data_6OZS # _entry.id 6OZS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6OZS pdb_00006ozs 10.2210/pdb6ozs/pdb WWPDB D_1000241593 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-09-04 2 'Structure model' 1 1 2019-10-16 3 'Structure model' 1 2 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.value' 22 3 'Structure model' '_struct_conn.pdbx_dist_value' 23 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 24 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 31 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 32 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 33 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 34 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 35 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 36 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6OZS _pdbx_database_status.recvd_initial_deposition_date 2019-05-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Samara, N.L.' 1 ? 'Yang, W.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 76 _citation.language ? _citation.page_first 44 _citation.page_last ? _citation.title 'Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2019.06.046 _citation.pdbx_database_id_PubMed 31444105 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, J.' 1 ? primary 'Samara, N.L.' 2 ? primary 'Kuraoka, I.' 3 ? primary 'Yang, W.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Endonuclease V' 27407.730 2 3.1.26.- ? ? ? 2 polymer syn ;DNA/RNA (5'-R(*CP*GP*GP*UP*AP*AP*CP*CP*C)-D(P*I)-R(P*A)-3') ; 3474.156 2 ? ? ? ? 3 polymer syn ;RNA (5'-R(P*UP*AP*UP*GP*CP*AP*UP*GP*CP*AP*UP*U)-3') ; 3774.264 2 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 6 ? ? ? ? 5 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 2 ? ? ? ? 6 non-polymer syn 'HEXAETHYLENE GLYCOL' 282.331 2 ? ? ? ? 7 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 8 non-polymer syn 'SODIUM ION' 22.990 2 ? ? ? ? 9 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 10 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 11 water nat water 18.015 36 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;AERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVKGDSVRACASLVVLSYPELKVVYEDSRMV GLKAPYVSGFLAFREVPFLVELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLLQVDGLEN NALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSRE YIRRTLG ; ;AERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVKGDSVRACASLVVLSYPELKVVYEDSRMV GLKAPYVSGFLAFREVPFLVELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLLQVDGLEN NALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSRE YIRRTLG ; A,B ? 2 'polydeoxyribonucleotide/polyribonucleotide hybrid' no no 'CGGUAACCC(DI)A' CGGUAACCCIA c,d ? 3 polyribonucleotide no no UAUGCAUGCAUU UAUGCAUGCAUU C,D ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'MAGNESIUM ION' MG 5 'TRIETHYLENE GLYCOL' PGE 6 'HEXAETHYLENE GLYCOL' P6G 7 GLYCEROL GOL 8 'SODIUM ION' NA 9 1,2-ETHANEDIOL EDO 10 'TETRAETHYLENE GLYCOL' PG4 11 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 ARG n 1 4 PRO n 1 5 PRO n 1 6 GLU n 1 7 GLU n 1 8 THR n 1 9 LEU n 1 10 SER n 1 11 LEU n 1 12 TRP n 1 13 LYS n 1 14 GLY n 1 15 GLU n 1 16 GLN n 1 17 ALA n 1 18 ARG n 1 19 LEU n 1 20 LYS n 1 21 ALA n 1 22 ARG n 1 23 VAL n 1 24 VAL n 1 25 ASP n 1 26 ARG n 1 27 ASP n 1 28 THR n 1 29 GLU n 1 30 ALA n 1 31 TRP n 1 32 GLN n 1 33 ARG n 1 34 ASP n 1 35 PRO n 1 36 SER n 1 37 PHE n 1 38 SER n 1 39 GLY n 1 40 LEU n 1 41 GLN n 1 42 LYS n 1 43 VAL n 1 44 GLY n 1 45 GLY n 1 46 VAL n 1 47 ASP n 1 48 VAL n 1 49 SER n 1 50 PHE n 1 51 VAL n 1 52 LYS n 1 53 GLY n 1 54 ASP n 1 55 SER n 1 56 VAL n 1 57 ARG n 1 58 ALA n 1 59 CYS n 1 60 ALA n 1 61 SER n 1 62 LEU n 1 63 VAL n 1 64 VAL n 1 65 LEU n 1 66 SER n 1 67 TYR n 1 68 PRO n 1 69 GLU n 1 70 LEU n 1 71 LYS n 1 72 VAL n 1 73 VAL n 1 74 TYR n 1 75 GLU n 1 76 ASP n 1 77 SER n 1 78 ARG n 1 79 MET n 1 80 VAL n 1 81 GLY n 1 82 LEU n 1 83 LYS n 1 84 ALA n 1 85 PRO n 1 86 TYR n 1 87 VAL n 1 88 SER n 1 89 GLY n 1 90 PHE n 1 91 LEU n 1 92 ALA n 1 93 PHE n 1 94 ARG n 1 95 GLU n 1 96 VAL n 1 97 PRO n 1 98 PHE n 1 99 LEU n 1 100 VAL n 1 101 GLU n 1 102 LEU n 1 103 VAL n 1 104 GLN n 1 105 ARG n 1 106 LEU n 1 107 GLN n 1 108 GLU n 1 109 LYS n 1 110 GLU n 1 111 PRO n 1 112 ASP n 1 113 LEU n 1 114 MET n 1 115 PRO n 1 116 GLN n 1 117 VAL n 1 118 VAL n 1 119 LEU n 1 120 VAL n 1 121 ASP n 1 122 GLY n 1 123 ASN n 1 124 GLY n 1 125 VAL n 1 126 LEU n 1 127 HIS n 1 128 GLN n 1 129 ARG n 1 130 GLY n 1 131 PHE n 1 132 GLY n 1 133 VAL n 1 134 ALA n 1 135 CYS n 1 136 HIS n 1 137 LEU n 1 138 GLY n 1 139 VAL n 1 140 LEU n 1 141 THR n 1 142 GLU n 1 143 LEU n 1 144 PRO n 1 145 CYS n 1 146 ILE n 1 147 GLY n 1 148 VAL n 1 149 ALA n 1 150 LYS n 1 151 LYS n 1 152 LEU n 1 153 LEU n 1 154 GLN n 1 155 VAL n 1 156 ASP n 1 157 GLY n 1 158 LEU n 1 159 GLU n 1 160 ASN n 1 161 ASN n 1 162 ALA n 1 163 LEU n 1 164 HIS n 1 165 LYS n 1 166 GLU n 1 167 LYS n 1 168 ILE n 1 169 VAL n 1 170 LEU n 1 171 LEU n 1 172 GLN n 1 173 ALA n 1 174 GLY n 1 175 GLY n 1 176 ASP n 1 177 THR n 1 178 PHE n 1 179 PRO n 1 180 LEU n 1 181 ILE n 1 182 GLY n 1 183 SER n 1 184 SER n 1 185 GLY n 1 186 THR n 1 187 VAL n 1 188 LEU n 1 189 GLY n 1 190 MET n 1 191 ALA n 1 192 LEU n 1 193 ARG n 1 194 SER n 1 195 HIS n 1 196 ASP n 1 197 HIS n 1 198 SER n 1 199 THR n 1 200 LYS n 1 201 PRO n 1 202 LEU n 1 203 TYR n 1 204 VAL n 1 205 SER n 1 206 VAL n 1 207 GLY n 1 208 HIS n 1 209 ARG n 1 210 ILE n 1 211 SER n 1 212 LEU n 1 213 GLU n 1 214 VAL n 1 215 ALA n 1 216 VAL n 1 217 ARG n 1 218 LEU n 1 219 THR n 1 220 HIS n 1 221 HIS n 1 222 CYS n 1 223 CYS n 1 224 ARG n 1 225 PHE n 1 226 ARG n 1 227 ILE n 1 228 PRO n 1 229 GLU n 1 230 PRO n 1 231 ILE n 1 232 ARG n 1 233 GLN n 1 234 ALA n 1 235 ASP n 1 236 ILE n 1 237 ARG n 1 238 SER n 1 239 ARG n 1 240 GLU n 1 241 TYR n 1 242 ILE n 1 243 ARG n 1 244 ARG n 1 245 THR n 1 246 LEU n 1 247 GLY n 2 1 C n 2 2 G n 2 3 G n 2 4 U n 2 5 A n 2 6 A n 2 7 C n 2 8 C n 2 9 C n 2 10 DI n 2 11 A n 3 1 U n 3 2 A n 3 3 U n 3 4 G n 3 5 C n 3 6 A n 3 7 U n 3 8 G n 3 9 C n 3 10 A n 3 11 U n 3 12 U n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 247 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Endov _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 2 1 sample 1 11 'synthetic construct' ? 32630 ? 3 1 sample 1 12 'synthetic construct' ? 32630 ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DI 'DNA linking' y "2'-DEOXYINOSINE-5'-MONOPHOSPHATE" ? 'C10 H13 N4 O7 P' 332.207 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 P6G non-polymer . 'HEXAETHYLENE GLYCOL' 'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7' 282.331 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 6 6 ALA ALA A . n A 1 2 GLU 2 7 7 GLU GLU A . n A 1 3 ARG 3 8 8 ARG ARG A . n A 1 4 PRO 4 9 9 PRO PRO A . n A 1 5 PRO 5 10 10 PRO PRO A . n A 1 6 GLU 6 11 11 GLU GLU A . n A 1 7 GLU 7 12 12 GLU GLU A . n A 1 8 THR 8 13 13 THR THR A . n A 1 9 LEU 9 14 14 LEU LEU A . n A 1 10 SER 10 15 15 SER SER A . n A 1 11 LEU 11 16 16 LEU LEU A . n A 1 12 TRP 12 17 17 TRP TRP A . n A 1 13 LYS 13 18 18 LYS LYS A . n A 1 14 GLY 14 19 19 GLY GLY A . n A 1 15 GLU 15 20 20 GLU GLU A . n A 1 16 GLN 16 21 21 GLN GLN A . n A 1 17 ALA 17 22 22 ALA ALA A . n A 1 18 ARG 18 23 23 ARG ARG A . n A 1 19 LEU 19 24 24 LEU LEU A . n A 1 20 LYS 20 25 25 LYS LYS A . n A 1 21 ALA 21 26 26 ALA ALA A . n A 1 22 ARG 22 27 27 ARG ARG A . n A 1 23 VAL 23 28 28 VAL VAL A . n A 1 24 VAL 24 29 29 VAL VAL A . n A 1 25 ASP 25 30 30 ASP ASP A . n A 1 26 ARG 26 31 31 ARG ARG A . n A 1 27 ASP 27 32 32 ASP ASP A . n A 1 28 THR 28 33 33 THR THR A . n A 1 29 GLU 29 34 34 GLU GLU A . n A 1 30 ALA 30 35 35 ALA ALA A . n A 1 31 TRP 31 36 36 TRP TRP A . n A 1 32 GLN 32 37 37 GLN GLN A . n A 1 33 ARG 33 38 38 ARG ARG A . n A 1 34 ASP 34 39 39 ASP ASP A . n A 1 35 PRO 35 40 40 PRO PRO A . n A 1 36 SER 36 41 41 SER SER A . n A 1 37 PHE 37 42 42 PHE PHE A . n A 1 38 SER 38 43 43 SER SER A . n A 1 39 GLY 39 44 44 GLY GLY A . n A 1 40 LEU 40 45 45 LEU LEU A . n A 1 41 GLN 41 46 46 GLN GLN A . n A 1 42 LYS 42 47 47 LYS LYS A . n A 1 43 VAL 43 48 48 VAL VAL A . n A 1 44 GLY 44 49 49 GLY GLY A . n A 1 45 GLY 45 50 50 GLY GLY A . n A 1 46 VAL 46 51 51 VAL VAL A . n A 1 47 ASP 47 52 52 ASP ASP A . n A 1 48 VAL 48 53 53 VAL VAL A . n A 1 49 SER 49 54 54 SER SER A . n A 1 50 PHE 50 55 55 PHE PHE A . n A 1 51 VAL 51 56 56 VAL VAL A . n A 1 52 LYS 52 57 57 LYS LYS A . n A 1 53 GLY 53 58 ? ? ? A . n A 1 54 ASP 54 59 ? ? ? A . n A 1 55 SER 55 60 ? ? ? A . n A 1 56 VAL 56 61 61 VAL VAL A . n A 1 57 ARG 57 62 62 ARG ARG A . n A 1 58 ALA 58 63 63 ALA ALA A . n