ILE ILE B . n B 1 29 VAL 29 694 694 VAL VAL B . n B 1 30 TYR 30 695 695 TYR TYR B . n B 1 31 ALA 31 696 696 ALA ALA B . n B 1 32 GLY 32 697 697 GLY GLY B . n B 1 33 ARG 33 698 698 ARG ARG B . n B 1 34 ASP 34 699 699 ASP ASP B . n B 1 35 LEU 35 700 700 LEU LEU B . n B 1 36 SER 36 701 701 SER SER B . n B 1 37 ASN 37 702 702 ASN ASN B . n B 1 38 GLN 38 703 703 GLN GLN B . n B 1 39 VAL 39 704 704 VAL VAL B . n B 1 40 ARG 40 705 705 ARG ARG B . n B 1 41 ILE 41 706 706 ILE ILE B . n B 1 42 ALA 42 707 707 ALA ALA B . n B 1 43 ILE 43 708 708 ILE ILE B . n B 1 44 LYS 44 709 709 LYS LYS B . n B 1 45 GLU 45 710 710 GLU GLU B . n B 1 46 ILE 46 711 711 ILE ILE B . n B 1 47 PRO 47 712 712 PRO PRO B . n B 1 48 GLU 48 713 ? ? ? B . n B 1 49 ARG 49 714 ? ? ? B . n B 1 50 ASP 50 715 ? ? ? B . n B 1 51 SER 51 716 ? ? ? B . n B 1 52 ARG 52 717 ? ? ? B . n B 1 53 TYR 53 718 ? ? ? B . n B 1 54 SER 54 719 719 SER SER B . n B 1 55 GLN 55 720 720 GLN GLN B . n B 1 56 PRO 56 721 721 PRO PRO B . n B 1 57 LEU 57 722 722 LEU LEU B . n B 1 58 HIS 58 723 723 HIS HIS B . n B 1 59 GLU 59 724 724 GLU GLU B . n B 1 60 GLU 60 725 725 GLU GLU B . n B 1 61 ILE 61 726 726 ILE ILE B . n B 1 62 ALA 62 727 727 ALA ALA B . n B 1 63 LEU 63 728 728 LEU LEU B . n B 1 64 HIS 64 729 729 HIS HIS B . n B 1 65 LYS 65 730 730 LYS LYS B . n B 1 66 HIS 66 731 731 HIS HIS B . n B 1 67 LEU 67 732 732 LEU LEU B . n B 1 68 LYS 68 733 733 LYS LYS B . n B 1 69 HIS 69 734 734 HIS HIS B . n B 1 70 LYS 70 735 735 LYS LYS B . n B 1 71 ASN 71 736 736 ASN ASN B . n B 1 72 ILE 72 737 737 ILE ILE B . n B 1 73 VAL 73 738 738 VAL VAL B . n B 1 74 GLN 74 739 739 GLN GLN B . n B 1 75 TYR 75 740 740 TYR TYR B . n B 1 76 LEU 76 741 741 LEU LEU B . n B 1 77 GLY 77 742 742 GLY GLY B . n B 1 78 SER 78 743 743 SER SER B . n B 1 79 PHE 79 744 744 PHE PHE B . n B 1 80 SER 80 745 745 SER SER B . n B 1 81 GLU 81 746 746 GLU GLU B . n B 1 82 ASN 82 747 747 ASN ASN B . n B 1 83 GLY 83 748 748 GLY GLY B . n B 1 84 PHE 84 749 749 PHE PHE B . n B 1 85 ILE 85 750 750 ILE ILE B . n B 1 86 LYS 86 751 751 LYS LYS B . n B 1 87 ILE 87 752 752 ILE ILE B . n B 1 88 PHE 88 753 753 PHE PHE B . n B 1 89 MET 89 754 754 MET MET B . n B 1 90 GLU 90 755 755 GLU GLU B . n B 1 91 GLN 91 756 756 GLN GLN B . n B 1 92 VAL 92 757 757 VAL VAL B . n B 1 93 PRO 93 758 758 PRO PRO B . n B 1 94 GLY 94 759 759 GLY GLY B . n B 1 95 GLY 95 760 760 GLY GLY B . n B 1 96 SER 96 761 761 SER SER B . n B 1 97 LEU 97 762 762 LEU LEU B . n B 1 98 SER 98 763 763 SER SER B . n B 1 99 ALA 99 764 764 ALA ALA B . n B 1 100 LEU 100 765 765 LEU LEU B . n B 1 101 LEU 101 766 766 LEU LEU B . n B 1 102 ARG 102 767 767 ARG ARG B . n B 1 103 SER 103 768 768 SER SER B . n B 1 104 LYS 104 769 769 LYS LYS B . n B 1 105 TRP 105 770 770 TRP TRP B . n B 1 106 GLY 106 771 771 GLY GLY B . n B 1 107 PRO 107 772 772 PRO PRO B . n B 1 108 LEU 108 773 773 LEU LEU B . n B 1 109 LYS 109 774 774 LYS LYS B . n B 1 110 ASP 110 775 775 ASP ASP B . n B 1 111 ASN 111 776 776 ASN ASN B . n B 1 112 GLU 112 777 777 GLU GLU B . n B 1 113 GLN 113 778 778 GLN GLN B . n B 1 114 THR 114 779 779 THR THR B . n B 1 115 ILE 115 780 780 ILE ILE B . n B 1 116 GLY 116 781 781 GLY GLY B . n B 1 117 PHE 117 782 782 PHE PHE B . n B 1 118 TYR 118 783 783 TYR TYR B . n B 1 119 THR 119 784 784 THR THR B . n B 1 120 LYS 120 785 785 LYS LYS B . n B 1 121 GLN 121 786 786 GLN GLN B . n B 1 122 ILE 122 787 787 ILE ILE B . n B 1 123 LEU 123 788 788 LEU LEU B . n B 1 124 GLU 124 789 789 GLU GLU B . n B 1 125 GLY 125 790 790 GLY GLY B . n B 1 126 LEU 126 791 791 LEU LEU B . n B 1 127 LYS 127 792 792 LYS LYS B . n B 1 128 TYR 128 793 793 TYR TYR B . n B 1 129 LEU 129 794 794 LEU LEU B . n B 1 130 HIS 130 795 795 HIS HIS B . n B 1 131 ASP 131 796 796 ASP ASP B . n B 1 132 ASN 132 797 797 ASN ASN B . n B 1 133 GLN 133 798 798 GLN GLN B . n B 1 134 ILE 134 799 799 ILE ILE B . n B 1 135 VAL 135 800 800 VAL VAL B . n B 1 136 HIS 136 801 801 HIS HIS B . n B 1 137 ARG 137 802 802 ARG ARG B . n B 1 138 ASP 138 803 803 ASP ASP B . n B 1 139 ILE 139 804 804 ILE ILE B . n B 1 140 LYS 140 805 805 LYS LYS B . n B 1 141 GLY 141 806 806 GLY GLY B . n B 1 142 ASP 142 807 807 ASP ASP B . n B 1 143 ASN 143 808 808 ASN ASN B . n B 1 144 VAL 144 809 809 VAL VAL B . n B 1 145 LEU 145 810 810 LEU LEU B . n B 1 146 ILE 146 811 811 ILE ILE B . n B 1 147 ASN 147 812 812 ASN ASN B . n B 1 148 THR 148 813 813 THR THR B . n B 1 149 TYR 149 814 814 TYR TYR B . n B 1 150 SER 150 815 815 SER SER B . n B 1 151 GLY 151 816 816 GLY GLY B . n B 1 152 VAL 152 817 817 VAL VAL B . n B 1 153 LEU 153 818 818 LEU LEU B . n B 1 154 LYS 154 819 819 LYS LYS B . n B 1 155 ILE 155 820 820 ILE ILE B . n B 1 156 SER 156 821 821 SER SER B . n B 1 157 ASP 157 822 822 ASP ASP B . n B 1 158 PHE 158 823 823 PHE PHE B . n B 1 159 GLY 159 824 824 GLY GLY B . n B 1 160 THR 160 825 825 THR THR B . n B 1 161 SER 161 826 826 SER SER B . n B 1 162 LYS 162 827 827 LYS LYS B . n B 1 163 ARG 163 828 828 ARG ARG B . n B 1 164 LEU 164 829 829 LEU LEU B . n B 1 165 ALA 165 830 830 ALA ALA B . n B 1 166 GLY 166 831 ? ? ? B . n B 1 167 ILE 167 832 ? ? ? B . n B 1 168 ASN 168 833 ? ? ? B . n B 1 169 PRO 169 834 ? ? ? B . n B 1 170 CYS 170 835 ? ? ? B . n B 1 171 THR 171 836 ? ? ? B . n B 1 172 GLU 172 837 ? ? ? B . n B 1 173 THR 173 838 ? ? ? B . n B 1 174 PHE 174 839 ? ? ? B . n B 1 175 THR 175 840 ? ? ? B . n B 1 176 GLY 176 841 841 GLY GLY B . n B 1 177 THR 177 842 842 THR THR B . n B 1 178 LEU 178 843 843 LEU LEU B . n B 1 179 GLN 179 844 844 GLN GLN B . n B 1 180 TYR 180 845 845 TYR TYR B . n B 1 181 MET 181 846 846 MET MET B . n B 1 182 ALA 182 847 847 ALA ALA B . n B 1 183 PRO 183 848 848 PRO PRO B . n B 1 184 GLU 184 849 849 GLU GLU B . n B 1 185 ILE 185 850 850 ILE ILE B . n B 1 186 ILE 186 851 ? ? ? B . n B 1 187 ASP 187 852 ? ? ? B . n B 1 188 LYS 188 853 ? ? ? B . n B 1 189 GLY 189 854 ? ? ? B . n B 1 190 PRO 190 855 ? ? ? B . n B 1 191 ARG 191 856 ? ? ? B . n B 1 192 GLY 192 857 ? ? ? B . n B 1 193 TYR 193 858 ? ? ? B . n B 1 194 GLY 194 859 859 GLY GLY B . n B 1 195 LYS 195 860 860 LYS LYS B . n B 1 196 ALA 196 861 861 ALA ALA B . n B 1 197 ALA 197 862 862 ALA ALA B . n B 1 198 ASP 198 863 863 ASP ASP B . n B 1 199 ILE 199 864 864 ILE ILE B . n B 1 200 TRP 200 865 865 TRP TRP B . n B 1 201 SER 201 866 866 SER SER B . n B 1 202 LEU 202 867 867 LEU LEU B . n B 1 203 GLY 203 868 868 GLY GLY B . n B 1 204 CYS 204 869 869 CYS CYS B . n B 1 205 THR 205 870 870 THR THR B . n B 1 206 ILE 206 871 871 ILE ILE B . n B 1 207 ILE 207 872 872 ILE ILE B . n B 1 208 GLU 208 873 873 GLU GLU B . n B 1 209 MET 209 874 874 MET MET B . n B 1 210 ALA 210 875 875 ALA ALA B . n B 1 211 THR 211 876 876 THR THR B . n B 1 212 GLY 212 877 877 GLY GLY B . n B 1 213 LYS 213 878 878 LYS LYS B . n B 1 214 PRO 214 879 879 PRO PRO B . n B 1 215 PRO 215 880 880 PRO PRO B . n B 1 216 PHE 216 881 ? ? ? B . n B 1 217 TYR 217 882 ? ? ? B . n B 1 218 GLU 218 883 ? ? ? B . n B 1 219 LEU 219 884 ? ? ? B . n B 1 220 GLY 220 885 ? ? ? B . n B 1 221 GLU 221 886 ? ? ? B . n B 1 222 PRO 222 887 ? ? ? B . n B 1 223 GLN 223 888 ? ? ? B . n B 1 224 ALA 224 889 889 ALA ALA B . n B 1 225 ALA 225 890 890 ALA ALA B . n B 1 226 MET 226 891 891 MET MET B . n B 1 227 PHE 227 892 892 PHE PHE B . n B 1 228 LYS 228 893 893 LYS LYS B . n B 1 229 VAL 229 894 894 VAL VAL B . n B 1 230 GLY 230 895 895 GLY GLY B . n B 1 231 MET 231 896 896 MET MET B . n B 1 232 PHE 232 897 897 PHE PHE B . n B 1 233 LYS 233 898 898 LYS LYS B . n B 1 234 VAL 234 899 899 VAL VAL B . n B 1 235 HIS 235 900 900 HIS HIS B . n B 1 236 PRO 236 901 901 PRO PRO B . n B 1 237 GLU 237 902 902 GLU GLU B . n B 1 238 ILE 238 903 903 ILE ILE B . n B 1 239 PRO 239 904 904 PRO PRO B . n B 1 240 GLU 240 905 905 GLU GLU B . n B 1 241 SER 241 906 906 SER SER B . n B 1 242 MET 242 907 907 MET MET B . n B 1 243 SER 243 908 908 SER SER B . n B 1 244 ALA 244 909 909 ALA ALA B . n B 1 245 GLU 245 910 910 GLU GLU B . n B 1 246 ALA 246 911 911 ALA ALA B . n B 1 247 LYS 247 912 912 LYS LYS B . n B 1 248 ALA 248 913 913 ALA ALA B . n B 1 249 PHE 249 914 914 PHE PHE B . n B 1 250 ILE 250 915 915 ILE ILE B . n B 1 251 LEU 251 916 916 LEU LEU B . n B 1 252 LYS 252 917 917 LYS LYS B . n B 1 253 CYS 253 918 918 CYS CYS B . n B 1 254 PHE 254 919 919 PHE PHE B . n B 1 255 GLU 255 920 920 GLU GLU B . n B 1 256 PRO 256 921 921 PRO PRO B . n B 1 257 ASP 257 922 922 ASP ASP B . n B 1 258 PRO 258 923 923 PRO PRO B . n B 1 259 ASP 259 924 924 ASP ASP B . n B 1 260 LYS 260 925 925 LYS LYS B . n B 1 261 ARG 261 926 926 ARG ARG B . n B 1 262 ALA 262 927 927 ALA ALA B . n B 1 263 CYS 263 928 928 CYS CYS B . n B 1 264 ALA 264 929 929 ALA ALA B . n B 1 265 ASN 265 930 930 ASN ASN B . n B 1 266 ASP 266 931 931 ASP ASP B . n B 1 267 LEU 267 932 932 LEU LEU B . n B 1 268 LEU 268 933 933 LEU LEU B . n B 1 269 VAL 269 934 934 VAL VAL B . n B 1 270 ASP 270 935 935 ASP ASP B . n B 1 271 GLU 271 936 936 GLU GLU B . n B 1 272 PHE 272 937 937 PHE PHE B . n B 1 273 LEU 273 938 938 LEU LEU B . n B 1 274 LYS 274 939 939 LYS LYS B . n B 1 275 