A 1 59 CYS 59 64 64 CYS CYS A . n A 1 60 ALA 60 65 65 ALA ALA A . n A 1 61 SER 61 66 66 SER SER A . n A 1 62 LEU 62 67 67 LEU LEU A . n A 1 63 VAL 63 68 68 VAL VAL A . n A 1 64 VAL 64 69 69 VAL VAL A . n A 1 65 LEU 65 70 70 LEU LEU A . n A 1 66 SER 66 71 71 SER SER A . n A 1 67 TYR 67 72 72 TYR TYR A . n A 1 68 PRO 68 73 73 PRO PRO A . n A 1 69 GLU 69 74 74 GLU GLU A . n A 1 70 LEU 70 75 75 LEU LEU A . n A 1 71 LYS 71 76 76 LYS LYS A . n A 1 72 VAL 72 77 77 VAL VAL A . n A 1 73 VAL 73 78 78 VAL VAL A . n A 1 74 TYR 74 79 79 TYR TYR A . n A 1 75 GLU 75 80 80 GLU GLU A . n A 1 76 ASP 76 81 81 ASP ASP A . n A 1 77 SER 77 82 82 SER SER A . n A 1 78 ARG 78 83 83 ARG ARG A . n A 1 79 MET 79 84 84 MET MET A . n A 1 80 VAL 80 85 85 VAL VAL A . n A 1 81 GLY 81 86 86 GLY GLY A . n A 1 82 LEU 82 87 87 LEU LEU A . n A 1 83 LYS 83 88 88 LYS LYS A . n A 1 84 ALA 84 89 89 ALA ALA A . n A 1 85 PRO 85 90 90 PRO PRO A . n A 1 86 TYR 86 91 91 TYR TYR A . n A 1 87 VAL 87 92 92 VAL VAL A . n A 1 88 SER 88 93 93 SER SER A . n A 1 89 GLY 89 94 94 GLY GLY A . n A 1 90 PHE 90 95 95 PHE PHE A . n A 1 91 LEU 91 96 96 LEU LEU A . n A 1 92 ALA 92 97 97 ALA ALA A . n A 1 93 PHE 93 98 98 PHE PHE A . n A 1 94 ARG 94 99 99 ARG ARG A . n A 1 95 GLU 95 100 100 GLU GLU A . n A 1 96 VAL 96 101 101 VAL VAL A . n A 1 97 PRO 97 102 102 PRO PRO A . n A 1 98 PHE 98 103 103 PHE PHE A . n A 1 99 LEU 99 104 104 LEU LEU A . n A 1 100 VAL 100 105 105 VAL VAL A . n A 1 101 GLU 101 106 106 GLU GLU A . n A 1 102 LEU 102 107 107 LEU LEU A . n A 1 103 VAL 103 108 108 VAL VAL A . n A 1 104 GLN 104 109 109 GLN GLN A . n A 1 105 ARG 105 110 110 ARG ARG A . n A 1 106 LEU 106 111 111 LEU LEU A . n A 1 107 GLN 107 112 112 GLN GLN A . n A 1 108 GLU 108 113 113 GLU GLU A . n A 1 109 LYS 109 114 114 LYS LYS A . n A 1 110 GLU 110 115 115 GLU GLU A . n A 1 111 PRO 111 116 116 PRO PRO A . n A 1 112 ASP 112 117 117 ASP ASP A . n A 1 113 LEU 113 118 118 LEU LEU A . n A 1 114 MET 114 119 119 MET MET A . n A 1 115 PRO 115 120 120 PRO PRO A . n A 1 116 GLN 116 121 121 GLN GLN A . n A 1 117 VAL 117 122 122 VAL VAL A . n A 1 118 VAL 118 123 123 VAL VAL A . n A 1 119 LEU 119 124 124 LEU LEU A . n A 1 120 VAL 120 125 125 VAL VAL A . n A 1 121 ASP 121 126 126 ASP ASP A . n A 1 122 GLY 122 127 127 GLY GLY A . n A 1 123 ASN 123 128 128 ASN ASN A . n A 1 124 GLY 124 129 129 GLY GLY A . n A 1 125 VAL 125 130 130 VAL VAL A . n A 1 126 LEU 126 131 131 LEU LEU A . n A 1 127 HIS 127 132 132 HIS HIS A . n A 1 128 GLN 128 133 133 GLN GLN A . n A 1 129 ARG 129 134 134 ARG ARG A . n A 1 130 GLY 130 135 135 GLY GLY A . n A 1 131 PHE 131 136 136 PHE PHE A . n A 1 132 GLY 132 137 137 GLY GLY A . n A 1 133 VAL 133 138 138 VAL VAL A . n A 1 134 ALA 134 139 139 ALA ALA A . n A 1 135 CYS 135 140 140 CYS CYS A . n A 1 136 HIS 136 141 141 HIS HIS A . n A 1 137 LEU 137 142 142 LEU LEU A . n A 1 138 GLY 138 143 143 GLY GLY A . n A 1 139 VAL 139 144 144 VAL VAL A . n A 1 140 LEU 140 145 145 LEU LEU A . n A 1 141 THR 141 146 146 THR THR A . n A 1 142 GLU 142 147 147 GLU GLU A . n A 1 143 LEU 143 148 148 LEU LEU A . n A 1 144 PRO 144 149 149 PRO PRO A . n A 1 145 CYS 145 150 150 CYS CYS A . n A 1 146 ILE 146 151 151 ILE ILE A . n A 1 147 GLY 147 152 152 GLY GLY A . n A 1 148 VAL 148 153 153 VAL VAL A . n A 1 149 ALA 149 154 154 ALA ALA A . n A 1 150 LYS 150 155 155 LYS LYS A . n A 1 151 LYS 151 156 156 LYS LYS A . n A 1 152 LEU 152 157 157 LEU LEU A . n A 1 153 LEU 153 158 158 LEU LEU A . n A 1 154 GLN 154 159 159 GLN GLN A . n A 1 155 VAL 155 160 160 VAL VAL A . n A 1 156 ASP 156 161 161 ASP ASP A . n A 1 157 GLY 157 162 162 GLY GLY A . n A 1 158 LEU 158 163 163 LEU LEU A . n A 1 159 GLU 159 164 164 GLU GLU A . n A 1 160 ASN 160 165 165 ASN ASN A . n A 1 161 ASN 161 166 166 ASN ASN A . n A 1 162 ALA 162 167 167 ALA ALA A . n A 1 163 LEU 163 168 168 LEU LEU A . n A 1 164 HIS 164 169 169 HIS HIS A . n A 1 165 LYS 165 170 170 LYS LYS A . n A 1 166 GLU 166 171 171 GLU GLU A . n A 1 167 LYS 167 172 172 LYS LYS A . n A 1 168 ILE 168 173 173 ILE ILE A . n A 1 169 VAL 169 174 174 VAL VAL A . n A 1 170 LEU 170 175 175 LEU LEU A . n A 1 171 LEU 171 176 176 LEU LEU A . n A 1 172 GLN 172 177 177 GLN GLN A . n A 1 173 ALA 173 178 178 ALA ALA A . n A 1 174 GLY 174 179 179 GLY GLY A . n A 1 175 GLY 175 180 180 GLY GLY A . n A 1 176 ASP 176 181 181 ASP ASP A . n A 1 177 THR 177 182 182 THR THR A . n A 1 178 PHE 178 183 183 PHE PHE A . n A 1 179 PRO 179 184 184 PRO PRO A . n A 1 180 LEU 180 185 185 LEU LEU A . n A 1 181 ILE 181 186 186 ILE ILE A . n A 1 182 GLY 182 187 187 GLY GLY A . n A 1 183 SER 183 188 188 SER SER A . n A 1 184 SER 184 189 189 SER SER A . n A 1 185 GLY 185 190 190 GLY GLY A . n A 1 186 THR 186 191 191 THR THR A . n A 1 187 VAL 187 192 192 VAL VAL A . n A 1 188 LEU 188 193 193 LEU LEU A . n A 1 189 GLY 189 194 194 GLY GLY A . n A 1 190 MET 190 195 195 MET MET A . n A 1 191 ALA 191 196 196 ALA ALA A . n A 1 192 LEU 192 197 197 LEU LEU A . n A 1 193 ARG 193 198 198 ARG ARG A . n A 1 194 SER 194 199 199 SER SER A . n A 1 195 HIS 195 200 200 HIS HIS A . n A 1 196 ASP 196 201 201 ASP ASP A . n A 1 197 HIS 197 202 202 HIS HIS A . n A 1 198 SER 198 203 203 SER SER A . n A 1 199 THR 199 204 204 THR THR A . n A 1 200 LYS 200 205 205 LYS LYS A . n A 1 201 PRO 201 206 206 PRO PRO A . n A 1 202 LEU 202 207 207 LEU LEU A . n A 1 203 TYR 203 208 208 TYR TYR A . n A 1 204 VAL 204 209 209 VAL VAL A . n A 1 205 SER 205 210 210 SER SER A . n A 1 206 VAL 206 211 211 VAL VAL A . n A 1 207 GLY 207 212 212 GLY GLY A . n A 1 208 HIS 208 213 213 HIS HIS A . n A 1 209 ARG 209 214 214 ARG ARG A . n A 1 210 ILE 210 215 215 ILE ILE A . n A 1 211 SER 211 216 216 SER SER A . n A 1 212 LEU 212 217 217 LEU LEU A . n A 1 213 GLU 213 218 218 GLU GLU A . n A 1 214 VAL 214 219 219 VAL VAL A . n A 1 215 ALA 215 220 220 ALA ALA A . n A 1 216 VAL 216 221 221 VAL VAL A . n A 1 217 ARG 217 222 222 ARG ARG A . n A 1 218 LEU 218 223 223 LEU LEU A . n A 1 219 THR 219 224 224 THR THR A . n A 1 220 HIS 220 225 225 HIS HIS A . n A 1 221 HIS 221 226 226 HIS HIS A . n A 1 222 CYS 222 227 227 CYS CYS A . n A 1 223 CYS 223 228 228 CYS CYS A . n A 1 224 ARG 224 229 229 ARG ARG A . n A 1 225 PHE 225 230 230 PHE PHE A . n A 1 226 ARG 226 231 231 ARG ARG A . n A 1 227 ILE 227 232 232 ILE ILE A . n A 1 228 PRO 228 233 233 PRO PRO A . n A 1 229 GLU 229 234 234 GLU GLU A . n A 1 230 PRO 230 235 235 PRO PRO A . n A 1 231 ILE 231 236 236 ILE ILE A . n A 1 232 ARG 232 237 237 ARG ARG A . n A 1 233 GLN 233 238 238 GLN GLN A . n A 1 234 ALA 234 239 239 ALA ALA A . n A 1 235 ASP 235 240 240 ASP ASP A . n A 1 236 ILE 236 241 241 ILE ILE A . n A 1 237 ARG 237 242 242 ARG ARG A . n A 1 238 SER 238 243 243 SER SER A . n A 1 239 ARG 239 244 244 ARG ARG A . n A 1 240 GLU 240 245 245 GLU GLU A . n A 1 241 TYR 241 246 246 TYR TYR A . n A 1 242 ILE 242 247 247 ILE ILE A . n A 1 243 ARG 243 248 248 ARG ARG A . n A 1 244 ARG 244 249 249 ARG ARG A . n A 1 245 THR 245 250 250 THR THR A . n A 1 246 LEU 246 251 251 LEU LEU A . n A 1 247 GLY 247 252 252 GLY GLY A . n B 1 1 ALA 1 6 ? ? ? B . n B 1 2 GLU 2 7 ? ? ? B . n B 1 3 ARG 3 8 8 ARG ARG B . n B 1 4 PRO 4 9 9 PRO PRO B . n B 1 5 PRO 5 10 10 PRO PRO B . n B 1 6 GLU 6 11 11 GLU GLU B . n B 1 7 GLU 7 12 12 GLU GLU B . n B 1 8 THR 8 13 13 THR THR B . n B 1 9 LEU 9 14 14 LEU LEU B . n B 1 10 SER 10 15 15 SER SER B . n B 1 11 LEU 11 16 16 LEU LEU B . n B 1 12 TRP 12 17 17 TRP TRP B . n B 1 13 LYS 13 18 18 LYS LYS B . n B 1 14 GLY 14 19 19 GLY GLY B . n B 1 15 GLU 15 20 20 GLU GLU B . n B 1 16 GLN 16 21 21 GLN GLN B . n B 1 17 ALA 17 22 22 ALA ALA B . n B 1 18 ARG 18 23 23 ARG ARG B . n B 1 19 LEU 19 24 24 LEU LEU B . n B 1 20 LYS 20 25 25 LYS LYS B . n B 1 21 ALA 21 26 26 ALA ALA B . n B 1 22 ARG 22 27 27 ARG ARG B . n B 1 23 VAL 23 28 28 VAL VAL B . n B 1 24 VAL 24 29 29 VAL VAL B . n B 1 25 ASP 25 30 30 ASP ASP B . n B 1 26 ARG 26 31 31 ARG ARG B . n B 1 27 ASP 27 32 32 ASP ASP B . n B 1 28 THR 28 33 33 THR THR B . n B 1 29 GLU 29 34 34 GLU GLU B . n B 1 30 ALA 30 35 35 ALA ALA B . n B 1 31 TRP 31 36 36 TRP TRP B . n B 1 32 GLN 32 37 37 GLN GLN B . n B 1 33 ARG 33 38 38 ARG ARG B . n B 1 34 ASP 34 39 39 ASP ASP B . n B 1 35 PRO 35 40 40 PRO PRO B . n B 1 36 SER 36 41 41 SER SER B . n B 1 37 PHE 37 42 42 PHE PHE B . n B 1 38 SER 38 43 43 SER SER B . n B 1 39 GLY 39 44 44 GLY GLY B . n B 1 40 LEU 40 45 45 LEU LEU B . n B 1 41 GLN 41 46 46 GLN GLN B . n B 1 42 LYS 42 47 47 LYS LYS B . n B 1 43 VAL 43 48 48 VAL VAL B . n B 1 44 GLY 44 49 49 GLY GLY B . n B 1 45 GLY 45 50 50 GLY GLY B . n B 1 46 VAL 46 51 51 VAL VAL B . n B 1 47 ASP 47 52 52 ASP ASP B . n B 1 48 VAL 48 53 53 VAL VAL B . n B 1 49 SER 49 54 54 SER SER B . n B 1 50 PHE 50 55 55 PHE PHE B . n B 1 51 VAL 51 56 56 VAL VAL B . n B 1 52 LYS 52 57 57 LYS LYS B . n B 1 53 GLY 53 58 58 GLY GLY B . n B 1 54 ASP 54 59 59 ASP ASP B . n B 1 55 SER 55 60 60 SER SER B . n B 1 56 VAL 56 61 61 VAL VAL B . n B 1 57 ARG 57 62 62 ARG ARG B . n B 1 58 ALA 58 63 63 ALA ALA B . n B 1 59 CYS 59 64 64 CYS CYS B . n B 1 60 ALA 60 65 65 ALA ALA B . n B 1 61 SER 61 66 66 SER SER B . n B 1 62 LEU 62 67 67 LEU LEU B . n B 1 63 VAL 63 68 68 VAL VAL B . n B 1 64 VAL 64 69 69 VAL VAL B . n B 1 65 LEU 65 70 70 LEU LEU B . n B 1 66 SER 66 71 71 SER SER B . n B 1 67 TYR 67 72 72 TYR TYR B . n B 1 68 PRO 68 73 73 PRO PRO B . n B 1 69 GLU 69 74 74 GLU GLU B . n B 1 70 LEU 70 75 75 LEU LEU B . n B 1 71 LYS 71 76 76 LYS ALA B . n B 1 72 VAL 72 77 77 VAL VAL B . n B 1 73 VAL 73 78 78 VAL VAL B . n B 1 74 TYR 74 79 79 TYR TYR B . n B 1 75 GLU 75 80 80 GLU GLU B . n B 1 76 ASP 76 81 81 ASP ASP B . n B 1 77 SER 77 82 82 SER SER B . n B 1 78 ARG 78 83 83 ARG ARG B . n B 1 79 MET 79 84 84 MET MET B . n B 1 80 VAL 80 85 85 VAL VAL B . n B 1 81 GLY 81 86 86 GLY GLY B . n B 1 82 LEU 82 87 87 LEU LEU B . n B 1 83 LYS 83 88 88 LYS LYS B . n B 1 84 ALA 84 89 89 ALA ALA B . n B 1 85 PRO 85 90 90 PRO PRO B . n B 1 86 TYR 86 91 91 TYR TYR B . n B 1 87 VAL 87 92 92 VAL VAL B . n B 1 88 SER 88 93 93 SER SER B . n B 1 89 GLY 89 94 94 GLY GLY B . n B 1 90 PHE 90 95 95 PHE PHE B . n B 1 91 LEU 91 96 96 LEU LEU B . n B 1 92 ALA 92 97 97 ALA ALA B . n B 1 93 PHE 93 98 98 PHE PHE B . n B 1 94 ARG 94 99 99 ARG ARG B . n B 1 95 GLU 95 100 100 GLU GLU B . n B 1 96 VAL 96 101 101 VAL VAL B . n B 1 97 PRO 97 102 102 PRO PRO B . n B 1 98 PHE 98 103 103 PHE PHE B . n B 1 99 LEU 99 104 104 LEU LEU B . n B 1 100 VAL 100 105 105 VAL VAL B . n B 1 101 GLU 101 106 106 GLU GLU B . n B 1 102 LEU 102 107 107 LEU LEU B . n B 1 103 VAL 103 108 108 VAL VAL B . n B 1 104 GLN 104 109 109 GLN GLN B . n B 1 105 ARG 105 110 110 ARG ARG B . n B 1 106 LEU 106 111 111 LEU LEU B . n B 1 107 GLN 107 112 112 GLN GLN B . n B 1 108 GLU 108 113 113 GLU GLU B . n B 1 109 LYS 109 114 114 LYS LYS B . n B 1 110 GLU 110 115 115 GLU GLU B . n B 1 111 PRO 111 116 116 PRO PRO B . n B 1 112 ASP 112 117 117 ASP ASP B . n B 1 113 LEU 113 118 118 LEU LEU B . n B 1 114 MET 114 119 119 MET MET B . n B 1 115 PRO 115 120 120 PRO PRO B . n B 1 116 GLN 116 121 121 GLN GLN B . n B 1 117 VAL 117 122 122 VAL VAL B . n B 1 118 VAL 118 123 123 VAL VAL B . n B 1 119 LEU 119 124 124 LEU LEU B . n B 1 120 VAL 120 125 125 VAL VAL B . n B 1 121 ASP 121 126 126 ASP ASP B . n B 1 122 GLY 122 127 127 GLY GLY B . n B 1 123 ASN 123 128 128 ASN ASN B . n B 1 124 GLY 124 129 129 GLY GLY B . n B 1 125 VAL 125 130 130 VAL VAL B . n B 1 126 LEU 126 131 131 LEU LEU B . n B 1 127 HIS 127 132 132 HIS HIS B . n B 1 128 GLN 128 133 133 GLN GLN B . n B 1 129 ARG 129 134 134 ARG ARG B . n B 1 130 GLY 130 135 135 GLY GLY B . n B 1 131 PHE 131 136 136 PHE PHE B . n B 1 132 GLY 132 137 137 GLY GLY B . n B 1 133 VAL 133 138 138 VAL VAL B . n B 1 134 ALA 134 139 139 ALA ALA B . n B 1 135 CYS 135 140 140 CYS CYS B . n B 1 136 HIS 136 141 141 HIS HIS B . n B 1 137 LEU 137 142 142 LEU LEU B . n B 1 138 GLY 138 143 143 GLY GLY B . n B 1 139 VAL 139 144 144 VAL VAL B . n B 1 140 LEU 140 145 145 LEU LEU B . n B 1 141 THR 141 146 146 THR THR B . n B 1 142 GLU 142 147 147 GLU GLU B . n B 1 143 LEU 143 148 148 LEU LEU B . n B 1 144 PRO 144 149 149 PRO PRO B . n B 1 145 CYS 145 150 150 CYS CYS B . n B 1 146 ILE 146 151 151 ILE ILE B . n B 1 147 GLY 147 152 152 GLY GLY B . n B 1 148 VAL 148 153 153 VAL VAL B . n B 1 149 ALA 149 154 154 ALA ALA B . n B 1 150 LYS 150 155 155 LYS LYS B . n B 1 151 LYS 151 156 156 LYS LYS B . n B 1 152 LEU 152 157 157 LEU LEU B . n B 1 153 LEU 153 158 158 LEU LEU B . n B 1 154 GLN 154 159 159 GLN GLN B . n B 1 155 VAL 155 160 160 VAL VAL B . n B 1 156 ASP 156 161 161 ASP ASP B . n B 1 157 GLY 157 162 162 GLY GLY B . n B 1 158 LEU 158 163 163 LEU LEU B . n B 1 159 GLU 159 164 164 GLU GLU B . n B 1 160 ASN 160 165 165 ASN ASN B . n B 1 161 ASN 161 166 166 ASN ASN B . n B 1 162 ALA 162 167 167 ALA ALA B . n B 1 163 LEU 163 168 168 LEU LEU B . n B 1 164 HIS 164 169 169 HIS HIS B . n B 1 165 LYS 165 170 170 LYS LYS B . n B 1 166 GLU 166 171 171 GLU GLU B . n B 1 167 LYS 167 172 172 LYS LYS B . n B 1 168 ILE 168 173 173 ILE ILE B . n B 1 169 VAL 169 174 174 VAL VAL B . n B 1 170 LEU 170 175 175 LEU LEU B . n B 1 171 LEU 171 176 176 LEU LEU B . n B 1 172 GLN 172 177 177 GLN GLN B . n B 1 173 ALA 173 178 178 ALA ALA B . n B 1 174 GLY 174 179 179 GLY GLY B . n B 1 175 GLY 175 180 180 GLY GLY B . n B 1 176 ASP 176 181 181 ASP ASP B . n B 1 177 THR 177 182 182 THR THR B . n B 1 178 PHE 178 183 183 PHE PHE B . n B 1 179 PRO 179 184 184 PRO PRO B . n B 1 180 LEU 180 185 185 LEU LEU B . n B 1 181 ILE 181 186 186 ILE ILE B . n B 1 182 GLY 182 187 187 GLY GLY B . n B 1 183 SER 183 188 188 SER SER B . n B 1 184 SER 184 189 189 SER SER B . n B 1 185 GLY 185 190 190 GLY GLY B . n B 1 186 THR 186 191 191 THR THR B . n B 1 187 VAL 187 192 192 VAL VAL B . n B 1 188 LEU 188 193 193 LEU LEU B . n B 1 189 GLY 189 194 194 GLY GLY B . n B 1 190 MET 190 195 195 MET MET B . n B 1 191 ALA 191 196 196 ALA ALA B . n B 1 192 LEU 192 197 197 LEU LEU B . n B 1 193 ARG 193 198 198 ARG ARG B . n B 1 194 SER 194 199 199 SER SER B . n B 1 195 HIS 195 200 200 HIS HIS B . n B 1 196 ASP 196 201 201 ASP ASP B . n B 1 197 HIS 197 202 202 HIS HIS B . n B 1 198 SER 198 203 203 SER SER B . n B 1 199 THR 199 204 204 THR THR B . n B 1 200 LYS 200 205 205 LYS LYS B . n B 1 201 PRO 201 206 206 PRO PRO B . n B 1 202 LEU 202 207 207 LEU LEU B . n B 1 203 TYR 203 208 208 TYR TYR B . n B 1 204 VAL 204 209 209 VAL VAL B . n B 1 205 SER 205 210 210 SER SER B . n B 1 206 VAL 206 211 211 VAL VAL B . n B 1 207 GLY 207 212 212 GLY GLY B . n B 1 208 HIS 208 213 213 HIS HIS B . n B 1 209 ARG 209 214 214 ARG ARG B . n B 1 210 ILE 210 215 215 ILE ILE B . n B 1 211 SER 211 216 216 SER SER B . n B 1 212 LEU 212 217 217 LEU LEU B . n B 1 213 GLU 213 218 218 GLU GLU B . n B 1 214 VAL 214 219 219 VAL VAL B . n B 1 215 ALA 215 220 220 ALA ALA B . n B 1 216 VAL 216 221 221 VAL VAL B . n B 1 217 ARG 217 222 222 ARG ARG B . n B 1 218 LEU 218 223 223 LEU LEU B . n B 1 219 THR 219 224 224 THR THR B . n B 1 220 HIS 220 225 225 HIS HIS B . n B 1 221 HIS 221 226 226 HIS HIS B . n B 1 222 CYS 222 227 227 CYS CYS B . n B 1 223 CYS 223 228 228 CYS CYS B . n B 1 224 ARG 224 229 229 ARG ARG B . n B 1 225 PHE 225 230 230 PHE PHE B . n B 1 226 ARG 226 231 231 ARG ARG B . n B 1 227 ILE 227 232 232 ILE ILE B . n B 1 228 PRO 228 233 233 PRO PRO B . n B 1 229 GLU 229 234 234 GLU GLU B . n B 1 230 PRO 230 235 235 PRO PRO B . n B 1 231 ILE 231 236 236 ILE ILE B . n B 1 232 ARG 232 237 237 ARG ARG B . n B 1 233 GLN 233 238 238 GLN GLN B . n B 1 234 ALA 234 239 239 ALA ALA B . n B 1 235 ASP 235 240 240 ASP ASP B . n B 1 236 ILE 236 241 241 ILE ILE B . n B 1 237 ARG 237 242 242 ARG ARG B . n B 1 238 SER 238 243 243 SER SER B . n B 1 239 ARG 239 244 244 ARG ARG B . n B 1 240 GLU 240 245 245 GLU GLU B . n B 1 241 TYR 241 246 246 TYR TYR B . n B 1 242 ILE 242 247 247 ILE ILE B . n B 1 243 ARG 243 248 248 ARG ARG B . n B 1 244 ARG 244 249 249 ARG ARG B . n B 1 245 THR 245 250 250 THR THR B . n B 1 246 LEU 246 251 251 LEU LEU B . n B 1 247 GLY 247 252 ? ? ? B . n C 2 1 C 1 294 ? ? ? c . n C 2 2 G 2 295 ? ? ? c . n C 2 3 G 3 296 ? ? ? c . n C 2 4 U 4 297 ? ? ? c . n C 2 5 A 5 298 ? ? ? c . n C 2 6 A 6 299 ? ? ? c . n C 2 7 C 7 300 ? ? ? c . n C 2 8 C 8 301 8 C C c . n C 2 9 C 9 302 9 C C c . n C 2 10 DI 10 303 10 DI DI c . n C 2 11 A 11 304 11 A A c . n D 3 1 U 1 318 12 U U C . n D 3 2 A 2 319 13 A A C . n D 3 3 U 3 320 14 U U C . n D 3 4 G 4 321 15 G G C . n D 3 5 C 5 322 16 C C C . n D 3 6 A 6 323 17 A A C . n D 3 7 U 7 324 18 U U C . n D 3 8 G 8 325 19 G G C . n D 3 9 C 9 326 20 C C C . n D 3 10 A 10 327 21 A A C . n D 3 11 U 11 328 22 U U C . n D 3 12 U 12 329 23 U U C . n E 2 1 C 1 294 ? ? ? d . n E 2 2 G 2 295 ? ? ? d . n E 2 3 G 3 296 ? ? ? d . n E 2 4 U 4 297 ? ? ? d . n E 2 5 A 5 298 ? ? ? d . n E 2 6 A 6 299 ? ? ? d . n E 2 7 C 7 300 ? ? ? d . n E 2 8 C 8 301 8 C C d . n E 2 9 C 9 302 9 C C d . n E 2 10 DI 10 303 10 DI DI d . n E 2 11 A 11 304 11 A A d . n F 3 1 U 1 318 12 U U D . n F 3 2 A 2 319 13 A A D . n F 3 3 U 3 320 14 U U D . n F 3 4 G 4 321 15 G G D . n F 3 5 C 5 322 16 C C D . n F 3 6 A 6 323 17 A A D . n F 3 7 U 7 324 18 U U D . n F 3 8 G 8 325 19 G G D . n F 3 9 C 9 326 20 C C D . n F 3 