HIS 275 940 ? ? ? B . n B 1 276 HIS 276 941 ? ? ? B . n B 1 277 HIS 277 942 ? ? ? B . n B 1 278 HIS 278 943 ? ? ? B . n B 1 279 HIS 279 944 ? ? ? B . n B 1 280 HIS 280 945 ? ? ? B . n C 1 1 MET 1 666 ? ? ? C . n C 1 2 GLU 2 667 ? ? ? C . n C 1 3 SER 3 668 ? ? ? C . n C 1 4 ASP 4 669 ? ? ? C . n C 1 5 LEU 5 670 ? ? ? C . n C 1 6 LEU 6 671 671 LEU LEU C . n C 1 7 GLU 7 672 672 GLU GLU C . n C 1 8 TYR 8 673 673 TYR TYR C . n C 1 9 ASP 9 674 674 ASP ASP C . n C 1 10 TYR 10 675 675 TYR TYR C . n C 1 11 GLU 11 676 676 GLU GLU C . n C 1 12 TYR 12 677 677 TYR TYR C . n C 1 13 ASP 13 678 678 ASP ASP C . n C 1 14 GLU 14 679 679 GLU GLU C . n C 1 15 ASN 15 680 680 ASN ASN C . n C 1 16 GLY 16 681 681 GLY GLY C . n C 1 17 ASP 17 682 682 ASP ASP C . n C 1 18 ARG 18 683 683 ARG ARG C . n C 1 19 VAL 19 684 684 VAL VAL C . n C 1 20 VAL 20 685 685 VAL VAL C . n C 1 21 LEU 21 686 686 LEU LEU C . n C 1 22 GLY 22 687 687 GLY GLY C . n C 1 23 LYS 23 688 688 LYS LYS C . n C 1 24 GLY 24 689 689 GLY GLY C . n C 1 25 THR 25 690 690 THR THR C . n C 1 26 TYR 26 691 691 TYR TYR C . n C 1 27 GLY 27 692 692 GLY GLY C . n C 1 28 ILE 28 693 693 ILE ILE C . n C 1 29 VAL 29 694 694 VAL VAL C . n C 1 30 TYR 30 695 695 TYR TYR C . n C 1 31 ALA 31 696 696 ALA ALA C . n C 1 32 GLY 32 697 697 GLY GLY C . n C 1 33 ARG 33 698 698 ARG ARG C . n C 1 34 ASP 34 699 699 ASP ASP C . n C 1 35 LEU 35 700 700 LEU LEU C . n C 1 36 SER 36 701 701 SER SER C . n C 1 37 ASN 37 702 702 ASN ASN C . n C 1 38 GLN 38 703 703 GLN GLN C . n C 1 39 VAL 39 704 704 VAL VAL C . n C 1 40 ARG 40 705 705 ARG ARG C . n C 1 41 ILE 41 706 706 ILE ILE C . n C 1 42 ALA 42 707 707 ALA ALA C . n C 1 43 ILE 43 708 708 ILE ILE C . n C 1 44 LYS 44 709 709 LYS LYS C . n C 1 45 GLU 45 710 710 GLU GLU C . n C 1 46 ILE 46 711 711 ILE ILE C . n C 1 47 PRO 47 712 712 PRO PRO C . n C 1 48 GLU 48 713 713 GLU GLU C . n C 1 49 ARG 49 714 714 ARG ARG C . n C 1 50 ASP 50 715 715 ASP ASP C . n C 1 51 SER 51 716 716 SER SER C . n C 1 52 ARG 52 717 717 ARG ARG C . n C 1 53 TYR 53 718 718 TYR TYR C . n C 1 54 SER 54 719 719 SER SER C . n C 1 55 GLN 55 720 720 GLN GLN C . n C 1 56 PRO 56 721 721 PRO PRO C . n C 1 57 LEU 57 722 722 LEU LEU C . n C 1 58 HIS 58 723 723 HIS HIS C . n C 1 59 GLU 59 724 724 GLU GLU C . n C 1 60 GLU 60 725 725 GLU GLU C . n C 1 61 ILE 61 726 726 ILE ILE C . n C 1 62 ALA 62 727 727 ALA ALA C . n C 1 63 LEU 63 728 728 LEU LEU C . n C 1 64 HIS 64 729 729 HIS HIS C . n C 1 65 LYS 65 730 730 LYS LYS C . n C 1 66 HIS 66 731 731 HIS HIS C . n C 1 67 LEU 67 732 732 LEU LEU C . n C 1 68 LYS 68 733 733 LYS LYS C . n C 1 69 HIS 69 734 734 HIS HIS C . n C 1 70 LYS 70 735 735 LYS LYS C . n C 1 71 ASN 71 736 736 ASN ASN C . n C 1 72 ILE 72 737 737 ILE ILE C . n C 1 73 VAL 73 738 738 VAL VAL C . n C 1 74 GLN 74 739 739 GLN GLN C . n C 1 75 TYR 75 740 740 TYR TYR C . n C 1 76 LEU 76 741 741 LEU LEU C . n C 1 77 GLY 77 742 742 GLY GLY C . n C 1 78 SER 78 743 743 SER SER C . n C 1 79 PHE 79 744 744 PHE PHE C . n C 1 80 SER 80 745 745 SER SER C . n C 1 81 GLU 81 746 746 GLU GLU C . n C 1 82 ASN 82 747 747 ASN ASN C . n C 1 83 GLY 83 748 748 GLY GLY C . n C 1 84 PHE 84 749 749 PHE PHE C . n C 1 85 ILE 85 750 750 ILE ILE C . n C 1 86 LYS 86 751 751 LYS LYS C . n C 1 87 ILE 87 752 752 ILE ILE C . n C 1 88 PHE 88 753 753 PHE PHE C . n C 1 89 MET 89 754 754 MET MET C . n C 1 90 GLU 90 755 755 GLU GLU C . n C 1 91 GLN 91 756 756 GLN GLN C . n C 1 92 VAL 92 757 757 VAL VAL C . n C 1 93 PRO 93 758 758 PRO PRO C . n C 1 94 GLY 94 759 759 GLY GLY C . n C 1 95 GLY 95 760 760 GLY GLY C . n C 1 96 SER 96 761 761 SER SER C . n C 1 97 LEU 97 762 762 LEU LEU C . n C 1 98 SER 98 763 763 SER SER C . n C 1 99 ALA 99 764 764 ALA ALA C . n C 1 100 LEU 100 765 765 LEU LEU C . n C 1 101 LEU 101 766 766 LEU LEU C . n C 1 102 ARG 102 767 767 ARG ARG C . n C 1 103 SER 103 768 768 SER SER C . n C 1 104 LYS 104 769 769 LYS LYS C . n C 1 105 TRP 105 770 770 TRP TRP C . n C 1 106 GLY 106 771 771 GLY GLY C . n C 1 107 PRO 107 772 772 PRO PRO C . n C 1 108 LEU 108 773 773 LEU LEU C . n C 1 109 LYS 109 774 774 LYS LYS C . n C 1 110 ASP 110 775 775 ASP ASP C . n C 1 111 ASN 111 776 776 ASN ASN C . n C 1 112 GLU 112 777 777 GLU GLU C . n C 1 113 GLN 113 778 778 GLN GLN C . n C 1 114 THR 114 779 779 THR THR C . n C 1 115 ILE 115 780 780 ILE ILE C . n C 1 116 GLY 116 781 781 GLY GLY C . n C 1 117 PHE 117 782 782 PHE PHE C . n C 1 118 TYR 118 783 783 TYR TYR C . n C 1 119 THR 119 784 784 THR THR C . n C 1 120 LYS 120 785 785 LYS LYS C . n C 1 121 GLN 121 786 786 GLN GLN C . n C 1 122 ILE 122 787 787 ILE ILE C . n C 1 123 LEU 123 788 788 LEU LEU C . n C 1 124 GLU 124 789 789 GLU GLU C . n C 1 125 GLY 125 790 790 GLY GLY C . n C 1 126 LEU 126 791 791 LEU LEU C . n C 1 127 LYS 127 792 792 LYS LYS C . n C 1 128 TYR 128 793 793 TYR TYR C . n C 1 129 LEU 129 794 794 LEU LEU C . n C 1 130 HIS 130 795 795 HIS HIS C . n C 1 131 ASP 131 796 796 ASP ASP C . n C 1 132 ASN 132 797 797 ASN ASN C . n C 1 133 GLN 133 798 798 GLN GLN C . n C 1 134 ILE 134 799 799 ILE ILE C . n C 1 135 VAL 135 800 800 VAL VAL C . n C 1 136 HIS 136 801 801 HIS HIS C . n C 1 137 ARG 137 802 802 ARG ARG C . n C 1 138 ASP 138 803 803 ASP ASP C . n C 1 139 ILE 139 804 804 ILE ILE C . n C 1 140 LYS 140 805 805 LYS LYS C . n C 1 141 GLY 141 806 806 GLY GLY C . n C 1 142 ASP 142 807 807 ASP ASP C . n C 1 143 ASN 143 808 808 ASN ASN C . n C 1 144 VAL 144 809 809 VAL VAL C . n C 1 145 LEU 145 810 810 LEU LEU C . n C 1 146 ILE 146 811 811 ILE ILE C . n C 1 147 ASN 147 812 812 ASN ASN C . n C 1 148 THR 148 813 813 THR THR C . n C 1 149 TYR 149 814 814 TYR TYR C . n C 1 150 SER 150 815 815 SER SER C . n C 1 151 GLY 151 816 816 GLY GLY C . n C 1 152 VAL 152 817 817 VAL VAL C . n C 1 153 LEU 153 818 818 LEU LEU C . n C 1 154 LYS 154 819 819 LYS LYS C . n C 1 155 ILE 155 820 820 ILE ILE C . n C 1 156 SER 156 821 821 SER SER C . n C 1 157 ASP 157 822 822 ASP ASP C . n C 1 158 PHE 158 823 823 PHE PHE C . n C 1 159 GLY 159 824 824 GLY GLY C . n C 1 160 THR 160 825 825 THR THR C . n C 1 161 SER 161 826 826 SER SER C . n C 1 162 LYS 162 827 827 LYS LYS C . n C 1 163 ARG 163 828 828 ARG ARG C . n C 1 164 LEU 164 829 829 LEU LEU C . n C 1 165 ALA 165 830 ? ? ? C . n C 1 166 GLY 166 831 ? ? ? C . n C 1 167 ILE 167 832 ? ? ? C . n C 1 168 ASN 168 833 ? ? ? C . n C 1 169 PRO 169 834 ? ? ? C . n C 1 170 CYS 170 835 ? ? ? C . n C 1 171 THR 171 836 ? ? ? C . n C 1 172 GLU 172 837 ? ? ? C . n C 1 173 THR 173 838 ? ? ? C . n C 1 174 PHE 174 839 ? ? ? C . n C 1 175 THR 175 840 ? ? ? C . n C 1 176 GLY 176 841 ? ? ? C . n C 1 177 THR 177 842 ? ? ? C . n C 1 178 LEU 178 843 843 LEU LEU C . n C 1 179 GLN 179 844 844 GLN GLN C . n C 1 180 TYR 180 845 845 TYR TYR C . n C 1 181 MET 181 846 846 MET MET C . n C 1 182 ALA 182 847 847 ALA ALA C . n C 1 183 PRO 183 848 848 PRO PRO C . n C 1 184 GLU 184 849 849 GLU GLU C . n C 1 185 ILE 185 850 850 ILE ILE C . n C 1 186 ILE 186 851 851 ILE ILE C . n C 1 187 ASP 187 852 852 ASP ASP C . n C 1 188 LYS 188 853 853 LYS LYS C . n C 1 189 GLY 189 854 854 GLY GLY C . n C 1 190 PRO 190 855 855 PRO PRO C . n C 1 191 ARG 191 856 856 ARG ARG C . n C 1 192 GLY 192 857 857 GLY GLY C . n C 1 193 TYR 193 858 ? ? ? C . n C 1 194 GLY 194 859 859 GLY GLY C . n C 1 195 LYS 195 860 860 LYS LYS C . n C 1 196 ALA 196 861 861 ALA ALA C . n C 1 197 ALA 197 862 862 ALA ALA C . n C 1 198 ASP 198 863 863 ASP ASP C . n C 1 199 ILE 199 864 864 ILE ILE C . n C 1 200 TRP 200 865 865 TRP TRP C . n C 1 201 SER 201 866 866 SER SER C . n C 1 202 LEU 202 867 867 LEU LEU C . n C 1 203 GLY 203 868 868 GLY GLY C . n C 1 204 CYS 204 869 869 CYS CYS C . n C 1 205 THR 205 870 870 THR THR C . n C 1 206 ILE 206 871 871 ILE ILE C . n C 1 207 ILE 207 872 872 ILE ILE C . n C 1 208 GLU 208 873 873 GLU GLU C . n C 1 209 MET 209 874 874 MET MET C . n C 1 210 ALA 210 875 875 ALA ALA C . n C 1 211 THR 211 876 876 THR THR C . n C 1 212 GLY 212 877 877 GLY GLY C . n C 1 213 LYS 213 878 878 LYS LYS C . n C 1 214 PRO 214 879 879 PRO PRO C . n C 1 215 PRO 215 880 880 PRO PRO C . n C 1 216 PHE 216 881 881 PHE PHE C . n C 1 217 TYR 217 882 ? ? ? C . n C 1 218 GLU 218 883 ? ? ? C . n C 1 219 LEU 219 884 ? ? ? C . n C 1 220 GLY 220 885 ? ? ? C . n C 1 221 GLU 221 886 ? ? ? C . n C 1 222 PRO 222 887 ? ? ? C . n C 1 223 GLN 223 888 ? ? ? C . n C 1 224 ALA 224 889 ? ? ? C . n C 1 225 ALA 225 890 ? ? ? C . n C 1 226 MET 226 891 ? ? ? C . n C 1 227 PHE 227 892 ? ? ? C . n C 1 228 LYS 228 893 ? ? ? C . n C 1 229 VAL 229 894 ? ? ? C . n C 1 230 GLY 230 895 ? ? ? C . n C 1 231 MET 231 896 ? ? ? C . n C 1 232 PHE 232 897 ? ? ? C . n C 1 233 LYS 233 898 ? ? ? C . n C 1 234 VAL 234 899 ? ? ? C . n C 1 235 HIS 235 900 900 HIS HIS C . n C 1 236 PRO 236 901 901 PRO PRO C . n C 1 237 GLU 237 902 902 GLU GLU C . n C 1 238 ILE 238 903 903 ILE ILE C . n C 1 239 PRO 239 904 904 PRO PRO C . n C 1 240 GLU 240 905 905 GLU GLU C . n C 1 241 SER 241 906 906 SER SER C . n C 1 242 MET 242 907 907 MET MET C . n C 1 243 SER 243 908 908 SER SER C . n C 1 244 ALA 244 909 909 ALA ALA C . n C 1 245 GLU 245 910 910 GLU GLU C . n C 1 246 ALA 246 911 911 ALA ALA C . n C 1 247 LYS 247 912 912 LYS LYS C . n C 1 248 ALA 248 913 913 ALA ALA C . n C 1 249 PHE 249 914 914 PHE PHE C . n C 1 250 ILE 250 915 915 ILE ILE C . n C 1 251 LEU 251 916 916 LEU LEU C . n C 1 252 LYS 252 917 917 LYS LYS C . n C 1 253 CYS 253 918 918 CYS CYS C . n C 1 254 PHE 254 919 919 PHE PHE C . n C 1 255 GLU 255 920 920 GLU GLU C . n C 1 256 PRO 256 921 921 PRO PRO C . n C 1 257 ASP 257 922 922 ASP ASP C . n C 1 258 PRO 258 923 923 PRO PRO C . n C 1 259 ASP 259 924 924 ASP ASP C . n C 1 260 LYS 260 925 925 LYS LYS C . n C 1 261 ARG 261 926 926 ARG ARG C . n C 1 262 ALA 262 927 927 ALA ALA C . n C 1 263 CYS 263 928 928 CYS CYS C . n C 1 264 ALA 264 929 929 ALA ALA C . n C 1 265 ASN 265 930 930 ASN ASN C . n C 1 266 ASP 266 931 931 ASP ASP C . n C 1 267 LEU 267 932 932 LEU LEU C . n C 1 268 LEU 268 933 933 LEU LEU C . n C 1 269 VAL 269 934 934 VAL VAL C . n C 1 270 ASP 270 935 935 ASP ASP C . n C 1 271 GLU 271 936 936 GLU GLU C . n C 1 272 PHE 272 937 937 PHE PHE C . n C 1 273 LEU 273 938 938 LEU LEU C . n C 1 274 LYS 274 939 ? ? ? C . n C 1 275 HIS 275 940 ? ? ? C . n C 1 276 HIS 276 941 ? ? ? C . n C 1 277 HIS 277 942 ? ? ? C . n C 1 278 HIS 278 943 ? ? ? C . n C 1 279 HIS 279 944 ? ? ? C . n C 1 280 HIS 280 945 ? ? ? C . n D 1 1 MET 1 666 666 MET MET D . n D 1 2 GLU 2 667 667 GLU GLU D . n D 1 3 SER 3 668 668 SER SER D . n D 1 4 ASP 4 669 669 ASP ASP D . n D 1 5 LEU 5 670 670 LEU LEU D . n D 1 6 LEU 6 671 671 LEU LEU D . n D 1 7 GLU 7 672 672 GLU GLU D . n D 1 8 TYR 8 673 673 TYR TYR D . n D 1 9 ASP 9 674 674 ASP ASP D . n D 1 10 TYR 10 675 675 TYR TYR D . n D 1 11 GLU 11 676 676 GLU GLU D . n D 1 12 TYR 12 677 677 TYR TYR D . n D 1 13 ASP 13 679 679 ASP ASP D D n D 1 14 GLU 14 679 679 GLU GLU D E n D 1 15 ASN 15 680 680 ASN ASN D . n D 1 16 GLY 16 681 681 GLY GLY D . n D 1 17 ASP 17 682 682 ASP ASP D . n D 1 18 ARG 18 683 683 ARG ARG D . n D 1 19 VAL 19 684 684 VAL VAL D . n D 1 20 VAL 20 685 685 VAL VAL D . n D 1 21 LEU 21 686 686 LEU LEU D . n D 1 22 GLY 22 687 687 GLY GLY D . n D 1 23 LYS 23 688 688 LYS LYS D . n D 1 24 GLY 24 689 689 GLY GLY D . n D 1 25 THR 25 690 690 THR THR D . n D 1 26 TYR 26 691 691 TYR TYR D . n D 1 27 GLY 27 692 692 GLY GLY D . n D 1 28 ILE 28 693 693 ILE ILE D . n D 1 29 VAL 29 694 694 VAL VAL D . n D 1 30 TYR 30 695 695 TYR TYR D . n D 1 31 ALA 31 696 696 ALA ALA D . n D 1 32 GLY 32 697 697 GLY GLY D . n D 1 33 ARG 33 698 698 ARG ARG D . n D 1 34 ASP 34 699 699 ASP ASP D . n D 1 35 LEU 35 700 700 LEU LEU D . n D 1 36 SER 36 701 701 SER SER D . n D 1 37 ASN 37 702 702 ASN ASN D . n D 1 38 GLN 38 703 703 GLN GLN D . n D 1 39 VAL 39 704 704 VAL VAL D . n D 1 40 ARG 40 705 705 ARG ARG D . n D 1 41 ILE 41 706 706 ILE ILE D . n D 1 42 ALA 42 707 707 ALA ALA D . n D 1 43 ILE 43 708 708 ILE ILE D . n D 1 44 LYS 44 709 709 LYS LYS D . n D 1 45 GLU 45 710 710 GLU GLU D . n D 1 46 ILE 46 711 711 ILE ILE D . n D 1 47 PRO 47 712 712 PRO PRO D . n D 1 48 GLU 48 713 713 GLU GLU D . n D 1 49 ARG 49 714 714 ARG ARG D . n D 1 50 ASP 50 715 ? ? ? D . n D 1 51 SER 51 716 ? ? ? D . n D 1 52 ARG 52 717 ? ? ? D . n D 1 53 TYR 53 718 ? ? ? D . n D 1 54 SER 54 719 719 SER SER D . n D 1 55 GLN 55 720 720 GLN GLN D . n D 1 56 PRO 56 721 721 PRO PRO D . n D 1 57 LEU 57 722 722 LEU LEU D . n D 1 58 HIS 58 723 723 HIS HIS D . n D 1 59 GLU 59 724 724 GLU GLU D . n D 1 60 GLU 60 725 725 GLU GLU D . n D 1 61 ILE 61 726 726 ILE ILE D . n D 1 62 ALA 62 727 727 ALA ALA D . n D 1 63 LEU 63 728 728 LEU LEU D . n D 1 64 HIS 64 729 729 HIS HIS D . n D 1 65 LYS 65 730 730 LYS LYS D . n D 1 66 HIS 66 731 731 HIS HIS D . n D 1 67 LEU 67 732 732 LEU LEU D . n D 1 68 LYS 68 733 733 LYS LYS D . n D 1 69 HIS 69 734 734 HIS HIS D . n D 1 70 LYS 70 735 735 LYS LYS D . n D 1 71 ASN 71 736 736 ASN ASN D . n D 1 72 ILE 72 737 737 ILE ILE D . n D 1 73 VAL 73 738 738 VAL VAL D . n D 1 74 GLN 74 739 739 GLN GLN D . n D 1 75 TYR 75 740 740 TYR TYR D . n D 1 76 LEU 76 741 741 LEU LEU D . n D 1 77 GLY 77 742 742 GLY GLY D . n D 1 78 SER 78 743 743 SER SER D . n D 1 79 PHE 79 744 744 PHE PHE D . n D 1 80 SER 80 745 745 SER SER D . n D 1 81 GLU 81 746 746 GLU GLU D . n D 1 82 ASN 82 747 747 ASN ASN D . n D 1 83 GLY 83 748 748 GLY GLY D . n D 1 84 PHE 84 749 749 PHE PHE D . n D 1 85 ILE 85 750 750 ILE ILE D . n D 1 86 LYS 86 751 751 LYS LYS D . n D 1 87 ILE 87 752 752 ILE ILE D . n D 1 88 PHE 88 753 753 PHE PHE D . n D 1 89 MET 89 754 754 MET MET D . n D 1 90 GLU 90 755 755 GLU GLU D . n D 1 91 GLN 91 756 756 GLN GLN D . n D 1 92 VAL 92 757 757 VAL VAL D . n D 1 93 PRO 93 758 758 PRO PRO D . n D 1 94 GLY 94 759 759 GLY GLY D . n D 1 95 GLY 95 760 760 GLY GLY D . n D 1 96 SER 96 761 761 SER SER D . n D 1 97 LEU 97 762 762 LEU LEU D . n D 1 98 SER 98 763 763 SER SER D . n D 1 99 ALA 99 764 764 ALA ALA D . n D 1 100 LEU 100 765 765 LEU LEU D . n D 1 101 LEU 101 766 766 LEU LEU D . n D 1 102 ARG 102 767 767 ARG ARG D . n D 1 103 SER 103 768 768 SER SER D . n D 1 104 LYS 104 769 769 LYS LYS D . n D 1 105 TRP 105 770 770 TRP TRP D . n D 1 106 GLY 106 771 771 GLY GLY D . n D 1 107 PRO 107 772 772 PRO PRO D . n D 1 108 LEU 108 773 773 LEU LEU D . n D 1 109 LYS 109 774 774 LYS LYS D . n D 1 110 ASP 110 775 775 ASP ASP D . n D 1 111 ASN 111 776 776 ASN ASN D . n D 1 112 GLU 112 777 777 GLU GLU D . n D 1 113 GLN 113 778 778 GLN GLN D . n D 1 114 THR 114 779 779 THR THR D . n D 1 115 ILE 115 780 780 ILE ILE D . n D 1 116 GLY 116 781 781 GLY GLY D . n D 1 117 PHE 117 782 782 PHE PHE D . n D 1 118 TYR 118 783 783 TYR TYR D . n D 1 119 THR 119 784 784 THR THR D . n D 1 120 LYS 120 785 785 LYS LYS D . n D 1 121 GLN 121 786 786 GLN GLN D . n D 1 122 ILE 122 787 787 ILE ILE D . n D 1 123 LEU 123 788 788 LEU LEU D . n D 1 124 GLU 124 789 789 GLU GLU D . n D 1 125 GLY 125 790 790 GLY GLY D . n D 1 126 LEU 126 791 791 LEU LEU D . n D 1 127 LYS 127 792 792 LYS LYS D . n D 1 128 TYR 128 793 793 TYR TYR D . n D 1 129 LEU 129 794 794 LEU LEU D . n D 1 130 HIS 130 795 795 HIS HIS D . n D 1 131 ASP 131 796 796 ASP ASP D . n D 1 132 ASN 132 797 797 ASN ASN D . n D 1 133 GLN 133 798 798 GLN GLN D . n D 1 134 ILE 134 799 799 ILE ILE D . n D 1 135 VAL 135 800 800 VAL VAL D . n D 1 136 HIS 136 801 801 HIS HIS D . n D 1 137 ARG 137 802 802 ARG ARG D . n D 1 138 ASP 138 803 803 ASP ASP D . n D 1 139 ILE 139 804 804 ILE ILE D . n D 1 140 LYS 140 805 805 LYS LYS D . n D 1 141 GLY 141 806 806 GLY GLY D . n D 1 142 ASP 142 807 807 ASP ASP D . n D 1 143 ASN 143 808 808 ASN ASN D . n D 1 144 VAL 144 809 809 VAL VAL D . n D 1 145 LEU 145 810 810 LEU LEU D . n D 1 146 ILE 146 811 811 ILE ILE D . n D 1 147 ASN 147 812 812 ASN ASN D . n D 1 148 THR 148 813 813 THR THR D . n D 1 149 TYR 149 814 814 TYR TYR D . n D 1 150 SER 150 815 815 SER SER D . n D 1 151 GLY 151 816 816 GLY GLY D . n D 1 152 VAL 152 817 817 VAL VAL D . n D 1 153 LEU 153 818 818 LEU LEU D . n D 1 154 LYS 154 819 819 LYS LYS D . n D 1 155 ILE 155 820 820 ILE ILE D . n D 1 156 SER 156 821 821 SER SER D . n D 1 157 ASP 157 822 822 ASP ASP D . n D 1 158 PHE 158 823 823 PHE PHE D . n D 1 159 GLY 159 824 824 GLY GLY D . n D 1 160 THR 160 825 825 THR THR D . n D 1 161 SER 161 826 826 SER SER D . n D 1 162 LYS 162 827 827 LYS LYS D . n D 1 163 ARG 163 828 828 ARG ARG D . n D 1 164 LEU 164 829 829 LEU LEU D . n D 1 165 ALA 165 830 830 ALA ALA D . n D 1 166 GLY 166 831 ? ? ? D . n D 1 167 ILE 167 832 ? ? ? D . n D 1 168 ASN 168 833 ? ? ? D . n D 1 169 PRO 169 834 ? ? ? D . n D 1 170 CYS 170 835 ? ? ? D . n D 1 171 THR 171 836 ? ? ? D . n D 1 172 GLU 172 837 ? ? ? D . n D 1 173 THR 173 838 ? ? ? D . n D 1 174 PHE 174 839 ? ? ? D . n D 1 175 THR 175 840 ? ? ? D . n D 1 176 GLY 176 841 841 GLY GLY D . n D 1 177 THR 177 842 842 THR THR D . n D 1 178 LEU 178 843 843 LEU LEU D . n D 1 179 GLN 179 844 844 GLN GLN D . n D 1 180 TYR 180 845 845 TYR TYR D . n D 1 181 MET 181 846 846 MET MET D . n D 1 182 ALA 182 847 847 ALA ALA D . n D 1 183 PRO 183 848 848 PRO PRO D . n D 1 184 GLU 184 849 849 GLU GLU D . n D 1 185 ILE 185 850 850 ILE ILE D . n D 1 186 ILE 186 851 851 ILE ILE D . n D 1 187 ASP 187 852 ? ? ? D . n D 1 188 LYS 188 853 ? ? ? D . n D 1 189 GLY 189 854 ? ? ? D . n D 1 190 PRO 190 855 ? ? ? D . n D 1 191 ARG 191 856 ? ? ? D . n D 1 192 GLY 192 857 ? ? ? D . n D 1 193 TYR 193 858 858 TYR TYR D . n D 1 194 GLY 194 859 859 GLY GLY D . n D 1 195 LYS 195 860 860 LYS LYS D . n D 1 196 ALA 196 861 861 ALA ALA D . n D 1 197 ALA 197 862 862 ALA ALA D . n D 1 198 ASP 198 863 863 ASP ASP D . n D 1 199 ILE 199 864 864 ILE ILE D . n D 1 200 TRP 200 865 865 TRP TRP D . n D 1 201 SER 201 866 866 SER SER D . n D 1 202 LEU 202 867 867 LEU LEU D . n D 1 203 GLY 203 868 868 GLY GLY D . n D 1 204 CYS 204 869 869 CYS CYS D . n D 1 205 THR 205 870 870 THR THR D . n D 1 206 ILE 206 871 871 ILE ILE D . n D 1 207 ILE 207 872 872 ILE ILE D . n D 1 208 GLU 208 873 873 GLU GLU D . n D 1 209 MET 209 874 874 MET MET D . n D 1 210 ALA 210 875 875 ALA ALA D . n D 1 211 THR 211 876 876 THR THR D . n D 1 212 GLY 212 877 877 GLY GLY D . n D 1 213 LYS 