10 A 10 327 21 A A D . n F 3 11 U 11 328 22 U U D . n F 3 12 U 12 329 23 U U D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 4 MG 1 301 1 MG MG A . H 5 PGE 1 302 3 PGE PGE A . I 6 P6G 1 303 1 P6G P6G A . J 6 P6G 1 304 2 P6G P6G A . K 7 GOL 1 305 1 GOL GOL A . L 7 GOL 1 306 2 GOL GOL A . M 8 NA 1 307 1 NA NA A . N 9 EDO 1 308 1 EDO EDO A . O 10 PG4 1 309 1 PG4 PG4 A . P 4 MG 1 310 2 MG MG A . Q 4 MG 1 301 3 MG MG B . R 5 PGE 1 302 4 PGE PGE B . S 8 NA 1 303 2 NA NA B . T 4 MG 1 304 4 MG MG B . U 4 MG 1 401 5 MG MG C . V 4 MG 1 401 6 MG MG D . W 9 EDO 1 402 2 EDO EDO D . X 11 HOH 1 401 44 HOH HOH A . X 11 HOH 2 402 4 HOH HOH A . X 11 HOH 3 403 28 HOH HOH A . X 11 HOH 4 404 7 HOH HOH A . X 11 HOH 5 405 14 HOH HOH A . X 11 HOH 6 406 40 HOH HOH A . X 11 HOH 7 407 23 HOH HOH A . X 11 HOH 8 408 16 HOH HOH A . X 11 HOH 9 409 43 HOH HOH A . X 11 HOH 10 410 8 HOH HOH A . X 11 HOH 11 411 5 HOH HOH A . X 11 HOH 12 412 22 HOH HOH A . X 11 HOH 13 413 12 HOH HOH A . X 11 HOH 14 414 6 HOH HOH A . X 11 HOH 15 415 34 HOH HOH A . X 11 HOH 16 416 11 HOH HOH A . X 11 HOH 17 417 13 HOH HOH A . X 11 HOH 18 418 45 HOH HOH A . X 11 HOH 19 419 41 HOH HOH A . X 11 HOH 20 420 9 HOH HOH A . X 11 HOH 21 421 42 HOH HOH A . X 11 HOH 22 422 29 HOH HOH A . X 11 HOH 23 423 47 HOH HOH A . X 11 HOH 24 424 17 HOH HOH A . X 11 HOH 25 425 39 HOH HOH A . Y 11 HOH 1 401 1 HOH HOH B . Y 11 HOH 2 402 3 HOH HOH B . Y 11 HOH 3 403 18 HOH HOH B . Y 11 HOH 4 404 27 HOH HOH B . Y 11 HOH 5 405 33 HOH HOH B . Z 11 HOH 1 401 10 HOH HOH c . Z 11 HOH 2 402 2 HOH HOH c . AA 11 HOH 1 501 30 HOH HOH C . AA 11 HOH 2 502 32 HOH HOH C . AA 11 HOH 3 503 31 HOH HOH C . BA 11 HOH 1 501 37 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 7 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 7 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 7 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 7 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A LYS 57 ? CG ? A LYS 52 CG 6 1 Y 1 A LYS 57 ? CD ? A LYS 52 CD 7 1 Y 1 A LYS 57 ? CE ? A LYS 52 CE 8 1 Y 1 A LYS 57 ? NZ ? A LYS 52 NZ 9 1 Y 1 A ARG 62 ? CG ? A ARG 57 CG 10 1 Y 1 A ARG 62 ? CD ? A ARG 57 CD 11 1 Y 1 A ARG 62 ? NE ? A ARG 57 NE 12 1 Y 1 A ARG 62 ? CZ ? A ARG 57 CZ 13 1 Y 1 A ARG 62 ? NH1 ? A ARG 57 NH1 14 1 Y 1 A ARG 62 ? NH2 ? A ARG 57 NH2 15 1 Y 1 A LYS 88 ? CG ? A LYS 83 CG 16 1 Y 1 A LYS 88 ? CD ? A LYS 83 CD 17 1 Y 1 A LYS 88 ? CE ? A LYS 83 CE 18 1 Y 1 A LYS 88 ? NZ ? A LYS 83 NZ 19 1 Y 1 B LYS 57 ? CG ? B LYS 52 CG 20 1 Y 1 B LYS 57 ? CD ? B LYS 52 CD 21 1 Y 1 B LYS 57 ? CE ? B LYS 52 CE 22 1 Y 1 B LYS 57 ? NZ ? B LYS 52 NZ 23 1 Y 1 B ASP 59 ? CG ? B ASP 54 CG 24 1 Y 1 B ASP 59 ? OD1 ? B ASP 54 OD1 25 1 Y 1 B ASP 59 ? OD2 ? B ASP 54 OD2 26 1 Y 1 B LYS 76 ? CG ? B LYS 71 CG 27 1 Y 1 B LYS 76 ? CD ? B LYS 71 CD 28 1 Y 1 B LYS 76 ? CE ? B LYS 71 CE 29 1 Y 1 B LYS 76 ? NZ ? B LYS 71 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.31 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6OZS _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.086 _cell.length_a_esd ? _cell.length_b 73.257 _cell.length_b_esd ? _cell.length_c 155.704 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6OZS _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6OZS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M potassium sodium tartrate, 20-25% w/v PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 48.740 _reflns.entry_id 6OZS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.410 _reflns.d_resolution_low 41.710 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 30469 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.000 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 30469 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.410 _reflns_shell.d_res_low 2.500 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2341 _reflns_shell.percent_possible_all 71.400 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 199.490 _refine.B_iso_mean 39 _refine.B_iso_min 31.010 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6OZS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.41 _refine.ls_d_res_low 36.2460 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30306 _refine.ls_number_reflns_R_free 1530 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.1900 _refine.ls_percent_reflns_R_free 5.0500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1932 _refine.ls_R_factor_R_free 0.2360 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1909 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.990 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.7300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.41 _refine_hist.d_res_low 36.2460 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 4592 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 512 _refine_hist.pdbx_B_iso_mean_ligand 97.79 _refine_hist.pdbx_B_iso_mean_solvent 59.27 _refine_hist.pdbx_number_atoms_protein 3785 _refine_hist.pdbx_number_atoms_nucleic_acid 506 _refine_hist.pdbx_number_atoms_ligand 265 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 4729 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.012 ? 6508 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.053 ? 763 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 716 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.430 ? 2774 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? D 342 7.501 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? C 342 7.501 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 3 TORSIONAL ? A 1975 7.501 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 4 TORSIONAL ? B 1975 7.501 ? 2 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4067 2.4844 1963 . 92 1871 69.0000 . . . 0.3430 0.0000 0.2875 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.4844 2.5732 2425 . 116 2309 85.0000 . . . 0.3271 0.0000 0.2761 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.5732 2.6761 2746 . 137 2609 96.0000 . . . 0.3033 0.0000 0.2605 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.6761 2.7979 2835 . 149 2686 99.0000 . . . 0.2433 0.0000 0.2554 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.7979 2.9453 2851 . 140 2711 100.0000 . . . 0.3150 0.0000 0.2358 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.9453 3.1298 2858 . 151 2707 100.0000 . . . 0.3072 0.0000 0.2195 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 3.1298 3.3713 2881 . 131 2750 100.0000 . . . 0.2728 0.0000 0.2003 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 3.3713 3.7102 2884 . 148 2736 100.0000 . . . 0.2233 0.0000 0.1829 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 3.7102 4.2464 2890 . 148 2742 100.0000 . . . 0.2275 0.0000 0.1663 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 4.2464 5.3473 2929 . 146 2783 99.0000 . . . 0.2106 0.0000 0.1502 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 5.3473 36.2505 3044 . 172 2872 99.0000 . . . 0.1959 0.0000 0.1827 . . . . . . 11 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 'chain D' 1 2 'chain C' 2 1 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; 2 2 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? D 8 D 11 'chain D' ? ? ? ? ? ? ? ? ? ? 1 2 1 ? C 8 C 11 'chain C' ? ? ? ? ? ? ? ? ? ? 2 1 1 ? A 9 A 11 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 1 2 ? A 13 A 15 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 1 3 ? A 0 A 0 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 1 4 ? A 54 A 54 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 1 5 ? A 6 A 252 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 1 6 ? A 6 A 252 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 1 7 ? A 6 A 252 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 1 8 ? A 6 A 252 ;(chain A and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name O or name N or name C or name CB or name CG or name CD1)) or (resid 88 and (name O or name N or name CA or name C )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 2 1 ? B 9 B 11 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 2 2 ? B 13 B 15 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 2 3 ? B 0 B 0 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 2 4 ? B 54 B 54 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 2 5 ? B 8 B 251 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 2 6 ? B 8 B 251 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 2 7 ? B 8 B 251 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? 