213 878 878 LYS LYS D . n D 1 214 PRO 214 879 879 PRO PRO D . n D 1 215 PRO 215 880 880 PRO PRO D . n D 1 216 PHE 216 881 881 PHE PHE D . n D 1 217 TYR 217 882 882 TYR TYR D . n D 1 218 GLU 218 883 ? ? ? D . n D 1 219 LEU 219 884 ? ? ? D . n D 1 220 GLY 220 885 ? ? ? D . n D 1 221 GLU 221 886 886 GLU GLU D . n D 1 222 PRO 222 887 887 PRO PRO D . n D 1 223 GLN 223 888 888 GLN GLN D . n D 1 224 ALA 224 889 889 ALA ALA D . n D 1 225 ALA 225 890 890 ALA ALA D . n D 1 226 MET 226 891 891 MET MET D . n D 1 227 PHE 227 892 892 PHE PHE D . n D 1 228 LYS 228 893 893 LYS LYS D . n D 1 229 VAL 229 894 894 VAL VAL D . n D 1 230 GLY 230 895 895 GLY GLY D . n D 1 231 MET 231 896 896 MET MET D . n D 1 232 PHE 232 897 897 PHE PHE D . n D 1 233 LYS 233 898 898 LYS LYS D . n D 1 234 VAL 234 899 899 VAL VAL D . n D 1 235 HIS 235 900 900 HIS HIS D . n D 1 236 PRO 236 901 901 PRO PRO D . n D 1 237 GLU 237 902 902 GLU GLU D . n D 1 238 ILE 238 903 903 ILE ILE D . n D 1 239 PRO 239 904 904 PRO PRO D . n D 1 240 GLU 240 905 905 GLU GLU D . n D 1 241 SER 241 906 906 SER SER D . n D 1 242 MET 242 907 907 MET MET D . n D 1 243 SER 243 908 908 SER SER D . n D 1 244 ALA 244 909 909 ALA ALA D . n D 1 245 GLU 245 910 910 GLU GLU D . n D 1 246 ALA 246 911 911 ALA ALA D . n D 1 247 LYS 247 912 912 LYS LYS D . n D 1 248 ALA 248 913 913 ALA ALA D . n D 1 249 PHE 249 914 914 PHE PHE D . n D 1 250 ILE 250 915 915 ILE ILE D . n D 1 251 LEU 251 916 916 LEU LEU D . n D 1 252 LYS 252 917 917 LYS LYS D . n D 1 253 CYS 253 918 918 CYS CYS D . n D 1 254 PHE 254 919 919 PHE PHE D . n D 1 255 GLU 255 920 920 GLU GLU D . n D 1 256 PRO 256 921 921 PRO PRO D . n D 1 257 ASP 257 922 922 ASP ASP D . n D 1 258 PRO 258 923 923 PRO PRO D . n D 1 259 ASP 259 924 924 ASP ASP D . n D 1 260 LYS 260 925 925 LYS LYS D . n D 1 261 ARG 261 926 926 ARG ARG D . n D 1 262 ALA 262 927 927 ALA ALA D . n D 1 263 CYS 263 928 928 CYS CYS D . n D 1 264 ALA 264 929 929 ALA ALA D . n D 1 265 ASN 265 930 930 ASN ASN D . n D 1 266 ASP 266 931 931 ASP ASP D . n D 1 267 LEU 267 932 932 LEU LEU D . n D 1 268 LEU 268 933 933 LEU LEU D . n D 1 269 VAL 269 934 934 VAL VAL D . n D 1 270 ASP 270 935 935 ASP ASP D . n D 1 271 GLU 271 936 936 GLU GLU D . n D 1 272 PHE 272 937 937 PHE PHE D . n D 1 273 LEU 273 938 938 LEU LEU D . n D 1 274 LYS 274 939 939 LYS LYS D . n D 1 275 HIS 275 940 940 HIS HIS D . n D 1 276 HIS 276 941 941 HIS HIS D . n D 1 277 HIS 277 942 ? ? ? D . n D 1 278 HIS 278 943 ? ? ? D . n D 1 279 HIS 279 944 ? ? ? D . n D 1 280 HIS 280 945 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 NJV 1 1001 4 NJV 715 A . F 3 ACT 1 1002 3 ACT ACT A . G 2 NJV 1 1001 2 NJV 715 B . H 3 ACT 1 1002 1 ACT ACT B . I 3 ACT 1 1003 7 ACT ACT B . J 3 ACT 1 1004 8 ACT ACT B . K 2 NJV 1 1001 3 NJV 715 C . L 3 ACT 1 1002 4 ACT ACT C . M 3 ACT 1 1001 1001 ACT ACT D . N 2 NJV 1 1002 1 NJV 715 D . O 3 ACT 1 1003 2 ACT ACT D . P 3 ACT 1 1004 5 ACT ACT D . Q 3 ACT 1 1005 6 ACT ACT D . R 4 HOH 1 1101 37 HOH HOH A . R 4 HOH 2 1102 26 HOH HOH A . R 4 HOH 3 1103 8 HOH HOH A . R 4 HOH 4 1104 40 HOH HOH A . R 4 HOH 5 1105 17 HOH HOH A . R 4 HOH 6 1106 60 HOH HOH A . R 4 HOH 7 1107 32 HOH HOH A . R 4 HOH 8 1108 43 HOH HOH A . R 4 HOH 9 1109 14 HOH HOH A . R 4 HOH 10 1110 58 HOH HOH A . R 4 HOH 11 1111 64 HOH HOH A . R 4 HOH 12 1112 51 HOH HOH A . R 4 HOH 13 1113 67 HOH HOH A . R 4 HOH 14 1114 33 HOH HOH A . R 4 HOH 15 1115 62 HOH HOH A . R 4 HOH 16 1116 19 HOH HOH A . R 4 HOH 17 1117 20 HOH HOH A . R 4 HOH 18 1118 80 HOH HOH A . R 4 HOH 19 1119 52 HOH HOH A . R 4 HOH 20 1120 34 HOH HOH A . S 4 HOH 1 1101 57 HOH HOH B . S 4 HOH 2 1102 12 HOH HOH B . S 4 HOH 3 1103 11 HOH HOH B . S 4 HOH 4 1104 3 HOH HOH B . S 4 HOH 5 1105 54 HOH HOH B . S 4 HOH 6 1106 78 HOH HOH B . S 4 HOH 7 1107 55 HOH HOH B . S 4 HOH 8 1108 45 HOH HOH B . S 4 HOH 9 1109 68 HOH HOH B . S 4 HOH 10 1110 76 HOH HOH B . S 4 HOH 11 1111 35 HOH HOH B . S 4 HOH 12 1112 38 HOH HOH B . S 4 HOH 13 1113 22 HOH HOH B . T 4 HOH 1 1101 41 HOH HOH C . T 4 HOH 2 1102 18 HOH HOH C . T 4 HOH 3 1103 53 HOH HOH C . T 4 HOH 4 1104 70 HOH HOH C . T 4 HOH 5 1105 71 HOH HOH C . T 4 HOH 6 1106 5 HOH HOH C . T 4 HOH 7 1107 61 HOH HOH C . T 4 HOH 8 1108 73 HOH HOH C . T 4 HOH 9 1109 36 HOH HOH C . U 4 HOH 1 1101 27 HOH HOH D . U 4 HOH 2 1102 44 HOH HOH D . U 4 HOH 3 1103 48 HOH HOH D . U 4 HOH 4 1104 46 HOH HOH D . U 4 HOH 5 1105 74 HOH HOH D . U 4 HOH 6 1106 7 HOH HOH D . U 4 HOH 7 1107 15 HOH HOH D . U 4 HOH 8 1108 59 HOH HOH D . U 4 HOH 9 1109 50 HOH HOH D . U 4 HOH 10 1110 1 HOH HOH D . U 4 HOH 11 1111 77 HOH HOH D . U 4 HOH 12 1112 16 HOH HOH D . U 4 HOH 13 1113 56 HOH HOH D . U 4 HOH 14 1114 2 HOH HOH D . U 4 HOH 15 1115 39 HOH HOH D . U 4 HOH 16 1116 72 HOH HOH D . U 4 HOH 17 1117 9 HOH HOH D . U 4 HOH 18 1118 65 HOH HOH D . U 4 HOH 19 1119 79 HOH HOH D . U 4 HOH 20 1120 6 HOH HOH D . U 4 HOH 21 1121 4 HOH HOH D . U 4 HOH 22 1122 28 HOH HOH D . U 4 HOH 23 1123 63 HOH HOH D . U 4 HOH 24 1124 69 HOH HOH D . U 4 HOH 25 1125 66 HOH HOH D . U 4 HOH 26 1126 24 HOH HOH D . U 4 HOH 27 1127 47 HOH HOH D . U 4 HOH 28 1128 75 HOH HOH D . U 4 HOH 29 1129 49 HOH HOH D . U 4 HOH 30 1130 10 HOH HOH D . U 4 HOH 31 1131 23 HOH HOH D . U 4 HOH 32 1132 31 HOH HOH D . U 4 HOH 33 1133 25 HOH HOH D . U 4 HOH 34 1134 21 HOH HOH D . U 4 HOH 35 1135 30 HOH HOH D . U 4 HOH 36 1136 29 HOH HOH D . U 4 HOH 37 1137 13 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E,F,K,L,R,T 2 1 B,D,G,H,I,J,M,N,O,P,Q,S,U # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2260 ? 1 MORE -9 ? 1 'SSA (A^2)' 20590 ? 2 'ABSA (A^2)' 3030 ? 2 MORE -11 ? 2 'SSA (A^2)' 22080 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-11-27 2 'Structure model' 1 1 2019-12-04 3 'Structure model' 1 2 2019-12-25 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 2 'Structure model' '_citation_author.identifier_ORCID' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 4 'Structure model' '_chem_comp.pdbx_synonyms' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 11 4 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 12 4 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 13 4 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 14 4 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 15 4 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 16 4 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 17 4 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -0.3526 -23.3831 16.3951 0.4689 ? 0.0879 ? -0.0721 ? 0.4190 ? 0.0078 ? 0.3345 ? 5.9000 ? 3.0555 ? -1.6381 ? 2.6182 ? -0.0768 ? 7.0163 ? 0.0810 ? -0.4695 ? 0.1018 ? -0.1131 ? 0.1424 ? 0.1463 ? 0.4674 ? -0.9181 ? -0.2093 ? 2 'X-RAY DIFFRACTION' ? refined -0.7645 -20.3960 15.0799 0.4435 ? -0.0345 ? -0.0370 ? 0.2913 ? 0.0900 ? 0.3078 ? 9.4200 ? 4.2861 ? 0.8668 ? 4.7214 ? 1.6918 ? 6.9514 ? 0.1386 ? 0.5929 ? -0.7419 ? -0.0501 ? 0.1186 ? -0.4590 ? 0.4765 ? -0.7069 ? -0.1774 ? 3 'X-RAY DIFFRACTION' ? refined -13.1638 -11.6218 9.3134 1.1024 ? 0.3749 ? -0.1942 ? 1.0624 ? 0.0295 ? 0.5156 ? 5.8251 ? -3.7348 ? 0.0171 ? 2.0037 ? -2.7324 ? 1.5919 ? -1.0203 ? 0.0353 ? -0.5603 ? -2.4857 ? 0.6759 ? 1.8279 ? -0.2587 ? -1.1214 ? 0.1880 ? 4 'X-RAY DIFFRACTION' ? refined -4.9246 -13.6868 13.7839 0.4866 ? 0.0342 ? -0.0107 ? 0.4304 ? 0.0714 ? 0.3253 ? 5.5240 ? 0.0436 ? 1.5320 ? 3.4985 ? 0.2314 ? 3.9901 ? -0.2763 ? 0.0071 ? 0.4060 ? -0.7154 ? -0.1080 ? 0.0481 ? -0.9114 ? -0.9474 ? 0.3237 ? 5 'X-RAY DIFFRACTION' ? refined -10.7521 -7.2843 33.3396 0.7373 ? 0.2483 ? -0.0074 ? 0.9200 ? -0.1106 ? 0.3996 ? 4.5066 ? -1.9402 ? 0.6258 ? 6.7011 ? 0.8663 ? 2.2510 ? 0.0048 ? -0.3230 ? 0.5012 ? 0.1716 ? -0.4397 ? 0.1904 ? -0.6442 ? -0.6641 ? 0.2852 ? 6 'X-RAY DIFFRACTION' ? refined -11.2371 -9.1367 24.9795 0.6527 ? 0.3216 ? -0.0147 ? 0.8260 ? -0.0400 ? 0.4947 ? 5.3078 ? -0.4532 ? 0.5557 ? 4.2876 ? -0.0256 ? 2.3152 ? 0.3182 ? -0.0191 ? 0.1608 ? -0.1762 ? -0.0392 ? 0.6974 ? -0.3545 ? -1.1501 ? -0.0952 ? 7 'X-RAY DIFFRACTION' ? refined -19.8579 -9.4458 16.5524 0.7025 ? 0.0834 ? 0.4763 ? 0.8945 ? -0.2030 ? 0.8040 ? 5.4609 ? -3.7050 ? -1.3837 ? 8.5533 ? -2.8901 ? 2.7780 ? 0.5299 ? 0.5542 ? -0.0514 ? 3.7596 ? -0.4870 ? 2.1519 ? -0.9814 ? -0.3506 ? 0.4471 ? 8 'X-RAY DIFFRACTION' ? refined -20.6403 -8.4086 31.9623 0.5479 ? 0.2379 ? -0.0317 ? 1.4078 ? 0.0225 ? 0.8765 ? 5.2937 ? -1.5103 ? 2.1056 ? 2.8133 ? 0.2441 ? 4.8715 ? 0.3140 ? -1.1664 ? -0.4120 ? 0.1102 ? 1.0367 ? 1.0008 ? -0.3103 ? -2.9064 ? -0.8455 ? 9 'X-RAY DIFFRACTION' ? refined -22.8694 -11.4308 41.8783 1.1010 ? -0.1022 ? 0.1739 ? 1.0617 ? 0.1392 ? 0.6341 ? 6.5960 ? -2.6338 ? 0.4236 ? 5.5092 ? -1.4788 ? 4.1380 ? 0.7514 ? -0.3071 ? 0.2420 ? 1.7535 ? -1.7315 ? 1.0797 ? 0.4064 ? 0.6677 ? 0.1155 ? 10 'X-RAY DIFFRACTION' ? refined -23.3207 1.3742 34.3128 0.7351 ? 0.3017 ? -0.0680 ? 0.9171 ? -0.0484 ? 0.8271 ? 5.5598 ? -0.7382 ? -4.1855 ? 8.0907 ? -1.8889 ? 5.6595 ? 1.1720 ? 0.7587 ? 0.6113 ? -0.3634 ? -0.3273 ? 0.4520 ? -0.4111 ? -0.7528 ? -0.5572 ? 11 'X-RAY DIFFRACTION' ? refined 13.5103 23.3630 36.7359 0.3943 ? -0.0528 ? 0.0050 ? 0.5770 ? 0.0096 ? 0.4375 ? 2.5749 ? -1.5558 ? 1.1863 ? 5.4762 ? 0.2095 ? 6.2403 ? -0.0542 ? -1.0960 ? -0.3859 ? 0.6356 ? 0.4978 ? -0.0700 ? 0.2525 ? -0.1737 ? -0.4621 ? 12 'X-RAY DIFFRACTION' ? refined 20.7323 32.8046 33.1089 0.5155 ? 0.1014 ? -0.1488 ? 0.5641 ? -0.2081 ? 0.7604 ? 4.5751 ? 0.1814 ? -0.6676 ? 3.1327 ? -0.1198 ? 5.4028 ? -0.0681 ? -0.9051 ? 0.9919 ? 0.5711 ? 0.0837 ? -0.7004 ? -0.6651 ? 0.5330 ? 0.0251 ? 13 'X-RAY DIFFRACTION' ? refined 23.9590 25.4729 15.6390 0.2896 ? -0.0120 ? 0.0715 ? 0.3451 ? -0.0303 ? 0.5634 ? 4.7042 ? 0.6420 ? 0.5068 ? 3.4542 ? -2.3278 ? 5.4639 ? 0.0584 ? 0.6190 ? 0.2632 ? -0.2814 ? 0.0949 ? -0.7474 ? -0.0674 ? 0.4080 ? -0.1592 ? 14 'X-RAY DIFFRACTION' ? refined 36.4071 29.1596 23.4975 0.6619 ? -0.1846 ? -0.0359 ? 0.8606 ? -0.1182 ? 0.9672 ? 5.4028 ? 0.1757 ? -0.2962 ? 0.5027 ? -0.9496 ? 4.7827 ? -0.7470 ? 0.0801 ? -0.3740 ? -0.2870 ? 0.5285 ? -0.5608 ? 0.2124 ? 1.0750 ? -0.1398 ? 15 'X-RAY DIFFRACTION' ? refined 36.4779 24.8653 9.1933 0.4838 ? -0.1180 ? 0.1700 ? 0.8885 ? -0.0178 ? 1.0100 ? 5.7139 ? 0.3663 ? 2.1798 ? 4.9798 ? 0.6460 ? 3.8493 ? 0.0815 ? 1.0899 ? 0.7070 ? -0.4900 ? -0.1876 ? -1.1189 ? -0.1040 ? 1.2966 ? 0.0278 ? 16 'X-RAY DIFFRACTION' ? refined 6.2771 -14.8310 46.6201 0.8298 ? 0.0714 ? 0.0645 ? 0.7937 ? -0.0396 ? 0.5255 ? 2.2683 ? 1.6778 ? -0.6145 ? 4.3447 ? 2.4594 ? 6.0338 ? -0.0259 ? -0.8975 ? -0.2691 ? 1.1196 ? 0.1723 ? 0.0397 ? 0.8965 ? -0.0809 ? 0.1785 ? 17 'X-RAY DIFFRACTION' ? refined 12.6967 -8.5433 43.0680 0.6735 ? 0.2494 ? -0.0754 ? 0.8372 ? -0.2992 ? 0.1159 ? 7.1536 ? 0.9576 ? -1.5093 ? 4.1546 ? -0.9645 ? 1.3646 ? -0.3929 ? -1.2808 ? -0.7556 ? 1.5835 ? -0.3164 ? -1.1774 ? -0.8461 ? -0.1302 ? -0.0338 ? 18 'X-RAY DIFFRACTION' ? refined 23.2725 0.7540 42.6618 1.1292 ? 0.1305 ? -0.2820 ? 0.9512 ? -0.3699 ? 0.9657 ? 4.4124 ? 0.6326 ? -1.9865 ? 0.9163 ? -1.0977 ? 1.5461 ? -1.0198 ? -2.3216 ? 0.7549 ? -0.3823 ? -0.1476 ? -0.8282 ? -0.5338 ? 0.8096 ? 0.0573 ? 19 'X-RAY DIFFRACTION' ? refined 17.4774 -7.0379 27.8314 0.4331 ? 0.0059 ? -0.0264 ? 0.2033 ? -0.0049 ? 0.3557 ? 5.1780 ? -0.2418 ? 0.7702 ? 2.3828 ? 0.8370 ? 6.2104 ? -0.3686 ? 0.0278 ? 0.4511 ? 0.0831 ? 0.2042 ? -0.2939 ? -0.6572 ? 0.5223 ? 0.0439 ? 20 'X-RAY DIFFRACTION' ? refined 34.1725 -4.5102 31.0552 0.9070 ? -0.0851 ? -0.1686 ? 1.1492 ? -0.0661 ? 0.9226 ? 4.7352 ? -1.6216 ? -1.4115 ? 2.7599 ? -0.1586 ? 4.3344 ? -0.1779 ? -0.0379 ? 1.0965 ? 0.1838 ? 0.2171 ? -2.2446 ? -0.2286 ? 1.7868 ? -0.0448 ? 21 'X-RAY DIFFRACTION' ? refined 29.2933 -10.1918 21.4305 0.4519 ? -0.0795 ? 0.1304 ? 0.7998 ? 0.0102 ? 0.5890 ? 6.2151 ? -1.5917 ? -0.5723 ? 3.9429 ? 0.5507 ? 7.1585 ? -0.1253 ? 0.6252 ? 0.3551 ? 0.2619 ? 0.4314 ? -0.4650 ? -0.5757 ? 1.4026 ? -0.0847 ? 22 'X-RAY DIFFRACTION' ? refined 31.5310 -19.1468 15.6550 0.6486 ? 0.1515 ? 0.0107 ? 1.2551 ? -0.0211 ? 1.2625 ? 1.0673 ? 0.1305 ? 0.3937 ? 0.4627 ? 0.4606 ? 3.6329 ? 0.5010 ? 1.3793 ? -1.3975 ? 0.0403 ? 0.7190 ? -0.5398 ? -0.6329 ? 2.3333 ? -0.0985 ? 23 'X-RAY DIFFRACTION' ? refined 31.4686 -4.7771 13.1243 0.8013 ? -0.2925 ? 0.1600 ? 1.1293 ? -0.0858 ? 0.9691 ? 4.3962 ? 0.2443 ? 0.7282 ? 3.8897 ? -0.0772 ? 2.7802 ? -0.4144 ? 1.5566 ? 1.6188 ? -1.7028 ? 0.1994 ? -1.3188 ? -0.6520 ? 1.7599 ? -0.0063 ? 24 'X-RAY DIFFRACTION' ? refined 2.5198 14.5506 8.0966 0.6045 ? 0.1172 ? -0.0642 ? 0.2480 ? -0.0480 ? 0.4289 ? 7.1723 ? 0.9413 ? -2.6005 ? 1.4032 ? 0.3698 ? 5.5398 ? 0.3184 ? 1.1460 ? -1.3298 ? 0.4686 ? 0.0168 ? -0.4973 ? 0.4500 ? 0.0873 ? -0.0707 ? 25 'X-RAY DIFFRACTION' ? refined -4.4600 26.4721 4.9579 0.3456 ? -0.0260 ? 0.0686 ? 0.3329 ? 0.0472 ? 0.4138 ? 3.2286 ? -2.7132 ? -1.4296 ? 7.8181 ? 7.6286 ? 8.9345 ? -0.0941 ? 0.5932 ? 0.1568 ? -0.4728 ? -0.5530 ? 0.6060 ? -0.1851 ? -0.1573 ? 0.5998 ? 26 'X-RAY DIFFRACTION' ? refined -0.3022 17.9215 6.8376 0.3562 ? -0.0513 ? 0.0417 ? 0.3052 ? 0.1059 ? 0.3571 ? 6.4717 ? -0.8308 ? 0.8739 ? 5.3772 ? -1.6321 ? 5.7653 ? 0.0529 ? 0.1898 ? -0.4545 ? -1.4824 ? -0.3277 ? -0.0492 ? 0.9168 ? 0.0217 ? -0.2383 ? 27 'X-RAY DIFFRACTION' ? refined -6.0413 28.8023 23.6950 0.2751 ? -0.0548 ? 0.0852 ? 0.2957 ? -0.0047 ? 0.2132 ? 3.3974 ? -1.0586 ? 1.3418 ? 3.7345 ? -0.1834 ? 6.2636 ? -0.1091 ? -0.3601 ? 0.0890 ? 0.3728 ? 0.3260 ? -0.0007 ? 0.3548 ? -0.5774 ? -0.1981 ? 28 'X-RAY DIFFRACTION' ? refined -13.3932 26.3074 14.3673 0.6463 ? -0.1796 ? -0.0155 ? 0.4778 ? 0.0769 ? 0.5482 ? 3.5050 ? 0.4028 ? -0.7038 ? 4.8677 ? -1.8866 ? 6.4779 ? 0.9262 ? 0.2578 ? -1.3058 ? 0.0631 ? 0.5689 ? 0.9736 ? 0.6165 ? -0.9694 ? -0.9456 ? 29 'X-RAY DIFFRACTION' ? refined -18.7814 29.0523 22.5458 0.4491 ? -0.1138 ? 0.0422 ? 0.5322 ? -0.0250 ? 0.4167 ? 5.9392 ? -2.0084 ? 0.5559 ? 5.1773 ? -2.1128 ? 2.2119 ? 0.5391 ? 0.5730 ? -1.3045 ? -0.4988 ? 0.1124 ? 0.8266 ? 1.2914 ? -0.3763 ? -0.2744 ? 30 'X-RAY DIFFRACTION' ? refined -23.7612 19.2702 27.6562 1.0070 ? -0.2551 ? -0.1505 ? 0.9275 ? -0.1791 ? 0.7417 ? 7.2181 ? -2.9975 ? 1.1183 ? 2.4329 ? -0.3970 ? 0.3582 ? 1.8241 ? -0.7345 ? 0.2069 ? -0.6963 ? -1.3963 ? 0.4160 ? 0.3506 ? -1.0110 ? -0.4670 ? 31 'X-RAY DIFFRACTION' ? refined -20.6579 34.8195 30.5856 0.4220 ? -0.0664 ? 0.1040 ? 0.6271 ? 0.1353 ? 0.3995 ? 4.3887 ? -3.4316 ? 2.4623 ? 3.7180 ? -1.7399 ? 6.0312 ? -0.3785 ? -0.9911 ? -0.2732 ? 0.1227 ? 0.8346 ? 0.5728 ? -0.0964 ? -1.4543 ? -0.4256 ? 32 'X-RAY DIFFRACTION' ? refined -9.7701 42.9605 28.5293 0.4873 ? -0.0101 ? 0.0265 ? 0.3401 ? -0.0519 ? 0.4754 ? 9.4689 ? -1.9829 ? -6.3362 ? 2.9264 ? -2.2218 ? 9.5742 ? 0.4889 ? -1.0047 ? 1.1375 ? 0.2903 ? -0.0420 ? 0.0225 ? -0.8125 ? -0.7158 ? -0.2090 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 666 ? ? A 692 ? ;chain 'A' and (resid 666 through 692 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 693 ? ? A 720 ? ;chain 'A' and (resid 693 through 720 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 721 ? ? A 731 ? ;chain 'A' and (resid 721 through 731 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 732 ? ? A 758 ? ;chain 'A' and (resid 732 through 758 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 759 ? ? A 796 ? ;chain 'A' and (resid 759 through 796 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 797 ? ? A 820 ? ;chain 'A' and (resid 797 through 820 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 821 ? ? A 859 ? ;chain 'A' and (resid 821 through 859 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 860 ? ? A 876 ? ;chain 'A' and (resid 860 through 876 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? A 877 ? ? A 908 ? ;chain 'A' and (resid 877 through 908 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? A 909 ? ? A 939 ? ;chain 'A' and (resid 909 through 939 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? B 670 ? ? B 703 ? ;chain 'B' and (resid 670 through 703 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? B 704 ? ? B 758 ? ;chain 'B' and (resid 704 through 758 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? B 759 ? ? B 820 ? ;chain 'B' and (resid 759 through 820 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? B 821 ? ? B 859 ? ;chain 'B' and (resid 821 through 859 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? B 860 ? ? B 939 ? ;chain 'B' and (resid 860 through 939 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? C 671 ? ? C 684 ? ;chain 'C' and (resid 671 through 684 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? C 685 ? ? C 715 ? ;chain 'C' and (resid 685 through 715 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? C 716 ? ? C 731 ? ;chain 'C' and (resid 716 through 731 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? C 732 ? ? C 820 ? ;chain 'C' and (resid 732 through 820 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? C 821 ? ? C 859 ? ;chain 'C' and (resid 821 through 859 ) ; 21 'X-RAY DIFFRACTION' 21 ? ? C 860 ? ? C 876 ? ;chain 'C' and (resid 860 through 876 ) ; 22 'X-RAY DIFFRACTION' 22 ? ? C 877 ? ? C 908 ? ;chain 'C' and (resid 877 through 908 ) ; 23 'X-RAY DIFFRACTION' 23 ? ? C 909 ? ? C 938 ? ;chain 'C' and (resid 909 through 938 ) ; 24 'X-RAY DIFFRACTION' 24 ? ? D 666 ? ? D 720 ? ;chain 'D' and (resid 666 through 720 ) ; 25 'X-RAY DIFFRACTION' 25 ? ? D 721 ? ? D 746 ? ;chain 'D' and (resid 721 through 746 ) ; 26 'X-RAY DIFFRACTION' 26 ? ? D 747 ? ? D 758 ? ;chain 'D' and (resid 747 through 758 ) ; 27 'X-RAY DIFFRACTION' 27 ? ? D 759 ? ? D 817 ? ;chain 'D' and (resid 759 through 817 ) ; 28 'X-RAY DIFFRACTION' 28 ? ? D 818 ? ? D 845 ? ;chain 'D' and (resid 818 through 845 ) ; 29 'X-RAY DIFFRACTION' 29 ? ? D 846 ? ? D 876 ? ;chain 'D' and (resid 846 through 876 ) ; 30 'X-RAY DIFFRACTION' 30 ? ? D 877 ? ? D 896 ? ;chain 'D' and (resid 877 through 896 ) ; 31 'X-RAY DIFFRACTION' 31 ? ? D 897 ? ? D 928 ? ;chain 'D' and (resid 897 through 928 ) ; 32 'X-RAY DIFFRACTION' 32 ? ? D 929 ? ? D 941 ? ;chain 'D' and (resid 929 through 941 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH C TYR 675 ? ? OE2 C GLU 710 ? ? 2.11 2 1 OH B TYR 675 ? ? OE2 B GLU 710 ? ? 2.12 3 1 O D TYR 845 ? ? OG D SER 866 ? ? 