2 2 8 ? B 8 B 251 ;(chain B and (resseq 9:11 or resseq 13:15 or resseq 17:22 or resseq 24:53 or (resid 54 and (name N or name CA or name CB or name OG )) or (resid 55 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or (resid 56 and (name N or name CA or name CB or name CG2 or name C or name O )) or resseq 57 or resseq 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resseq 63:65 or resseq 67:75 or resseq 77:78 or (resid 79 and (name N or name CA or name CB or name CG or name CZ or name OH or name C or name O )) or resseq 80:82 or (resid 83 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 84:86 or (resid 87 and (name N or name CA or name CB or name CG or name CD1 or name CD2)) or (resid 88 and (name N or name CA or name C or name CB )) or resseq 89:98 or (resid 99 and (name N or name CA or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or resseq 100:105 or (resid 106 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 107:118 or (resid 119 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 120:167 or (resid 168 and (name N or name CA or name CB or name CG or name CD2 or name C or name O )) or resseq 169:174 or (resid 175 and (name N or name CA or name CB or name CG or name CD1 or name C or name O )) or resseq 176:185 or (resid 186 and (name N or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or resseq 187:194 or (resid 195 and (name N or name CA or name CB or name CG or name SD or name CE )) or resseq 196:199 or resseq 201:202 or (resid 204 and (name N or name CA or name CB or name OG1 or name CG2)) or resseq 205:213 or resseq 215:217 or (resid 218 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 219:228 or resseq 230:241 or resseq 243:247 or resseq 250)) ; ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 6OZS _struct.title ;Crystal structure of Mus musculus (Mm) Endonuclease V in complex with a 23mer RNA oligo containing an inosine after a 90 min soak in 10 mM Mg2+ ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6OZS _struct_keywords.text 'Nucleic acid hydrolysis, RNA recognition, metal ion dependent catalysis, DNA damage, adenosine deamination, HYDROLASE-RNA complex' _struct_keywords.pdbx_keywords HYDROLASE/RNA # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 2 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 6 ? J N N 6 ? K N N 7 ? L N N 7 ? M N N 8 ? N N N 9 ? O N N 10 ? P N N 4 ? Q N N 4 ? R N N 5 ? S N N 8 ? T N N 4 ? U N N 4 ? V N N 4 ? W N N 9 ? X N N 11 ? Y N N 11 ? Z N N 11 ? AA N N 11 ? BA N N 11 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ENDOV_MOUSE Q8C9A2 ? 1 ;AERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVKGDSVRACASLVVLSYPELKVVYEDSRMV GLKAPYVSGFLAFREVPFLVELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLLQVDGLEN NALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSRE YIRRTLG ; 6 2 PDB 6OZS 6OZS ? 2 ? 1 3 PDB 6OZS 6OZS ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6OZS A 1 ? 247 ? Q8C9A2 6 ? 252 ? 6 252 2 1 6OZS B 1 ? 247 ? Q8C9A2 6 ? 252 ? 6 252 3 2 6OZS c 1 ? 11 ? 6OZS 294 ? 304 ? 294 304 4 3 6OZS C 1 ? 12 ? 6OZS 318 ? 329 ? 318 329 5 2 6OZS d 1 ? 11 ? 6OZS 294 ? 304 ? 294 304 6 3 6OZS D 1 ? 12 ? 6OZS 318 ? 329 ? 318 329 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 10160 ? 1 MORE -115 ? 1 'SSA (A^2)' 24890 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 5 ? ALA A 21 ? PRO A 10 ALA A 26 1 ? 17 HELX_P HELX_P2 AA2 GLU A 29 ? ASP A 34 ? GLU A 34 ASP A 39 5 ? 6 HELX_P HELX_P3 AA3 LEU A 91 ? GLU A 110 ? LEU A 96 GLU A 115 1 ? 20 HELX_P HELX_P4 AA4 PRO A 111 ? MET A 114 ? PRO A 116 MET A 119 5 ? 4 HELX_P HELX_P5 AA5 GLY A 132 ? GLU A 142 ? GLY A 137 GLU A 147 1 ? 11 HELX_P HELX_P6 AA6 ASN A 161 ? LEU A 171 ? ASN A 166 LEU A 176 1 ? 11 HELX_P HELX_P7 AA7 SER A 211 ? CYS A 223 ? SER A 216 CYS A 228 1 ? 13 HELX_P HELX_P8 AA8 PRO A 228 ? THR A 245 ? PRO A 233 THR A 250 1 ? 18 HELX_P HELX_P9 AA9 PRO B 5 ? ALA B 21 ? PRO B 10 ALA B 26 1 ? 17 HELX_P HELX_P10 AB1 GLU B 29 ? ASP B 34 ? GLU B 34 ASP B 39 5 ? 6 HELX_P HELX_P11 AB2 PHE B 90 ? GLU B 110 ? PHE B 95 GLU B 115 1 ? 21 HELX_P HELX_P12 AB3 PRO B 111 ? MET B 114 ? PRO B 116 MET B 119 5 ? 4 HELX_P HELX_P13 AB4 GLY B 132 ? GLU B 142 ? GLY B 137 GLU B 147 1 ? 11 HELX_P HELX_P14 AB5 ASN B 161 ? LEU B 171 ? ASN B 166 LEU B 176 1 ? 11 HELX_P HELX_P15 AB6 SER B 211 ? CYS B 222 ? SER B 216 CYS B 227 1 ? 12 HELX_P HELX_P16 AB7 PRO B 228 ? THR B 245 ? PRO B 233 THR B 250 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A LEU 40 O ? ? ? 1_555 M NA . NA ? ? A LEU 45 A NA 307 1_555 ? ? ? ? ? ? ? 2.722 ? ? metalc2 metalc ? ? A ASP 47 OD2 ? ? ? 1_555 G MG . MG ? ? A ASP 52 A MG 301 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc3 metalc ? ? A ASP 47 OD1 ? ? ? 1_555 P MG . MG ? ? A ASP 52 A MG 310 1_555 ? ? ? ? ? ? ? 2.234 ? ? metalc4 metalc ? ? A ASP 121 OD2 ? ? ? 1_555 P MG . MG ? ? A ASP 126 A MG 310 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc5 metalc ? ? A ASP 235 OD1 ? ? ? 1_555 G MG . MG ? ? A ASP 240 A MG 301 1_555 ? ? ? ? ? ? ? 1.817 ? ? metalc6 metalc ? ? G MG . MG ? ? ? 1_555 X HOH . O ? ? A MG 301 A HOH 411 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc7 metalc ? ? G MG . MG ? ? ? 1_555 X HOH . O ? ? A MG 301 A HOH 414 1_555 ? ? ? ? ? ? ? 2.393 ? ? metalc8 metalc ? ? G MG . MG ? ? ? 1_555 D U 1 OP3 ? ? A MG 301 C U 318 1_555 ? ? ? ? ? ? ? 2.108 ? ? metalc9 metalc ? ? G MG . MG ? ? ? 1_555 D U 1 OP1 ? ? A MG 301 C U 318 1_555 ? ? ? ? ? ? ? 1.862 ? ? metalc10 metalc ? ? M NA . NA ? ? ? 1_555 X HOH . O ? ? A NA 307 A HOH 401 1_555 ? ? ? ? ? ? ? 3.149 ? ? metalc11 metalc ? ? M NA . NA ? ? ? 1_555 X HOH . O ? ? A NA 307 A HOH 424 1_555 ? ? ? ? ? ? ? 2.829 ? ? metalc12 metalc ? ? P MG . MG ? ? ? 1_555 X HOH . O ? ? A MG 310 A HOH 402 1_555 ? ? ? ? ? ? ? 2.193 ? ? metalc13 metalc ? ? P MG . MG ? ? ? 1_555 C A 11 "O3'" ? ? A MG 310 c A 304 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc14 metalc ? ? P MG . MG ? ? ? 1_555 Z HOH . O ? ? A MG 310 c HOH 402 1_555 ? ? ? ? ? ? ? 2.109 ? ? metalc15 metalc ? ? P MG . MG ? ? ? 1_555 D U 1 OP1 ? ? A MG 310 C U 318 1_555 ? ? ? ? ? ? ? 1.885 ? ? metalc16 metalc ? ? B ASP 47 OD2 ? ? ? 1_555 Q MG . MG ? ? B ASP 52 B MG 301 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc17 metalc ? ? B ASP 47 OD1 ? ? ? 1_555 T MG . MG ? ? B ASP 52 B MG 304 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc18 metalc ? ? B ASP 121 OD2 ? ? ? 1_555 T MG . MG ? ? B ASP 126 B MG 304 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc19 metalc ? ? B ASP 235 OD1 ? ? ? 1_555 Q MG . MG ? ? B ASP 240 B MG 301 1_555 ? ? ? ? ? ? ? 1.818 ? ? metalc20 metalc ? ? Q MG . MG ? ? ? 1_555 Y HOH . O ? ? B MG 301 B HOH 404 1_555 ? ? ? ? ? ? ? 2.769 ? ? metalc21 metalc ? ? Q MG . MG ? ? ? 1_555 F U 1 OP3 ? ? B MG 301 D U 318 1_555 ? ? ? ? ? ? ? 2.202 ? ? metalc22 metalc ? ? Q MG . MG ? ? ? 1_555 F U 1 OP1 ? ? B MG 301 D U 318 1_555 ? ? ? ? ? ? ? 1.881 ? ? metalc23 metalc ? ? T MG . MG ? ? ? 1_555 Y HOH . O ? ? B MG 304 B HOH 401 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc24 metalc ? ? T MG . MG ? ? ? 1_555 E A 11 "O3'" ? ? B MG 304 d A 304 1_555 ? ? ? ? ? ? ? 2.063 ? ? metalc25 metalc ? ? T MG . MG ? ? ? 1_555 F U 1 OP1 ? ? B MG 304 D U 318 1_555 ? ? ? ? ? ? ? 2.543 ? ? metalc26 metalc ? ? D U 1 OP3 ? ? ? 1_555 U MG . MG ? ? C U 318 C MG 401 1_555 ? ? ? ? ? ? ? 2.114 ? ? metalc27 metalc ? ? D A 2 OP2 ? ? ? 1_555 U MG . MG ? ? C A 319 C MG 401 1_555 ? ? ? ? ? ? ? 2.107 ? ? metalc28 metalc ? ? U MG . MG ? ? ? 1_555 AA HOH . O ? ? C MG 401 C HOH 501 1_555 ? ? ? ? ? ? ? 2.105 ? ? metalc29 metalc ? ? U MG . MG ? ? ? 1_555 AA HOH . O ? ? C MG 401 C HOH 502 1_555 ? ? ? ? ? ? ? 2.107 ? ? metalc30 metalc ? ? U MG . MG ? ? ? 1_555 AA HOH . O ? ? C MG 401 C HOH 503 1_555 ? ? ? ? ? ? ? 2.103 ? ? metalc31 metalc ? ? F U 1 OP3 ? ? ? 1_555 V MG . MG ? ? D U 318 D MG 401 1_555 ? ? ? ? ? ? ? 2.207 ? ? metalc32 metalc ? ? F A 2 OP2 ? ? ? 1_555 V MG . MG ? ? D A 319 D MG 401 1_555 ? ? ? ? ? ? ? 2.399 ? ? metalc33 metalc ? ? V MG . MG ? ? ? 1_555 BA HOH . O ? ? D MG 401 D HOH 501 1_555 ? ? ? ? ? ? ? 2.001 ? ? hydrog1 hydrog ? ? D U 1 N3 ? ? ? 1_555 F U 12 O2 ? ? C U 318 D U 329 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? ? hydrog2 hydrog ? ? D U 1 O4 ? ? ? 1_555 F U 12 N3 ? ? C U 318 D U 329 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? ? hydrog3 hydrog ? ? D A 2 N1 ? ? ? 1_555 F U 11 N3 ? ? C A 319 D U 328 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? D A 2 N6 ? ? ? 1_555 F U 11 O4 ? ? C A 319 D U 328 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? D U 3 N3 ? ? ? 1_555 F A 10 N1 ? ? C U 320 D A 327 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? D U 3 O4 ? ? ? 1_555 F A 10 N6 ? ? C U 320 D A 327 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? D G 4 N1 ? ? ? 