2.17 4 1 NH2 D ARG 698 ? ? O D HOH 1101 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 672 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 D _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 713 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_545 _pdbx_validate_symm_contact.dist 2.06 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 905 ? ? CD A GLU 905 ? ? 1.654 1.515 0.139 0.015 N 2 1 CD A GLU 905 ? ? OE2 A GLU 905 ? ? 1.322 1.252 0.070 0.011 N 3 1 N B PRO 758 ? ? CA B PRO 758 ? ? 1.683 1.468 0.215 0.017 N 4 1 CD C GLU 905 ? ? OE1 C GLU 905 ? ? 1.325 1.252 0.073 0.011 N 5 1 C C PRO 921 ? ? N C ASP 922 ? ? 1.531 1.336 0.195 0.023 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CD A LYS 688 ? ? CE A LYS 688 ? ? NZ A LYS 688 ? ? 89.36 111.70 -22.34 2.30 N 2 1 CA A LEU 916 ? ? CB A LEU 916 ? ? CG A LEU 916 ? ? 133.11 115.30 17.81 2.30 N 3 1 C B VAL 757 ? ? N B PRO 758 ? ? CA B PRO 758 ? ? 137.86 119.30 18.56 1.50 Y 4 1 CA B PRO 758 ? ? N B PRO 758 ? ? CD B PRO 758 ? ? 99.87 111.70 -11.83 1.40 N 5 1 CA B LEU 916 ? ? CB B LEU 916 ? ? CG B LEU 916 ? ? 129.65 115.30 14.35 2.30 N 6 1 CA C GLU 905 ? ? CB C GLU 905 ? ? CG C GLU 905 ? ? 137.29 113.40 23.89 2.20 N 7 1 CB C ASP 922 ? ? CG C ASP 922 ? ? OD1 C ASP 922 ? ? 124.33 118.30 6.03 0.90 N 8 1 CB C ASP 922 ? ? CG C ASP 922 ? ? OD2 C ASP 922 ? ? 105.73 118.30 -12.57 0.90 N 9 1 CB D LEU 670 ? ? CA D LEU 670 ? ? C D LEU 670 ? ? 95.94 110.20 -14.26 1.90 N 10 1 CG1 D VAL 738 ? ? CB D VAL 738 ? ? CG2 D VAL 738 ? ? 122.41 110.90 11.51 1.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 667 ? ? 63.24 60.88 2 1 SER A 668 ? ? -158.22 61.56 3 1 ASP A 669 ? ? 75.62 -19.19 4 1 LEU A 671 ? ? -127.36 -77.87 5 1 LYS A 769 ? ? -131.94 -51.34 6 1 ASN A 776 ? ? -119.30 72.82 7 1 ASP A 803 ? ? -152.68 45.97 8 1 ASP A 822 ? ? 59.78 86.22 9 1 LEU B 671 ? ? -128.97 -74.30 10 1 LYS B 769 ? ? -131.90 -50.97 11 1 ASN B 776 ? ? -119.75 73.38 12 1 ASP B 803 ? ? -151.30 47.23 13 1 ASP B 822 ? ? 58.76 86.33 14 1 LYS B 898 ? ? -87.57 48.50 15 1 LEU B 938 ? ? 56.99 -113.25 16 1 ASP C 715 ? ? -150.37 82.53 17 1 LYS C 769 ? ? -134.47 -50.80 18 1 ASN C 776 ? ? -119.12 73.03 19 1 ASP C 803 ? ? -150.97 44.61 20 1 ASP C 822 ? ? 56.50 86.88 21 1 ASP C 852 ? ? -91.08 -63.61 22 1 SER D 668 ? ? -107.53 -167.50 23 1 LEU D 671 ? ? -128.86 -78.20 24 1 LYS D 769 ? ? -134.52 -50.55 25 1 ASN D 776 ? ? -118.26 72.73 26 1 ASP D 803 ? ? -152.95 47.40 27 1 ASP D 822 ? ? 60.77 86.25 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ASN _pdbx_validate_main_chain_plane.auth_asym_id D _pdbx_validate_main_chain_plane.auth_seq_id 930 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -10.25 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 666 ? CG ? A MET 1 CG 2 1 Y 1 A MET 666 ? SD ? A MET 1 SD 3 1 Y 1 A MET 666 ? CE ? A MET 1 CE 4 1 Y 1 A GLU 667 ? CG ? A GLU 2 CG 5 1 Y 1 A GLU 667 ? CD ? A GLU 2 CD 6 1 Y 1 A GLU 667 ? OE1 ? A GLU 2 OE1 7 1 Y 1 A GLU 667 ? OE2 ? A GLU 2 OE2 8 1 Y 1 A GLU 713 ? CG ? A GLU 48 CG 9 1 Y 1 A GLU 713 ? CD ? A GLU 48 CD 10 1 Y 1 A GLU 713 ? OE1 ? A GLU 48 OE1 11 1 Y 1 A GLU 713 ? OE2 ? A GLU 48 OE2 12 1 Y 1 A ARG 714 ? CG ? A ARG 49 CG 13 1 Y 1 A ARG 714 ? CD ? A ARG 49 CD 14 1 Y 1 A ARG 714 ? NE ? A ARG 49 NE 15 1 Y 1 A ARG 714 ? CZ ? A ARG 49 CZ 16 1 Y 1 A ARG 714 ? NH1 ? A ARG 49 NH1 17 1 Y 1 A ARG 714 ? NH2 ? A ARG 49 NH2 18 1 Y 1 A GLN 720 ? CG ? A GLN 55 CG 19 1 Y 1 A GLN 720 ? CD ? A GLN 55 CD 20 1 Y 1 A GLN 720 ? OE1 ? A GLN 55 OE1 21 1 Y 1 A GLN 720 ? NE2 ? A GLN 55 NE2 22 1 Y 1 A PRO 721 ? CG ? A PRO 56 CG 23 1 Y 1 A PRO 721 ? CD ? A PRO 56 CD 24 1 Y 1 A GLU 724 ? CG ? A GLU 59 CG 25 1 Y 1 A GLU 724 ? CD ? A GLU 59 CD 26 1 Y 1 A GLU 724 ? OE1 ? A GLU 59 OE1 27 1 Y 1 A GLU 724 ? OE2 ? A GLU 59 OE2 28 1 Y 1 A LEU 728 ? CG ? A LEU 63 CG 29 1 Y 1 A LEU 728 ? CD1 ? A LEU 63 CD1 30 1 Y 1 A LEU 728 ? CD2 ? A LEU 63 CD2 31 1 Y 1 A ASP 775 ? CG ? A ASP 110 CG 32 1 Y 1 A ASP 775 ? OD1 ? A ASP 110 OD1 33 1 Y 1 A ASP 775 ? OD2 ? A ASP 110 OD2 34 1 Y 1 A ASN 776 ? CG ? A ASN 111 CG 35 1 Y 1 A ASN 776 ? OD1 ? A ASN 111 OD1 36 1 Y 1 A ASN 776 ? ND2 ? A ASN 111 ND2 37 1 Y 1 A LYS 827 ? CG ? A LYS 162 CG 38 1 Y 1 A LYS 827 ? CD ? A LYS 162 CD 39 1 Y 1 A LYS 827 ? CE ? A LYS 162 CE 40 1 Y 1 A LYS 827 ? NZ ? A LYS 162 NZ 41 1 Y 1 A LYS 939 ? CG ? A LYS 274 CG 42 1 Y 1 A LYS 939 ? CD ? A LYS 274 CD 43 1 Y 1 A LYS 939 ? CE ? A LYS 274 CE 44 1 Y 1 A LYS 939 ? NZ ? A LYS 274 NZ 45 1 Y 1 B GLU 672 ? CG ? B GLU 7 CG 46 1 Y 1 B GLU 672 ? CD ? B GLU 7 CD 47 1 Y 1 B GLU 672 ? OE1 ? B GLU 7 OE1 48 1 Y 1 B GLU 672 ? OE2 ? B GLU 7 OE2 49 1 Y 1 B LYS 688 ? CG ? B LYS 23 CG 50 1 Y 1 B LYS 688 ? CD ? B LYS 23 CD 51 1 Y 1 B LYS 688 ? CE ? B LYS 23 CE 52 1 Y 1 B LYS 688 ? NZ ? B LYS 23 NZ 53 1 Y 1 B LYS 827 ? CG ? B LYS 162 CG 54 1 Y 1 B LYS 827 ? CD ? B LYS 162 CD 55 1 Y 1 B LYS 827 ? CE ? B LYS 162 CE 56 1 Y 1 B LYS 827 ? NZ ? B LYS 162 NZ 57 1 Y 1 B ARG 828 ? CG ? B ARG 163 CG 58 1 Y 1 B ARG 828 ? CD ? B ARG 163 CD 59 1 Y 1 B ARG 828 ? NE ? B ARG 163 NE 60 1 Y 1 B ARG 828 ? CZ ? B ARG 163 CZ 61 1 Y 1 B ARG 828 ? NH1 ? B ARG 163 NH1 62 1 Y 1 B ARG 828 ? NH2 ? B ARG 163 NH2 63 1 Y 1 B LEU 843 ? CG ? B LEU 178 CG 64 1 Y 1 B LEU 843 ? CD1 ? B LEU 178 CD1 65 1 Y 1 B LEU 843 ? CD2 ? B LEU 178 CD2 66 1 Y 1 B LYS 860 ? CG ? B LYS 195 CG 67 1 Y 1 B LYS 860 ? CD ? B LYS 195 CD 68 1 Y 1 B LYS 860 ? CE ? B LYS 195 CE 69 1 Y 1 B LYS 860 ? NZ ? B LYS 195 NZ 70 1 Y 1 B THR 876 ? OG1 ? B THR 211 OG1 71 1 Y 1 B THR 876 ? CG2 ? B THR 211 CG2 72 1 Y 1 B PHE 892 ? CG ? B PHE 227 CG 73 1 Y 1 B PHE 892 ? CD1 ? B PHE 227 CD1 74 1 Y 1 B PHE 892 ? CD2 ? B PHE 227 CD2 75 1 Y 1 B PHE 892 ? CE1 ? B PHE 227 CE1 76 1 Y 1 B PHE 892 ? CE2 ? B PHE 227 CE2 77 1 Y 1 B PHE 892 ? CZ ? B PHE 227 CZ 78 1 Y 1 B MET 896 ? CG ? B MET 231 CG 79 1 Y 1 B MET 896 ? SD ? B MET 231 SD 80 1 Y 1 B MET 896 ? CE ? B MET 231 CE 81 1 Y 1 B PHE 897 ? CG ? B PHE 232 CG 82 1 Y 1 B PHE 897 ? CD1 ? B PHE 232 CD1 83 1 Y 1 B PHE 897 ? CD2 ? B PHE 232 CD2 84 1 Y 1 B PHE 897 ? CE1 ? B PHE 232 CE1 85 1 Y 1 B PHE 897 ? CE2 ? B PHE 232 CE2 86 1 Y 1 B PHE 897 ? CZ ? B PHE 232 CZ 87 1 Y 1 B LYS 898 ? CG ? B LYS 233 CG 88 1 Y 1 B LYS 898 ? CD ? B LYS 233 CD 89 1 Y 1 B LYS 898 ? CE ? B LYS 233 CE 90 1 Y 1 B LYS 898 ? NZ ? B LYS 233 NZ 91 1 Y 1 C LEU 671 ? CG ? C LEU 6 CG 92 1 Y 1 C LEU 671 ? CD1 ? C LEU 6 CD1 93 1 Y 1 C LEU 671 ? CD2 ? C LEU 6 CD2 94 1 Y 1 C GLU 672 ? CG ? C GLU 7 CG 95 1 Y 1 C GLU 672 ? CD ? C GLU 7 CD 96 1 Y 1 C GLU 672 ? OE1 ? C GLU 7 OE1 97 1 Y 1 C GLU 672 ? OE2 ? C GLU 7 OE2 98 1 Y 1 C ARG 714 ? CG ? C ARG 49 CG 99 1 Y 1 C ARG 714 ? CD ? C ARG 49 CD 100 1 Y 1 C ARG 714 ? NE ? C ARG 49 NE 101 1 Y 1 C ARG 714 ? CZ ? C ARG 49 CZ 102 1 Y 1 C ARG 714 ? NH1 ? C ARG 49 NH1 103 1 Y 1 C ARG 714 ? NH2 ? C ARG 49 NH2 104 1 Y 1 C ARG 717 ? CG ? C ARG 52 CG 105 1 Y 1 C ARG 717 ? CD ? C ARG 52 CD 106 1 Y 1 C ARG 717 ? NE ? C ARG 52 NE 107 1 Y 1 C ARG 717 ? CZ ? C ARG 52 CZ 108 1 Y 1 C ARG 717 ? NH1 ? C ARG 52 NH1 109 1 Y 1 C ARG 717 ? NH2 ? C ARG 52 NH2 110 1 Y 1 C GLN 720 ? CG ? C GLN 55 CG 111 1 Y 1 C GLN 720 ? CD ? C GLN 55 CD 112 1 Y 1 C GLN 720 ? OE1 ? C GLN 55 OE1 113 1 Y 1 C GLN 720 ? NE2 ? C GLN 55 NE2 114 1 Y 1 C LYS 730 ? CG ? C LYS 65 CG 115 1 Y 1 C LYS 730 ? CD ? C LYS 65 CD 116 1 Y 1 C LYS 730 ? CE ? C LYS 65 CE 117 1 Y 1 C LYS 730 ? NZ ? C LYS 65 NZ 118 1 Y 1 C ARG 767 ? CG ? C ARG 102 CG 119 1 Y 1 C ARG 767 ? CD ? C ARG 102 CD 120 1 Y 1 C ARG 767 ? NE ? C ARG 102 NE 121 1 Y 1 C ARG 767 ? CZ ? C ARG 102 CZ 122 1 Y 1 C ARG 767 ? NH1 ? C ARG 102 NH1 123 1 Y 1 C ARG 767 ? NH2 ? C ARG 102 NH2 124 1 Y 1 C LYS 827 ? CG ? C LYS 162 CG 125 1 Y 1 C LYS 827 ? CD ? C LYS 162 CD 126 1 Y 1 C LYS 827 ? CE ? C LYS 162 CE 127 1 Y 1 C LYS 827 ? NZ ? C LYS 162 NZ 128 1 Y 1 C ARG 828 ? CG ? C ARG 163 CG 129 1 Y 1 C ARG 828 ? CD ? C ARG 163 CD 130 1 Y 1 C ARG 828 ? NE ? C ARG 163 NE 131 1 Y 1 C ARG 828 ? CZ ? C ARG 163 CZ 132 1 Y 1 C ARG 828 ? NH1 ? C ARG 163 NH1 133 1 Y 1 C ARG 828 ? NH2 ? C ARG 163 NH2 134 1 Y 1 C ILE 851 ? CG1 ? C ILE 186 CG1 135 1 Y 1 C ILE 851 ? CG2 ? C ILE 186 CG2 136 1 Y 1 C ILE 851 ? CD1 ? C ILE 186 CD1 137 1 Y 1 C ASP 852 ? CG ? C ASP 187 CG 138 1 Y 1 C ASP 852 ? OD1 ? C ASP 187 OD1 139 1 Y 1 C ASP 852 ? OD2 ? C ASP 187 OD2 140 1 Y 1 C LYS 853 ? CG ? C LYS 188 CG 141 1 Y 1 C LYS 853 ? CD ? C LYS 188 CD 142 1 Y 1 C LYS 853 ? CE ? C LYS 188 CE 143 1 Y 1 C LYS 853 ? NZ ? C LYS 188 NZ 144 1 Y 1 C LYS 878 ? CG ? C LYS 213 CG 145 1 Y 1 C LYS 878 ? CD ? C LYS 213 CD 146 1 Y 1 C LYS 878 ? CE ? C LYS 213 CE 147 1 Y 1 C LYS 878 ? NZ ? C LYS 213 NZ 148 1 Y 1 C PHE 881 ? CG ? C PHE 216 CG 149 1 Y 1 C PHE 881 ? CD1 ? C PHE 216 CD1 150 1 Y 1 C PHE 881 ? CD2 ? C PHE 216 CD2 151 1 Y 1 C PHE 881 ? CE1 ? C PHE 216 CE1 152 1 Y 1 C PHE 881 ? CE2 ? C PHE 216 CE2 153 1 Y 1 C PHE 881 ? CZ ? C PHE 216 CZ 154 1 Y 1 C GLU 910 ? CG ? C GLU 245 CG 155 1 Y 1 C GLU 910 ? CD ? C GLU 245 CD 156 1 Y 1 C GLU 910 ? OE1 ? C GLU 245 OE1 157 1 Y 1 C GLU 910 ? OE2 ? C GLU 245 OE2 158 1 Y 1 C LYS 925 ? CG ? C LYS 260 CG 159 1 Y 1 C LYS 925 ? CD ? C LYS 260 CD 160 1 Y 1 C LYS 925 ? CE ? C LYS 260 CE 161 1 Y 1 C LYS 925 ? NZ ? C LYS 260 NZ 162 1 Y 1 C GLU 936 ? CG ? C GLU 271 CG 163 1 Y 1 C GLU 936 ? CD ? C GLU 271 CD 164 1 Y 1 C GLU 936 ? OE1 ? C GLU 271 OE1 165 1 Y 1 C GLU 936 ? OE2 ? C GLU 271 OE2 166 1 Y 1 D LYS 688 ? CG ? D LYS 23 CG 167 1 Y 1 D LYS 688 ? CD ? D LYS 23 CD 168 1 Y 1 D LYS 688 ? CE ? D LYS 23 CE 169 1 Y 1 D LYS 688 ? NZ ? D LYS 23 NZ 170 1 Y 1 D ARG 714 ? CG ? D ARG 49 CG 171 1 Y 1 D ARG 714 ? CD ? D ARG 49 CD 172 1 Y 1 D ARG 714 ? NE ? D ARG 49 NE 173 1 Y 1 D ARG 714 ? CZ ? D ARG 49 CZ 174 1 Y 1 D ARG 714 ? NH1 ? D ARG 49 NH1 175 1 Y 1 D ARG 714 ? NH2 ? D ARG 49 NH2 176 1 Y 1 D LYS 827 ? CG ? D LYS 162 CG 177 1 Y 1 D LYS 827 ? CD ? D LYS 162 CD 178 1 Y 1 D LYS 827 ? CE ? D LYS 162 CE 179 1 Y 1 D LYS 827 ? NZ ? D LYS 162 NZ 180 1 Y 1 D LEU 829 ? CG ? D LEU 164 CG 181 1 Y 1 D LEU 829 ? CD1 ? D LEU 164 CD1 182 1 Y 1 D LEU 829 ? CD2 ? D LEU 164 CD2 183 1 Y 1 D GLN 888 ? CG ? D GLN 223 CG 184 1 Y 1 D GLN 888 ? CD ? D GLN 223 CD 185 1 Y 1 D GLN 888 ? OE1 ? D GLN 223 OE1 186 1 Y 1 D GLN 888 ? NE2 ? D GLN 223 NE2 187 1 Y 1 D MET 891 ? CG ? D MET 226 CG 188 1 Y 1 D MET 891 ? SD ? D MET 226 SD 189 1 Y 1 D MET 891 ? CE ? D MET 226 CE 190 1 Y 1 D PHE 892 ? CG ? D PHE 227 CG 191 1 Y 1 D PHE 892 ? CD1 ? D PHE 227 CD1 192 1 Y 1 D PHE 892 ? CD2 ? D PHE 227 CD2 193 1 Y 1 D PHE 892 ? CE1 ? D PHE 227 CE1 194 1 Y 1 D PHE 892 ? CE2 ? D PHE 227 CE2 195 1 Y 1 D PHE 892 ? CZ ? D PHE 227 CZ 196 1 Y 1 D LYS 893 ? CG ? D LYS 228 CG 197 1 Y 1 D LYS 893 ? CD ? D LYS 228 CD 198 1 Y 1 D LYS 893 ? CE ? D LYS 228 CE 199 1 Y 1 D LYS 893 ? NZ ? D LYS 228 NZ 200 1 Y 1 D MET 896 ? CG ? D MET 231 CG 201 1 Y 1 D MET 896 ? SD ? D MET 231 SD 202 1 Y 1 D MET 896 ? CE ? D MET 231 CE 203 1 Y 1 D PHE 897 ? CG ? D PHE 232 CG 204 1 Y 1 D PHE 897 ? CD1 ? D PHE 232 CD1 205 1 Y 1 D PHE 897 ? CD2 ? D PHE 232 CD2 206 1 Y 1 D PHE 897 ? CE1 ? D PHE 232 CE1 207 1 Y 1 D PHE 897 ? CE2 ? D PHE 232 CE2 208 1 Y 1 D PHE 897 ? CZ ? D PHE 232 CZ 209 1 Y 1 D LYS 898 ? CG ? D LYS 233 CG 210 1 Y 1 D LYS 898 ? CD ? D LYS 233 CD 211 1 Y 1 D LYS 898 ? CE ? D LYS 233 CE 212 1 Y 1 D LYS 898 ? NZ ? D LYS 233 NZ 213 1 Y 1 D HIS 940 ? CG ? D HIS 275 CG 214 1 Y 1 D HIS 940 ? ND1 ? D HIS 275 ND1 215 1 Y 1 D HIS 940 ? CD2 ? D HIS 275 CD2 216 1 Y 1 D HIS 940 ? CE1 ? D HIS 275 CE1 217 1 Y 1 D HIS 940 ? NE2 ? D HIS 275 NE2 218 1 Y 1 D HIS 941 ? CG ? D HIS 276 CG 219 1 Y 1 D HIS 941 ? ND1 ? D HIS 276 ND1 220 1 Y 1 D HIS 941 ? CD2 ? D HIS 276 CD2 221 1 Y 1 D HIS 941 ? CE1 ? D HIS 276 CE1 222 1 Y 1 D HIS 941 ? NE2 ? D HIS 276 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 715 ? A ASP 50 2 1 Y 1 A SER 716 ? A SER 51 3 1 Y 1 A ARG 717 ? A ARG 52 4 1 Y 1 A TYR 718 ? A TYR 53 5 1 Y 1 A SER 719 ? A SER 54 6 1 Y 1 A ALA 830 ? A ALA 165 7 1 Y 1 A GLY 831 ? A GLY 166 8 1 Y 1 A ILE 832 ? A ILE 167 9 1 Y 1 A ASN 833 ? A ASN 168 10 1 Y 1 A PRO 834 ? A PRO 169 11 1 Y 1 A CYS 835 ? A CYS 170 12 1 Y 1 A THR 836 ? A THR 171 13 1 Y 1 A GLU 837 ? A GLU 172 14 1 Y 1 A THR 838 ? A THR 173 15 1 Y 1 A PHE 839 ? A PHE 174 16 1 Y 1 A THR 840 ? A THR 175 17 1 Y 1 A GLY 841 ? A GLY 176 18 1 Y 1 A THR 842 ? A THR 177 19 1 Y 1 A LEU 843 ? A LEU 178 20 1 Y 1 A GLN 844 ? A GLN 179 21 1 Y 1 A TYR 845 ? A TYR 180 22 1 Y 1 A MET 846 ? A MET 181 23 1 Y 1 A ALA 847 ? A ALA 182 24 1 Y 1 A PRO 848 ? A PRO 183 25 1 Y 1 A GLU 849 ? A GLU 184 26 1 Y 1 A ILE 850 ? A ILE 185 27 1 Y 1 A ILE 851 ? A ILE 186 28 1 Y 1 A ASP 852 ? A ASP 187 29 1 Y 1 A LYS 853 ? A LYS 188 30 1 Y 1 A GLY 854 ? A GLY 189 31 1 Y 1 A PRO 855 ? A PRO 190 32 1 Y 1 A ARG 856 ? A ARG 191 33 1 Y 1 A GLY 857 ? A GLY 192 34 1 Y 1 A TYR 858 ? A TYR 193 35 1 Y 1 A PHE 881 ? A PHE 216 36 1 Y 1 A TYR 882 ? A TYR 217 37 1 Y 1 A GLU 883 ? A GLU 218 38 1 Y 1 A LEU 884 ? A LEU 219 39 1 Y 1 A GLY 885 ? A GLY 220 40 1 Y 1 A GLU 886 ? A GLU 221 41 1 Y 1 A PRO 887 ? A PRO 222 42 1 Y 1 A GLN 888 ? A GLN 223 43 1 Y 1 A ALA 889 ? A ALA 224 44 1 Y 1 A ALA 890 ? A ALA 225 45 1 Y 1 A MET 891 ? A MET 226 46 1 Y 1 A PHE 892 ? A PHE 227 47 1 Y 1 A LYS 893 ? A LYS 228 48 1 Y 1 A VAL 894 ? A VAL 229 49 1 Y 1 A GLY 895 ? A GLY 230 50 1 Y 1 A MET 896 ? A MET 231 51 1 Y 1 A PHE 897 ? A PHE 232 52 1 Y 1 A LYS 898 ? A LYS 233 53 1 Y 1 A HIS 940 ? A HIS 275 54 1 Y 1 A HIS 941 ? A HIS 276 55 1 Y 1 A HIS 942 ? A HIS 277 56 1 Y 1 A HIS 943 ? A HIS 278 57 1 Y 1 A HIS 944 ? A HIS 279 58 1 Y 1 A HIS 945 ? A HIS 280 59 1 Y 1 B MET 666 ? B MET 1 60 1 Y 1 B GLU 667 ? B GLU 2 61 1 Y 1 B SER 668 ? B SER 3 62 1 Y 1 B ASP 669 ? B ASP 4 63 1 Y 1 B GLU 713 ? B GLU 48 64 1 Y 1 B ARG 714 ? B ARG 49 65 1 Y 1 B ASP 715 ? B ASP 50 66 1 Y 1 B SER 716 ? B SER 51 67 1 Y 1 B ARG 717 ? B ARG 52 68 1 Y 1 B TYR 718 ? B TYR 53 69 1 Y 1 B GLY 831 ? B GLY 166 70 1 Y 1 B ILE 832 ? B ILE 167 71 1 Y 1 B ASN 833 ? B ASN 168 72 1 Y 1 B PRO 834 ? B PRO 169 73 1 Y 1 B CYS 835 ? B CYS 170 74 1 Y 1 B THR 836 ? B THR 171 75 1 Y 1 B GLU 837 ? B GLU 172 76 1 Y 1 B THR 838 ? B THR 173 77 1 Y 1 B PHE 839 ? B PHE 174 78 1 Y 1 B THR 840 ? B THR 175 79 1 Y 1 B ILE 851 ? B ILE 186 80 1 Y 1 B ASP 852 ? B ASP 187 81 1 Y 1 B LYS 853 ? B LYS 188 82 1 Y 1 B GLY 854 ? B GLY 189 83 1 Y 1 B PRO 855 ? B PRO 190 84 1 Y 1 B ARG 856 ? B ARG 191 85 1 Y 1 B GLY 857 ? B GLY 192 86 1 Y 1 B TYR 858 ? B TYR 193 87 1 Y 1 B PHE 881 ? B PHE 216 88 1 Y 1 B TYR 882 ? B TYR 217 89 1 Y 1 B GLU 883 ? B GLU 218 90 1 Y 1 B LEU 884 ? B LEU 219 91 1 Y 1 B GLY 885 ? B GLY 220 92 1 Y 1 B GLU 886 ? B GLU 221 93 1 Y 1 B PRO 887 ? B PRO 222 94 1 Y 1 B GLN 888 ? B GLN 223 95 1 Y 1 B HIS 940 ? B HIS 275 96 1 Y 1 B HIS 941 ? B HIS 276 97 1 Y 1 B HIS 942 ? B HIS 277 98 1 Y 1 B HIS 943 ? B HIS 278 99 1 Y 1 B HIS 944 ? B HIS 279 100 1 Y 1 B HIS 945 ? B HIS 280 101 1 Y 1 C MET 666 ? C MET 1 102 1 Y 1 C GLU 667 ? C GLU 2 103 1 Y 1 C SER 668 ? C SER 3 104 1 Y 1 C ASP 669 ? C ASP 4 105 1 Y 1 C LEU 670 ? C LEU 5 106 1 Y 1 C ALA 830 ? C ALA 165 107 1 Y 1 C GLY 831 ? C GLY 166 108 1 Y 1 C ILE 832 ? C ILE 167 109 1 Y 1 C ASN 833 ? C ASN 168 110 1 Y 1 C PRO 834 ? C PRO 169 111 1 Y 1 C CYS 835 ? C CYS 170 112 1 Y 1 C THR 836 ? C THR 171 113 1 Y 1 C GLU 837 ? C GLU 172 114 1 Y 1 C THR 838 ? C THR 173 115 1 Y 1 C PHE 839 ? C PHE 174 116 1 Y 1 C THR 840 ? C THR 175 117 1 Y 1 C GLY 841 ? C GLY 176 118 1 Y 1 C THR 842 ? C THR 177 119 1 Y 1 C TYR 858 ? C TYR 193 120 1 Y 1 C TYR 882 ? C TYR 217 121 1 Y 1 C GLU 883 ? C GLU 218 122 1 Y 1 C LEU 884 ? C LEU 219 123 1 Y 1 C GLY 885 ? C GLY 220 124 1 Y 1 C GLU 886 ? C GLU 221 125 1 Y 1 C PRO 887 ? C PRO 222 126 1 Y 1 C GLN 888 ? C GLN 223 127 1 Y 1 C ALA 889 ? C ALA 224 128 1 Y 1 C ALA 890 ? C ALA 225 129 1 Y 1 C MET 891 ? C MET 226 130 1 Y 1 C PHE 892 ? C PHE 227 131 1 Y 1 C LYS 893 ? C LYS 228 132 1 Y 1 C VAL 894 ? C VAL 229 133 1 Y 1 C GLY 895 ? C GLY 230 134 1 Y 1 C MET 896 ? C MET 231 135 1 Y 1 C PHE 897 ? C PHE 232 136 1 Y 1 C LYS 898 ? C LYS 233 137 1 Y 1 C VAL 899 ? C VAL 234 138 1 Y 1 C LYS 939 ? C LYS 274 139 1 Y 1 C HIS 940 ? C HIS 275 140 1 Y 1 C HIS 941 ? C HIS 276 141 1 Y 1 C HIS 942 ? C HIS 277 142 1 Y 1 C HIS 943 ? C HIS 278 143 1 Y 1 C HIS 944 ? C HIS 279 144 1 Y 1 C HIS 945 ? C HIS 280 145 1 Y 1 D ASP 715 ? D ASP 50 146 1 Y 1 D SER 716 ? D SER 51 147 1 Y 1 D ARG 717 ? D ARG 52 148 1 Y 1 D TYR 718 ? D TYR 53 149 1 Y 1 D GLY 831 ? D GLY 166 150 1 Y 1 D ILE 832 ? D ILE 167 151 1 Y 1 D ASN 833 ? D ASN 168 152 1 Y 1 D PRO 834 ? D PRO 169 153 1 Y 1 D CYS 835 ? D CYS 170 154 1 Y 1 D THR 836 ? D THR 171 155 1 Y 1 D GLU 837 ? D GLU 172 156 1 Y 1 D THR 838 ? D THR 173 157 1 Y 1 D PHE 839 ? D PHE 174 158 1 Y 1 D THR 840 ? D THR 175 159 1 Y 1 D ASP 852 ? D ASP 187 160 1 Y 1 D LYS 853 ? D LYS 188 161 1 Y 1 D GLY 854 ? D GLY 189 162 1 Y 1 D PRO 855 ? D PRO 190 163 1 Y 1 D ARG 856 ? D ARG 191 164 1 Y 1 D GLY 857 ? D GLY 192 165 1 Y 1 D GLU 883 ? D GLU 218 166 1 Y 1 D LEU 884 ? D LEU 219 167 1 Y 1 D GLY 885 ? D GLY 220 168 1 Y 1 D HIS 942 ? D HIS 277 169 1 Y 1 D HIS 943 ? D HIS 278 170 1 Y 1 D HIS 944 ? D HIS 279 171 1 Y 1 D HIS 945 ? D HIS 280 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 NJV C1 C Y N 257 NJV C6 C Y N 258 NJV C11 C N N 259 NJV C12 C N N 260 NJV C16 C Y N 261 NJV N N Y N 262 NJV CA C Y N 263 NJV C C Y N 264 NJV CB C Y N 265 NJV CG C Y N 266 NJV CD C N N 267 NJV NE N N N 268 NJV CZ C Y N 269 NJV NH1 N Y N 270 NJV C10 C Y N 271 NJV C13 C N N 272 NJV C17 C Y N 273 NJV C18 C Y N 274 NJV C19 C Y N 275 NJV C20 C Y N 276 NJV C21 C Y N 277 NJV C22 C N N 278 NJV C23 C N N 279 NJV C24 C N N 280 NJV C7 C N N 281 NJV C8 C Y N 282 NJV C9 C Y N 283 NJV F1 F N N 284 NJV N2 N Y N 285 NJV N5 N Y N 286 NJV N6 N Y N 287 NJV N7 N Y N 288 NJV O1 O N N 289 NJV H1 H N N 290 NJV H2 H N N 291 NJV H3 H N N 292 NJV H4 H N N 293 NJV H5 H N N 294 NJV H6 H N N 295 NJV H7 H N N 296 NJV H8 H N N 297 NJV H9 H N N 298 NJV H10 H N N 299 NJV H11 H N N 300 NJV H12 H N N 301 NJV H13 H N N 302 NJV H14 H N N 303 NJV H15 H N N 304 NJV H16 H N N 305 NJV H17 H N N 306 NJV H18 H N N 307 NJV H19 H N N 308 NJV H20 H N N 309 NJV H21 H N N 310 NJV H22 H N N 311 NJV H23 H N N 312 NJV H24 H N N 313 PHE N N N N 314 PHE CA C N S 315 PHE C C N N 316 PHE O O N N 317 PHE CB C N N 318 PHE CG C Y N 319 PHE CD1 C Y N 320 PHE CD2 C Y N 321 PHE CE1 C Y N 322 PHE CE2 C Y N 323 PHE CZ C Y N 324 PHE OXT O N N 325 PHE H H N N 326 PHE H2 H N N 327 PHE HA H N N 328 