1_555 F C 9 N3 ? ? C G 321 D C 326 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? D G 4 N2 ? ? ? 1_555 F C 9 O2 ? ? C G 321 D C 326 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? D G 4 O6 ? ? ? 1_555 F C 9 N4 ? ? C G 321 D C 326 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? D C 5 N3 ? ? ? 1_555 F G 8 N1 ? ? C C 322 D G 325 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? D C 5 N4 ? ? ? 1_555 F G 8 O6 ? ? C C 322 D G 325 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog12 hydrog ? ? D C 5 O2 ? ? ? 1_555 F G 8 N2 ? ? C C 322 D G 325 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog13 hydrog ? ? D A 6 N1 ? ? ? 1_555 F U 7 N3 ? ? C A 323 D U 324 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? D A 6 N6 ? ? ? 1_555 F U 7 O4 ? ? C A 323 D U 324 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? D U 7 N3 ? ? ? 1_555 F A 6 N1 ? ? C U 324 D A 323 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? D U 7 O4 ? ? ? 1_555 F A 6 N6 ? ? C U 324 D A 323 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? D G 8 N1 ? ? ? 1_555 F C 5 N3 ? ? C G 325 D C 322 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? D G 8 N2 ? ? ? 1_555 F C 5 O2 ? ? C G 325 D C 322 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? D G 8 O6 ? ? ? 1_555 F C 5 N4 ? ? C G 325 D C 322 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog20 hydrog ? ? D C 9 N3 ? ? ? 1_555 F G 4 N1 ? ? C C 326 D G 321 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog21 hydrog ? ? D C 9 N4 ? ? ? 1_555 F G 4 O6 ? ? C C 326 D G 321 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog22 hydrog ? ? D C 9 O2 ? ? ? 1_555 F G 4 N2 ? ? C C 326 D G 321 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog23 hydrog ? ? D A 10 N1 ? ? ? 1_555 F U 3 N3 ? ? C A 327 D U 320 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog24 hydrog ? ? D A 10 N6 ? ? ? 1_555 F U 3 O4 ? ? C A 327 D U 320 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? D U 11 N3 ? ? ? 1_555 F A 2 N1 ? ? C U 328 D A 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? D U 11 O4 ? ? ? 1_555 F A 2 N6 ? ? C U 328 D A 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? D U 12 N3 ? ? ? 1_555 F U 1 O4 ? ? C U 329 D U 318 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? ? hydrog28 hydrog ? ? D U 12 O2 ? ? ? 1_555 F U 1 N3 ? ? C U 329 D U 318 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? hydrog ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A LEU 40 ? A LEU 45 ? 1_555 NA ? M NA . ? A NA 307 ? 1_555 O ? X HOH . ? A HOH 401 ? 1_555 117.4 ? 2 O ? A LEU 40 ? A LEU 45 ? 1_555 NA ? M NA . ? A NA 307 ? 1_555 O ? X HOH . ? A HOH 424 ? 1_555 105.5 ? 3 O ? X HOH . ? A HOH 401 ? 1_555 NA ? M NA . ? A NA 307 ? 1_555 O ? X HOH . ? A HOH 424 ? 1_555 122.5 ? 4 OD2 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OD1 ? A ASP 235 ? A ASP 240 ? 1_555 84.3 ? 5 OD2 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 O ? X HOH . ? A HOH 411 ? 1_555 84.1 ? 6 OD1 ? A ASP 235 ? A ASP 240 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 O ? X HOH . ? A HOH 411 ? 1_555 90.0 ? 7 OD2 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 O ? X HOH . ? A HOH 414 ? 1_555 81.6 ? 8 OD1 ? A ASP 235 ? A ASP 240 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 O ? X HOH . ? A HOH 414 ? 1_555 80.8 ? 9 O ? X HOH . ? A HOH 411 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 O ? X HOH . ? A HOH 414 ? 1_555 163.7 ? 10 OD2 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP3 ? D U 1 ? C U 318 ? 1_555 169.6 ? 11 OD1 ? A ASP 235 ? A ASP 240 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP3 ? D U 1 ? C U 318 ? 1_555 102.4 ? 12 O ? X HOH . ? A HOH 411 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP3 ? D U 1 ? C U 318 ? 1_555 103.7 ? 13 O ? X HOH . ? A HOH 414 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP3 ? D U 1 ? C U 318 ? 1_555 91.5 ? 14 OD2 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 98.3 ? 15 OD1 ? A ASP 235 ? A ASP 240 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 166.9 ? 16 O ? X HOH . ? A HOH 411 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 103.0 ? 17 O ? X HOH . ? A HOH 414 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 86.9 ? 18 OP3 ? D U 1 ? C U 318 ? 1_555 MG ? G MG . ? A MG 301 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 73.4 ? 19 OD1 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 OD2 ? A ASP 121 ? A ASP 126 ? 1_555 83.2 ? 20 OD1 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 O ? X HOH . ? A HOH 402 ? 1_555 81.5 ? 21 OD2 ? A ASP 121 ? A ASP 126 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 O ? X HOH . ? A HOH 402 ? 1_555 159.8 ? 22 OD1 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 "O3'" ? C A 11 ? c A 304 ? 1_555 165.6 ? 23 OD2 ? A ASP 121 ? A ASP 126 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 "O3'" ? C A 11 ? c A 304 ? 1_555 82.5 ? 24 O ? X HOH . ? A HOH 402 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 "O3'" ? C A 11 ? c A 304 ? 1_555 112.1 ? 25 OD1 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 O ? Z HOH . ? c HOH 402 ? 1_555 90.8 ? 26 OD2 ? A ASP 121 ? A ASP 126 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 O ? Z HOH . ? c HOH 402 ? 1_555 92.2 ? 27 O ? X HOH . ? A HOH 402 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 O ? Z HOH . ? c HOH 402 ? 1_555 74.9 ? 28 "O3'" ? C A 11 ? c A 304 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 O ? Z HOH . ? c HOH 402 ? 1_555 88.5 ? 29 OD1 ? A ASP 47 ? A ASP 52 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 86.7 ? 30 OD2 ? A ASP 121 ? A ASP 126 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 83.6 ? 31 O ? X HOH . ? A HOH 402 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 108.5 ? 32 "O3'" ? C A 11 ? c A 304 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 92.9 ? 33 O ? Z HOH . ? c HOH 402 ? 1_555 MG ? P MG . ? A MG 310 ? 1_555 OP1 ? D U 1 ? C U 318 ? 1_555 175.3 ? 34 OD2 ? B ASP 47 ? B ASP 52 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 OD1 ? B ASP 235 ? B ASP 240 ? 1_555 85.2 ? 35 OD2 ? B ASP 47 ? B ASP 52 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 O ? Y HOH . ? B HOH 404 ? 1_555 75.8 ? 36 OD1 ? B ASP 235 ? B ASP 240 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 O ? Y HOH . ? B HOH 404 ? 1_555 72.5 ? 37 OD2 ? B ASP 47 ? B ASP 52 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 OP3 ? F U 1 ? D U 318 ? 1_555 155.0 ? 38 OD1 ? B ASP 235 ? B ASP 240 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 OP3 ? F U 1 ? D U 318 ? 1_555 100.0 ? 39 O ? Y HOH . ? B HOH 404 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 OP3 ? F U 1 ? D U 318 ? 1_555 82.5 ? 40 OD2 ? B ASP 47 ? B ASP 52 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 OP1 ? F U 1 ? D U 318 ? 1_555 95.5 ? 41 OD1 ? B ASP 235 ? B ASP 240 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 OP1 ? F U 1 ? D U 318 ? 1_555 161.3 ? 42 O ? Y HOH . ? B HOH 404 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 OP1 ? F U 1 ? D U 318 ? 1_555 89.5 ? 43 OP3 ? F U 1 ? D U 318 ? 1_555 MG ? Q MG . ? B MG 301 ? 1_555 OP1 ? F U 1 ? D U 318 ? 1_555 71.8 ? 44 OD1 ? B ASP 47 ? B ASP 52 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 OD2 ? B ASP 121 ? B ASP 126 ? 1_555 79.6 ? 45 OD1 ? B ASP 47 ? B ASP 52 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 O ? Y HOH . ? B HOH 401 ? 1_555 77.3 ? 46 OD2 ? B ASP 121 ? B ASP 126 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 O ? Y HOH . ? B HOH 401 ? 1_555 148.5 ? 47 OD1 ? B ASP 47 ? B ASP 52 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 "O3'" ? E A 11 ? d A 304 ? 1_555 145.1 ? 48 OD2 ? B ASP 121 ? B ASP 126 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 "O3'" ? E A 11 ? d A 304 ? 1_555 78.3 ? 49 O ? Y HOH . ? B HOH 401 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 "O3'" ? E A 11 ? d A 304 ? 1_555 110.1 ? 50 OD1 ? B ASP 47 ? B ASP 52 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 OP1 ? F U 1 ? D U 318 ? 1_555 70.5 ? 51 OD2 ? B ASP 121 ? B ASP 126 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 OP1 ? F U 1 ? D U 318 ? 1_555 69.7 ? 52 O ? Y HOH . ? B HOH 401 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 OP1 ? F U 1 ? D U 318 ? 1_555 82.5 ? 53 "O3'" ? E A 11 ? d A 304 ? 1_555 MG ? T MG . ? B MG 304 ? 1_555 OP1 ? F U 1 ? D U 318 ? 1_555 76.6 ? 54 OP3 ? D U 1 ? C U 318 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 OP2 ? D A 2 ? C A 319 ? 1_555 92.6 ? 55 OP3 ? D U 1 ? C U 318 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 501 ? 