PHE HB2 H N N 329 PHE HB3 H N N 330 PHE HD1 H N N 331 PHE HD2 H N N 332 PHE HE1 H N N 333 PHE HE2 H N N 334 PHE HZ H N N 335 PHE HXT H N N 336 PRO N N N N 337 PRO CA C N S 338 PRO C C N N 339 PRO O O N N 340 PRO CB C N N 341 PRO CG C N N 342 PRO CD C N N 343 PRO OXT O N N 344 PRO H H N N 345 PRO HA H N N 346 PRO HB2 H N N 347 PRO HB3 H N N 348 PRO HG2 H N N 349 PRO HG3 H N N 350 PRO HD2 H N N 351 PRO HD3 H N N 352 PRO HXT H N N 353 SER N N N N 354 SER CA C N S 355 SER C C N N 356 SER O O N N 357 SER CB C N N 358 SER OG O N N 359 SER OXT O N N 360 SER H H N N 361 SER H2 H N N 362 SER HA H N N 363 SER HB2 H N N 364 SER HB3 H N N 365 SER HG H N N 366 SER HXT H N N 367 THR N N N N 368 THR CA C N S 369 THR C C N N 370 THR O O N N 371 THR CB C N R 372 THR OG1 O N N 373 THR CG2 C N N 374 THR OXT O N N 375 THR H H N N 376 THR H2 H N N 377 THR HA H N N 378 THR HB H N N 379 THR HG1 H N N 380 THR HG21 H N N 381 THR HG22 H N N 382 THR HG23 H N N 383 THR HXT H N N 384 TRP N N N N 385 TRP CA C N S 386 TRP C C N N 387 TRP O O N N 388 TRP CB C N N 389 TRP CG C Y N 390 TRP CD1 C Y N 391 TRP CD2 C Y N 392 TRP NE1 N Y N 393 TRP CE2 C Y N 394 TRP CE3 C Y N 395 TRP CZ2 C Y N 396 TRP CZ3 C Y N 397 TRP CH2 C Y N 398 TRP OXT O N N 399 TRP H H N N 400 TRP H2 H N N 401 TRP HA H N N 402 TRP HB2 H N N 403 TRP HB3 H N N 404 TRP HD1 H N N 405 TRP HE1 H N N 406 TRP HE3 H N N 407 TRP HZ2 H N N 408 TRP HZ3 H N N 409 TRP HH2 H N N 410 TRP HXT H N N 411 TYR N N N N 412 TYR CA C N S 413 TYR C C N N 414 TYR O O N N 415 TYR CB C N N 416 TYR CG C Y N 417 TYR CD1 C Y N 418 TYR CD2 C Y N 419 TYR CE1 C Y N 420 TYR CE2 C Y N 421 TYR CZ C Y N 422 TYR OH O N N 423 TYR OXT O N N 424 TYR H H N N 425 TYR H2 H N N 426 TYR HA H N N 427 TYR HB2 H N N 428 TYR HB3 H N N 429 TYR HD1 H N N 430 TYR HD2 H N N 431 TYR HE1 H N N 432 TYR HE2 H N N 433 TYR HH H N N 434 TYR HXT H N N 435 VAL N N N N 436 VAL CA C N S 437 VAL C C N N 438 VAL O O N N 439 VAL CB C N N 440 VAL CG1 C N N 441 VAL CG2 C N N 442 VAL OXT O N N 443 VAL H H N N 444 VAL H2 H N N 445 VAL HA H N N 446 VAL HB H N N 447 VAL HG11 H N N 448 VAL HG12 H N N 449 VAL HG13 H N N 450 VAL HG21 H N N 451 VAL HG22 H N N 452 VAL HG23 H N N 453 VAL HXT H N N 454 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 HOH O H1 sing N N 156 HOH O H2 sing N N 157 ILE N CA sing N N 158 ILE N H sing N N 159 ILE N H2 sing N N 160 ILE CA C sing N N 161 ILE CA CB sing N N 162 ILE CA HA sing N N 163 ILE C O doub N N 164 ILE C OXT sing N N 165 ILE CB CG1 sing N N 166 ILE CB CG2 sing N N 167 ILE CB HB sing N N 168 ILE CG1 CD1 sing N N 169 ILE CG1 HG12 sing N N 170 ILE CG1 HG13 sing N N 171 ILE CG2 HG21 sing N N 172 ILE CG2 HG22 sing N N 173 ILE CG2 HG23 sing N N 174 ILE CD1 HD11 sing N N 175 ILE CD1 HD12 sing N N 176 ILE CD1 HD13 sing N N 177 ILE OXT HXT sing N N 178 LEU N CA sing N N 179 LEU N H sing N N 180 LEU N H2 sing N N 181 LEU CA C sing N N 182 LEU CA CB sing N N 183 LEU CA HA sing N N 184 LEU C O doub N N 185 LEU C OXT sing N N 186 LEU CB CG sing N N 187 LEU CB HB2 sing N N 188 LEU CB HB3 sing N N 189 LEU CG CD1 sing N N 190 LEU CG CD2 sing N N 191 LEU CG HG sing N N 192 LEU CD1 HD11 sing N N 193 LEU CD1 HD12 sing N N 194 LEU CD1 HD13 sing N N 195 LEU CD2 HD21 sing N N 196 LEU CD2 HD22 sing N N 197 LEU CD2 HD23 sing N N 198 LEU OXT HXT sing N N 199 LYS N CA sing N N 200 LYS N H sing N N 201 LYS N H2 sing N N 202 LYS CA C sing N N 203 LYS CA CB sing N N 204 LYS CA HA sing N N 205 LYS C O doub N N 206 LYS C OXT sing N N 207 LYS CB CG sing N N 208 LYS CB HB2 sing N N 209 LYS CB HB3 sing N N 210 LYS CG CD sing N N 211 LYS CG HG2 sing N N 212 LYS CG HG3 sing N N 213 LYS CD CE sing N N 214 LYS CD HD2 sing N N 215 LYS CD HD3 sing N N 216 LYS CE NZ sing N N 217 LYS CE HE2 sing N N 218 LYS CE HE3 sing N N 219 LYS NZ HZ1 sing N N 220 LYS NZ HZ2 sing N N 221 LYS NZ HZ3 sing N N 222 LYS OXT HXT sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 NJV N6 N7 sing Y N 243 NJV N6 C21 doub Y N 244 NJV N7 C20 doub Y N 245 NJV C17 C18 doub Y N 246 NJV C17 C16 sing Y N 247 NJV C21 N5 sing Y N 248 NJV C18 C19 sing Y N 249 NJV C20 C16 sing N N 250 NJV C20 N5 sing Y N 251 NJV C16 NH1 doub Y N 252 NJV N5 C22 sing N N 253 NJV C19 CZ doub Y N 254 NJV NH1 CZ sing Y N 255 NJV CZ NE sing N N 256 NJV C22 C23 sing N N 257 NJV C22 C24 sing N N 258 NJV NE CD sing N N 259 NJV O1 CD doub N N 260 NJV CD CG sing N N 261 NJV F1 C1 sing N N 262 NJV CG C1 doub Y N 263 NJV CG CB sing Y N 264 NJV C1 C6 sing Y N 265 NJV CB CA doub Y N 266 NJV C6 C doub Y N 267 NJV C8 N2 doub Y N 268 NJV C8 N sing Y N 269 NJV CA C sing Y N 270 NJV CA N sing N N 271 NJV C C7 sing N N 272 NJV N2 C9 sing Y N 273 NJV N C10 sing Y N 274 NJV C9 C10 doub Y N 275 NJV C9 C11 sing N N 276 NJV C13 C11 sing N N 277 NJV C13 C12 sing N N 278 NJV C11 C12 sing N N 279 NJV C6 H1 sing N N 280 NJV C11 H2 sing N N 281 NJV C12 H3 sing N N 282 NJV C12 H4 sing N N 283 NJV CB H5 sing N N 284 NJV NE H6 sing N N 285 NJV C10 H7 sing N N 286 NJV C13 H8 sing N N 287 NJV C13 H9 sing N N 288 NJV C17 H10 sing N N 289 NJV C18 H11 sing N N 290 NJV C19 H12 sing N N 291 NJV C21 H13 sing N N 292 NJV C22 H14 sing N N 293 NJV C23 H15 sing N N 294 NJV C23 H16 sing N N 295 NJV C23 H17 sing N N 296 NJV C24 H18 sing N N 297 NJV C24 H19 sing N N 298 NJV C24 H20 sing N N 299 NJV C7 H21 sing N N 300 NJV C7 H22 sing N N 301 NJV C7 H23 sing N N 302 NJV C8 H24 sing N N 303 PHE N CA sing N N 304 PHE N H sing N N 305 PHE N H2 sing N N 306 PHE CA C sing N N 307 PHE CA CB sing N N 308 PHE CA HA sing N N 309 PHE C O doub N N 310 PHE C OXT sing N N 311 PHE CB CG sing N N 312 PHE CB HB2 sing N N 313 PHE CB HB3 sing N N 314 PHE CG CD1 doub Y N 315 PHE CG CD2 sing Y N 316 PHE CD1 CE1 sing Y N 317 PHE CD1 HD1 sing N N 318 PHE CD2 CE2 doub Y N 319 PHE CD2 HD2 sing N N 320 PHE CE1 CZ doub Y N 321 PHE CE1 HE1 sing N N 322 PHE CE2 CZ sing Y N 323 PHE CE2 HE2 sing N N 324 PHE CZ HZ sing N N 325 PHE OXT HXT sing N N 326 PRO N CA sing N N 327 PRO N CD sing N N 328 PRO N H sing N N 329 PRO CA C sing N N 330 PRO CA CB sing N N 331 PRO CA HA sing N N 332 PRO C O doub N N 333 PRO C OXT sing N N 334 PRO CB CG sing N N 335 PRO CB HB2 sing N N 336 PRO CB HB3 sing N N 337 PRO CG CD sing N N 338 PRO CG HG2 sing N N 339 PRO CG HG3 sing N N 340 PRO CD HD2 sing N N 341 PRO CD HD3 sing N N 342 PRO OXT HXT sing N N 343 SER N CA sing N N 344 SER N H sing N N 345 SER N H2 sing N N 346 SER CA C sing N N 347 SER CA CB sing N N 348 SER CA HA sing N N 349 SER C O doub N N 350 SER C OXT sing N N 351 SER CB OG sing N N 352 SER CB HB2 sing N N 353 SER CB HB3 sing N N 354 SER OG HG sing N N 355 SER OXT HXT sing N N 356 THR N CA sing N N 357 THR N H sing N N 358 THR N H2 sing N N 359 THR CA C sing N N 360 THR CA CB sing N N 361 THR CA HA sing N N 362 THR C O doub N N 363 THR C OXT sing N N 364 THR CB OG1 sing N N 365 THR CB CG2 sing N N 366 THR CB HB sing N N 367 THR OG1 HG1 sing N N 368 THR CG2 HG21 sing N N 369 THR CG2 HG22 sing N N 370 THR CG2 HG23 sing N N 371 THR OXT HXT sing N N 372 TRP N CA sing N N 373 TRP N H sing N N 374 TRP N H2 sing N N 375 TRP CA C sing N N 376 TRP CA CB sing N N 377 TRP CA HA sing N N 378 TRP C O doub N N 379 TRP C OXT sing N N 380 TRP CB CG sing N N 381 TRP CB HB2 sing N N 382 TRP CB HB3 sing N N 383 TRP CG CD1 doub Y N 384 TRP CG CD2 sing Y N 385 TRP CD1 NE1 sing Y N 386 TRP CD1 HD1 sing N N 387 TRP CD2 CE2 doub Y N 388 TRP CD2 CE3 sing Y N 389 TRP NE1 CE2 sing Y N 390 TRP NE1 HE1 sing N N 391 TRP CE2 CZ2 sing Y N 392 TRP CE3 CZ3 doub Y N 393 TRP CE3 HE3 sing N N 394 TRP CZ2 CH2 doub Y N 395 TRP CZ2 HZ2 sing N N 396 TRP CZ3 CH2 sing Y N 397 TRP CZ3 HZ3 sing N N 398 TRP CH2 HH2 sing N N 399 TRP OXT HXT sing N N 400 TYR N CA sing N N 401 TYR N H sing N N 402 TYR N H2 sing N N 403 TYR CA C sing N N 404 TYR CA CB sing N N 405 TYR CA HA sing N N 406 TYR C O doub N N 407 TYR C OXT sing N N 408 TYR CB CG sing N N 409 TYR CB HB2 sing N N 410 TYR CB HB3 sing N N 411 TYR CG CD1 doub Y N 412 TYR CG CD2 sing Y N 413 TYR CD1 CE1 sing Y N 414 TYR CD1 HD1 sing N N 415 TYR CD2 CE2 doub Y N 416 TYR CD2 HD2 sing N N 417 TYR CE1 CZ doub Y N 418 TYR CE1 HE1 sing N N 419 TYR CE2 CZ sing Y N 420 TYR CE2 HE2 sing N N 421 TYR CZ OH sing N N 422 TYR OH HH sing N N 423 TYR OXT HXT sing N N 424 VAL N CA sing N N 425 VAL N H sing N N 426 VAL N H2 sing N N 427 VAL CA C sing N N 428 VAL CA CB sing N N 429 VAL CA HA sing N N 430 VAL C O doub N N 431 VAL C OXT sing N N 432 VAL CB CG1 sing N N 433 VAL CB CG2 sing N N 434 VAL CB HB sing N N 435 VAL CG1 HG11 sing N N 436 VAL CG1 HG12 sing N N 437 VAL CG1 HG13 sing N N 438 VAL CG2 HG21 sing N N 439 VAL CG2 HG22 sing N N 440 VAL CG2 HG23 sing N N 441 VAL OXT HXT sing N N 442 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-(4-cyclopropyl-1H-imidazol-1-yl)-2-fluoro-4-methyl-N-{6-[4-(propan-2-yl)-4H-1,2,4-triazol-3-yl]pyridin-2-yl}benzamide' NJV 3 'ACETATE ION' ACT 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4BF2 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'The kinase domain of ASK1 runs as a dimer on SEC and also has been reported to be dimeric by AUC.' #