1_555 85.2 ? 56 OP2 ? D A 2 ? C A 319 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 501 ? 1_555 88.3 ? 57 OP3 ? D U 1 ? C U 318 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 502 ? 1_555 154.8 ? 58 OP2 ? D A 2 ? C A 319 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 502 ? 1_555 92.2 ? 59 O ? AA HOH . ? C HOH 501 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 502 ? 1_555 70.3 ? 60 OP3 ? D U 1 ? C U 318 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 503 ? 1_555 98.3 ? 61 OP2 ? D A 2 ? C A 319 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 503 ? 1_555 148.2 ? 62 O ? AA HOH . ? C HOH 501 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 503 ? 1_555 122.3 ? 63 O ? AA HOH . ? C HOH 502 ? 1_555 MG ? U MG . ? C MG 401 ? 1_555 O ? AA HOH . ? C HOH 503 ? 1_555 90.4 ? 64 OP3 ? F U 1 ? D U 318 ? 1_555 MG ? V MG . ? D MG 401 ? 1_555 OP2 ? F A 2 ? D A 319 ? 1_555 86.9 ? 65 OP3 ? F U 1 ? D U 318 ? 1_555 MG ? V MG . ? D MG 401 ? 1_555 O ? BA HOH . ? D HOH 501 ? 1_555 76.0 ? 66 OP2 ? F A 2 ? D A 319 ? 1_555 MG ? V MG . ? D MG 401 ? 1_555 O ? BA HOH . ? D HOH 501 ? 1_555 100.2 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 67 A . ? TYR 72 A PRO 68 A ? PRO 73 A 1 6.15 2 TYR 67 B . ? TYR 72 B PRO 68 B ? PRO 73 B 1 6.44 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 72 ? GLY A 81 ? VAL A 77 GLY A 86 AA1 2 ARG A 57 ? SER A 66 ? ARG A 62 SER A 71 AA1 3 LYS A 42 ? PHE A 50 ? LYS A 47 PHE A 55 AA1 4 VAL A 117 ? ASP A 121 ? VAL A 122 ASP A 126 AA1 5 CYS A 145 ? ALA A 149 ? CYS A 150 ALA A 154 AA1 6 LEU A 202 ? HIS A 208 ? LEU A 207 HIS A 213 AA1 7 VAL A 187 ? LEU A 192 ? VAL A 192 LEU A 197 AA1 8 THR A 177 ? ILE A 181 ? THR A 182 ILE A 186 AA2 1 VAL B 72 ? GLY B 81 ? VAL B 77 GLY B 86 AA2 2 ARG B 57 ? SER B 66 ? ARG B 62 SER B 71 AA2 3 LYS B 42 ? PHE B 50 ? LYS B 47 PHE B 55 AA2 4 VAL B 117 ? ASP B 121 ? VAL B 122 ASP B 126 AA2 5 CYS B 145 ? ALA B 149 ? CYS B 150 ALA B 154 AA2 6 LEU B 202 ? HIS B 208 ? LEU B 207 HIS B 213 AA2 7 VAL B 187 ? LEU B 192 ? VAL B 192 LEU B 197 AA2 8 THR B 177 ? ILE B 181 ? THR B 182 ILE B 186 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 78 ? O ARG A 83 N ALA A 60 ? N ALA A 65 AA1 2 3 O LEU A 65 ? O LEU A 70 N VAL A 43 ? N VAL A 48 AA1 3 4 N GLY A 44 ? N GLY A 49 O VAL A 117 ? O VAL A 122 AA1 4 5 N VAL A 120 ? N VAL A 125 O ILE A 146 ? O ILE A 151 AA1 5 6 N ALA A 149 ? N ALA A 154 O TYR A 203 ? O TYR A 208 AA1 6 7 O LEU A 202 ? O LEU A 207 N LEU A 192 ? N LEU A 197 AA1 7 8 O GLY A 189 ? O GLY A 194 N LEU A 180 ? N LEU A 185 AA2 1 2 O ARG B 78 ? O ARG B 83 N ALA B 60 ? N ALA B 65 AA2 2 3 O LEU B 65 ? O LEU B 70 N VAL B 43 ? N VAL B 48 AA2 3 4 N GLY B 44 ? N GLY B 49 O VAL B 117 ? O VAL B 122 AA2 4 5 N VAL B 120 ? N VAL B 125 O ILE B 146 ? O ILE B 151 AA2 5 6 N GLY B 147 ? N GLY B 152 O SER B 205 ? O SER B 210 AA2 6 7 O VAL B 204 ? O VAL B 209 N MET B 190 ? N MET B 195 AA2 7 8 O GLY B 189 ? O GLY B 194 N LEU B 180 ? N LEU B 185 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 301 ? 7 'binding site for residue MG A 301' AC2 Software A PGE 302 ? 6 'binding site for residue PGE A 302' AC3 Software A P6G 303 ? 5 'binding site for residue P6G A 303' AC4 Software A P6G 304 ? 1 'binding site for residue P6G A 304' AC5 Software A GOL 305 ? 2 'binding site for residue GOL A 305' AC6 Software A GOL 306 ? 4 'binding site for residue GOL A 306' AC7 Software A NA 307 ? 4 'binding site for residue NA A 307' AC8 Software A EDO 308 ? 1 'binding site for residue EDO A 308' AC9 Software A PG4 309 ? 8 'binding site for residue PG4 A 309' AD1 Software A MG 310 ? 7 'binding site for residue MG A 310' AD2 Software B MG 301 ? 4 'binding site for residue MG B 301' AD3 Software B PGE 302 ? 2 'binding site for residue PGE B 302' AD4 Software B NA 303 ? 2 'binding site for residue NA B 303' AD5 Software B MG 304 ? 5 'binding site for residue MG B 304' AD6 Software C MG 401 ? 7 'binding site for residue MG C 401' AD7 Software D MG 401 ? 3 'binding site for residue MG D 401' AD8 Software D EDO 402 ? 2 'binding site for residue EDO D 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 47 ? ASP A 52 . ? 1_555 ? 2 AC1 7 ASP A 235 ? ASP A 240 . ? 1_555 ? 3 AC1 7 MG P . ? MG A 310 . ? 1_555 ? 4 AC1 7 HOH X . ? HOH A 411 . ? 1_555 ? 5 AC1 7 HOH X . ? HOH A 414 . ? 1_555 ? 6 AC1 7 U D 1 ? U C 318 . ? 1_555 ? 7 AC1 7 MG U . ? MG C 401 . ? 1_555 ? 8 AC2 6 ASP A 27 ? ASP A 32 . ? 1_555 ? 9 AC2 6 ALA A 30 ? ALA A 35 . ? 1_555 ? 10 AC2 6 ARG A 33 ? ARG A 38 . ? 1_555 ? 11 AC2 6 HOH X . ? HOH A 421 . ? 1_555 ? 12 AC2 6 LEU B 140 ? LEU B 145 . ? 2_555 ? 13 AC2 6 THR B 141 ? THR B 146 . ? 2_555 ? 14 AC3 5 GLN A 41 ? GLN A 46 . ? 1_555 ? 15 AC3 5 LYS A 42 ? LYS A 47 . ? 1_555 ? 16 AC3 5 GLN B 41 ? GLN B 46 . ? 2_555 ? 17 AC3 5 LYS B 42 ? LYS B 47 . ? 2_555 ? 18 AC3 5 ASP B 112 ? ASP B 117 . ? 2_555 ? 19 AC4 1 LYS A 20 ? LYS A 25 . ? 1_555 ? 20 AC5 2 HIS A 220 ? HIS A 225 . ? 1_555 ? 21 AC5 2 CYS A 223 ? CYS A 228 . ? 1_555 ? 22 AC6 4 TYR A 74 ? TYR A 79 . ? 1_555 ? 23 AC6 4 GLU A 75 ? GLU A 80 . ? 1_555 ? 24 AC6 4 ASP A 76 ? ASP A 81 . ? 1_555 ? 25 AC6 4 LYS A 109 ? LYS A 114 . ? 1_555 ? 26 AC7 4 LEU A 40 ? LEU A 45 . ? 1_555 ? 27 AC7 4 GLN A 41 ? GLN A 46 . ? 1_555 ? 28 AC7 4 TYR A 67 ? TYR A 72 . ? 1_555 ? 29 AC7 4 HOH X . ? HOH A 424 . ? 1_555 ? 30 AC8 1 VAL A 72 ? VAL A 77 . ? 1_555 ? 31 AC9 8 ARG A 22 ? ARG A 27 . ? 3_645 ? 32 AC9 8 LEU A 140 ? LEU A 145 . ? 3_645 ? 33 AC9 8 THR A 141 ? THR A 146 . ? 3_645 ? 34 AC9 8 GLU A 166 ? GLU A 171 . ? 1_555 ? 35 AC9 8 HOH X . ? HOH A 406 . ? 1_555 ? 36 AC9 8 ASP B 27 ? ASP B 32 . ? 4_545 ? 37 AC9 8 ALA B 30 ? ALA B 35 . ? 4_545 ? 38 AC9 8 ARG B 33 ? ARG B 38 . ? 4_545 ? 39 AD1 7 ASP A 47 ? ASP A 52 . ? 1_555 ? 40 AD1 7 ASP A 121 ? ASP A 126 . ? 1_555 ? 41 AD1 7 MG G . ? MG A 301 . ? 1_555 ? 42 AD1 7 HOH X . ? HOH A 402 . ? 1_555 ? 43 AD1 7 U D 1 ? U C 318 . ? 1_555 ? 44 AD1 7 A C 11 ? A c 304 . ? 1_555 ? 45 AD1 7 HOH Z . ? HOH c 402 . ? 1_555 ? 46 AD2 4 ASP B 47 ? ASP B 52 . ? 1_555 ? 47 AD2 4 ASP B 235 ? ASP B 240 . ? 1_555 ? 48 AD2 4 HOH Y . ? HOH B 404 . ? 1_555 ? 49 AD2 4 U F 1 ? U D 318 . ? 1_555 ? 50 AD3 2 HIS B 221 ? HIS B 226 . ? 1_555 ? 51 AD3 2 CYS B 223 ? CYS B 228 . ? 1_555 ? 52 AD4 2 GLN B 41 ? GLN B 46 . ? 1_555 ? 53 AD4 2 TYR B 67 ? TYR B 72 . ? 1_555 ? 54 AD5 5 ASP B 47 ? ASP B 52 . ? 1_555 ? 55 AD5 5 ASP B 121 ? ASP B 126 . ? 1_555 ? 56 AD5 5 HOH Y . ? HOH B 401 . ? 1_555 ? 57 AD5 5 U F 1 ? U D 318 . ? 1_555 ? 58 AD5 5 A E 11 ? A d 304 . ? 1_555 ? 59 AD6 7 ASP A 235 ? ASP A 240 . ? 1_555 ? 60 AD6 7 MG G . ? MG A 301 . ? 1_555 ? 61 AD6 7 U D 1 ? U C 318 . ? 1_555 ? 62 AD6 7 A D 2 ? A C 319 . ? 1_555 ? 63 AD6 7 HOH AA . ? HOH C 501 . ? 1_555 ? 64 AD6 7 HOH AA . ? HOH C 502 . ? 1_555 ? 65 AD6 7 HOH AA . ? HOH C 503 . ? 1_555 ? 66 AD7 3 U F 1 ? U D 318 . ? 1_555 ? 67 AD7 3 A F 2 ? A D 319 . ? 1_555 ? 68 AD7 3 HOH BA . ? HOH D 501 . ? 1_555 ? 69 AD8 2 U F 7 ? U D 324 . ? 1_555 ? 70 AD8 2 G F 8 ? G D 325 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 "C4'" c DI 303 ? ? "C3'" c DI 303 ? ? 1.312 1.524 -0.212 0.020 N 2 1 "O4'" c DI 303 ? ? "C4'" c DI 303 ? ? 1.633 1.410 0.223 0.020 N 3 1 N3 c DI 303 ? ? C4 c DI 303 ? ? 1.487 1.355 0.132 0.020 N 4 1 C5 c DI 303 ? ? C6 c DI 303 ? ? 1.538 1.390 0.148 0.020 N 5 1 P C U 318 ? ? OP3 C U 318 ? ? 1.480 1.607 -0.127 0.012 N 6 1 "C4'" d DI 303 ? ? "C3'" d DI 303 ? ? 1.307 1.524 -0.217 0.020 N 7 1 "O4'" d DI 303 ? ? "C4'" d DI 303 ? ? 1.622 1.410 0.212 0.020 N 8 1 N3 d DI 303 ? ? C4 d DI 303 ? ? 1.486 1.355 0.131 0.020 N 9 1 C5 d DI 303 ? ? C6 d DI 303 ? ? 1.533 1.390 0.143 0.020 N 10 1 P D U 318 ? ? OP3 D U 318 ? ? 1.471 1.607 -0.136 0.012 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 30 ? ? -106.94 45.91 2 1 GLU A 147 ? ? 58.91 14.35 3 1 LEU A 251 ? ? -37.87 140.05 4 1 ASP B 30 ? ? -106.47 44.26 5 1 PHE B 136 ? ? -150.73 76.59 6 1 PHE B 230 ? ? -123.07 -168.22 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 35.4764 1.7001 44.7803 0.3074 ? 0.1116 ? -0.0012 ? 0.2865 ? -0.1356 ? 0.3199 ? 9.6313 ? 6.5301 ? -4.9945 ? 7.9820 ? -4.5678 ? 6.5430 ? -0.2735 ? -0.6061 ? -0.5127 ? -0.1273 ? -0.3491 ? -0.6992 ? 0.5573 ? 0.3446 ? 0.6281 ? 2 'X-RAY DIFFRACTION' ? refined 25.6988 6.9700 40.9176 0.3196 ? 0.0002 ? -0.0340 ? 0.3710 ? -0.0149 ? 0.3642 ? 4.8047 ? 0.0758 ? -1.8570 ? 3.2249 ? -0.0900 ? 4.5675 ? -0.0559 ? 0.2152 ? 0.3889 ? -0.2509 ? 0.0715 ? 0.2733 ? -0.2226 ? -0.3467 ? -0.0210 ? 3 'X-RAY DIFFRACTION' ? refined 29.9316 -11.3818 34.0808 0.4274 ? -0.0425 ? -0.0114 ? 0.3139 ? 0.0035 ? 0.3793 ? 2.1978 ? -0.7370 ? -0.2948 ? 4.5002 ? 0.7065 ? 5.4184 ? 0.0280 ? 0.2367 ? -0.1671 ? -0.3563 ? 0.0692 ? 0.0793 ? 0.2612 ? -0.1649 ? -0.1114 ? 4 'X-RAY DIFFRACTION' ? refined 15.4218 8.1851 31.3890 0.6047 ? -0.0461 ? -0.1125 ? 0.6152 ? 0.0068 ? 0.6279 ? 3.1030 ? -0.4718 ? 0.3567 ? 4.9079 ? -4.9445 ? 4.9188 ? -0.3233 ? 0.0107 ? 0.5558 ? -1.0538 ? 0.3977 ? 0.7279 ? 0.0165 ? -0.9324 ? -0.1433 ? 5 'X-RAY DIFFRACTION' ? refined -8.9746 12.9421 -4.9748 1.1566 ? 0.4100 ? -0.1648 ? 0.9478 ? -0.0848 ? 0.9264 ? 7.8021 ? 1.8563 ? 1.2322 ? 6.3037 ? 1.6929 ? 8.7392 ? -0.1442 ? -0.4823 ? 1.3080 ? -0.0586 ? -0.2699 ? 0.7612 ? -2.2294 ? -1.3477 ? 0.4319 ? 6 'X-RAY DIFFRACTION' ? refined 8.7908 4.8077 -6.9257 0.7796 ? 0.0610 ? -0.0588 ? 0.4262 ? 0.0463 ? 0.3868 ? 3.9751 ? -0.5441 ? 0.3966 ? 3.2919 ? 0.2950 ? 7.4640 ? -0.2929 ? -0.2427 ? 0.4402 ? 0.8399 ? 0.1511 ? 0.0730 ? -1.0203 ? -0.1929 ? 0.0944 ? 7 'X-RAY DIFFRACTION' ? refined 2.8922 -10.7242 1.1478 0.7869 ? -0.0463 ? 0.0348 ? 0.6356 ? 0.0219 ? 0.4933 ? 3.5701 ? 0.2637 ? -0.5481 ? 6.9754 ? -2.4455 ? 5.0576 ? 0.1402 ? -0.7405 ? -0.3226 ? 0.9143 ? 0.2329 ? 0.5518 ? 0.8096 ? -0.4907 ? -0.3601 ? 8 'X-RAY DIFFRACTION' ? refined 18.5044 7.2865 4.7440 1.5026 ? -0.0820 ? -0.2674 ? 0.7918 ? 0.0342 ? 0.5803 ? 5.8857 ? 1.4057 ? 0.6196 ? 3.4439 ? 5.2299 ? 8.3720 ? -0.4480 ? -0.2249 ? 0.9561 ? 1.3451 ? 0.0200 ? -0.3662 ? -1.1143 ? 0.7703 ? 0.4162 ? 9 'X-RAY DIFFRACTION' ? refined 38.0520 0.9967 27.5931 0.8470 ? -0.1311 ? 0.4152 ? 0.9305 ? -0.1596 ? 1.2157 ? 8.8009 ? 4.0016 ? -2.8848 ? 2.0470 ? -2.0627 ? 3.6114 ? -1.1114 ? 0.8360 ? -0.0988 ? -2.4761 ? 1.2635 ? -3.0652 ? 1.2513 ? 1.7355 ? 0.1359 ? 10 'X-RAY DIFFRACTION' ? refined 14.4667 0.0647 17.4443 0.7231 ? 0.1089 ? -0.2049 ? 0.8865 ? -0.0329 ? 0.7001 ? 0.3025 ? 0.5168 ? 0.2422 ? 4.4551 ? -0.4547 ? 6.5162 ? -0.8680 ? -0.1571 ? 0.8844 ? -0.4828 ? 0.0672 ? 0.9200 ? -1.2710 ? -0.6444 ? 0.6768 ? 11 'X-RAY DIFFRACTION' ? refined -4.6507 2.3184 7.3301 1.7743 ? 0.4004 ? 0.6381 ? 1.4137 ? -0.0484 ? 1.2926 ? 2.8920 ? -2.1534 ? 1.8516 ? 3.0215 ? 0.9310 ? 4.9932 ? -0.2991 ? -0.7051 ? 0.1075 ? 2.8106 ? -0.2403 ? 2.5646 ? 2.4454 ? -1.1662 ? 0.7975 ? 12 'X-RAY DIFFRACTION' ? refined 18.7179 -0.1000 18.4295 0.7070 ? -0.0513 ? -0.1514 ? 0.6521 ? -0.0164 ? 0.4558 ? 3.1403 ? -0.6419 ? -3.0987 ? 6.3879 ? 1.6347 ? 8.9234 ? 0.2329 ? 0.1491 ? 0.2894 ? -0.6254 ? -0.2253 ? -0.0993 ? -1.5848 ? 0.2986 ? -0.0220 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 6 ? ? A 46 ? ;chain 'A' and (resid 6 through 46 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 47 ? ? A 154 ? ;chain 'A' and (resid 47 through 154 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 155 ? ? A 233 ? ;chain 'A' and (resid 155 through 233 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 234 ? ? A 251 ? ;chain 'A' and (resid 234 through 251 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 8 ? ? B 27 ? ;chain 'B' and (resid 8 through 27 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 28 ? ? B 154 ? ;chain 'B' and (resid 28 through 154 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 155 ? ? B 233 ? ;chain 'B' and (resid 155 through 233 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 234 ? ? B 251 ? ;chain 'B' and (resid 234 through 251 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? C 12 ? ? C 23 ? ;chain 'C' and (resid 12 through 23 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? D 12 ? ? D 23 ? ;chain 'D' and (resid 12 through 23 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 58 ? A GLY 53 2 1 Y 1 A ASP 59 ? A ASP 54 3 1 Y 1 A SER 60 ? A SER 55 4 1 Y 1 B ALA 6 ? B ALA 1 5 1 Y 1 B GLU 7 ? B GLU 2 6 1 Y 1 B GLY 252 ? B GLY 247 7 1 Y 1 c C 294 ? C C 1 8 1 Y 1 c G 295 ? C G 2 9 1 Y 1 c G 296 ? C G 3 10 1 Y 1 c U 297 ? C U 4 11 1 Y 1 c A 298 ? C A 5 12 1 Y 1 c A 299 ? C A 6 13 1 Y 1 c C 300 ? C C 7 14 1 Y 1 d C 294 ? E C 1 15 1 Y 1 d G 295 ? E G 2 16 1 Y 1 d G 296 ? E G 3 17 1 Y 1 d U 297 ? E U 4 18 1 Y 1 d A 298 ? E A 5 19 1 Y 1 d A 299 ? E A 6 20 1 Y 1 d C 300 ? E C 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 C OP3 O N N 111 C P P N N 112 C OP1 O N N 113 C OP2 O N N 114 C "O5'" O N N 115 C "C5'" C N N 116 C "C4'" C N R 117 C "O4'" O N N 118 C "C3'" C N S 119 C "O3'" O N N 120 C "C2'" C N R 121 C "O2'" O N N 122 C "C1'" C N R 123 C N1 N N N 124 C C2 C N N 125 C O2 O N N 126 C N3 N N N 127 C C4 C N N 128 C N4 N N N 129 C C5 C N N 130 C C6 C N N 131 C HOP3 H N N 132 C HOP2 H N N 133 C "H5'" H N N 134 C "H5''" H N N 135 C "H4'" H N N 136 C "H3'" H N N 137 C "HO3'" H N N 138 C "H2'" H N N 139 C "HO2'" H N N 140 C "H1'" H N N 141 C H41 H N N 142 C H42 H N N 143 C H5 H N N 144 C H6 H N N 145 CYS N N N N 146 CYS CA C N R 147 CYS C C N N 148 CYS O O N N 149 CYS CB C N N 150 CYS SG S N N 151 CYS OXT O N N 152 CYS H H N N 153 CYS H2 H N N 154 CYS HA H N N 155 CYS HB2 H N N 156 CYS HB3 H N N 157 CYS HG H N N 158 CYS HXT H N N 159 DI OP3 O N N 160 DI P P N N 161 DI OP1 O N N 162 DI OP2 O N N 163 DI "O5'" O N N 164 DI "C5'" C N N 165 DI "C4'" C N R 166 DI "O4'" O N N 167 DI "C3'" C N S 168 DI "O3'" O N N 169 DI "C2'" C N N 170 DI "C1'" C N R 171 DI N9 N Y N 172 DI C8 C Y N 173 DI N7 N Y N 174 DI C5 C Y N 175 DI C6 C N N 176 DI O6 O N N 177 DI N1 N N N 178 DI C2 C N N 179 DI N3 N N N 180 DI C4 C Y N 181 DI HOP3 H N N 182 DI HOP2 H N N 183 DI "H5'" H N N 184 DI "H5''" H N N 185 DI "H4'" H N N 186 DI "H3'" H N N 187 DI "HO3'" H N N 188 DI "H2'" H N N 189 DI "H2''" H N N 190 DI "H1'" H N N 191 DI H8 H N N 192 DI H1 H N N 193 DI H2 H N N 194 EDO C1 C N N 195 EDO O1 O N N 196 EDO C2 C N N 197 EDO O2 O N N 198 EDO H11 H N N 199 EDO H12 H N N 200 EDO HO1 H N N 201 EDO H21 H N N 202 EDO H22 H N N 203 EDO HO2 H N N 204 G OP3 O N N 205 G P P N N 206 G OP1 O N N 207 G OP2 O N N 208 G "O5'" O N N 209 G "C5'" C N N 210 G "C4'" C N R 211 G "O4'" O N N 212 G "C3'" C N S 213 G "O3'" O N N 214 G "C2'" C N R 215 G "O2'" O N N 216 G "C1'" C N R 217 G N9 N Y N 218 G C8 C Y N 219 G N7 N Y N 220 G C5 C Y N 221 G C6 C N N 222 G O6 O N N 223 G N1 N N N 224 G C2 C N N 225 G N2 N N N 226 G N3 N N N 227 G C4 C Y N 228 G HOP3 H N N 229 G HOP2 H N N 230 G "H5'" H N N 231 G "H5''" H N N 232 G "H4'" H N N 233 G "H3'" H N N 234 G "HO3'" H N N 235 G "H2'" H N N 236 G "HO2'" H N N 237 G "H1'" H N N 238 G H8 H N N 239 G H1 H N N 240 G H21 H N N 241 G H22 H N N 242 GLN N N N N 243 GLN CA C N S 244 GLN C C N N 245 GLN O O N N 246 GLN CB C N N 247 GLN CG C N N 248 GLN CD C N N 249 GLN OE1 O N N 250 GLN NE2 N N N 251 GLN OXT O N N 252 GLN H H N N 253 GLN H2 H N N 254 GLN HA H N N 255 GLN HB2 H N N 256 GLN HB3 H N N 257 GLN HG2 H N N 258 GLN HG3 H N N 259 GLN HE21 H N N 260 GLN HE22 H N N 261 GLN HXT H N N 262 GLU N N N N 263 GLU CA C N S 264 GLU C C N N 265 GLU O O N N 266 GLU CB C N N 267 GLU CG C N N 268 GLU CD C N N 269 GLU OE1 O N N 270 GLU OE2 O N N 271 GLU OXT O N N 272 GLU H H N N 273 GLU H2 H N N 274 GLU HA H N N 275 GLU HB2 H N N 276 GLU HB3 H N N 277 GLU HG2 H N N 278 GLU HG3 H N N 279 GLU HE2 H N N 280 GLU HXT H N N 281 GLY N N N N 282 GLY CA C N N 283 GLY C C N N 284 GLY O O N N 285 GLY OXT O N N 286 GLY H H N N 287 GLY H2 H N N 288 GLY HA2 H N N 289 GLY HA3 H N N 290 GLY HXT H N N 291 GOL C1 C N N 292 GOL O1 O N N 293 GOL C2 C N N 294 GOL O2 O N N 295 GOL C3 C N N 296 GOL O3 O N N 297 GOL H11 H N N 298 GOL H12 H N N 299 GOL HO1 H N N 300 GOL H2 H N N 301 GOL HO2 H N N 302 GOL H31 H N N 303 GOL H32 H N N 304 GOL HO3 H N N 305 HIS N N N N 306 HIS CA C N S 307 HIS C C N N 308 HIS O O N N 309 HIS CB C N N 310 HIS CG C Y N 311 HIS ND1 N Y N 312 HIS CD2 C Y N 313 HIS CE1 C Y N 314 HIS NE2 N Y N 315 HIS OXT O N N 316 HIS H H N N 317 HIS H2 H N N 318 HIS HA H N N 319 HIS HB2 H N N 320 HIS HB3 H N N 321 HIS HD1 H N N 322 HIS HD2 H N N 323 HIS HE1 H N N 324 HIS HE2 H N N 325 HIS HXT H N N 326 HOH O O N N 327 HOH H1 H N N 328 HOH H2 H N N 329 ILE N N N N 330 ILE CA C N S 331 ILE C C N N 332 ILE O O N N 333 ILE CB C N S 334 ILE CG1 C N N 335 ILE CG2 C N N 336 ILE CD1 C N N 337 ILE OXT O N N 338 ILE H H N N 339 ILE H2 H N N 340 ILE HA H N N 341 ILE HB H N N 342 ILE HG12 H N N 343 ILE HG13 H N N 344 ILE HG21 H N N 345 ILE HG22 H N N 346 ILE HG23 H N N 347 ILE HD11 H N N 348 ILE HD12 H N N 349 ILE HD13 H N N 350 ILE HXT H N N 351 LEU N N N N 352 LEU CA C N S 353 LEU C C N N 354 LEU O O N N 355 LEU CB C N N 356 LEU CG C N N 357 LEU CD1 C N N 358 LEU CD2 C N N 359 LEU OXT O N N 360 LEU H H N N 361 LEU H2 H N N 362 LEU HA H N N 363 LEU HB2 H N N 364 LEU HB3 H N N 365 LEU HG H N N 366 LEU HD11 H N N 367 LEU HD12 H N N 368 LEU HD13 H N N 369 LEU HD21 H N N 370 LEU HD22 H N N 371 LEU HD23 H N N 372 LEU HXT H N N 373 LYS N N N N 374 LYS CA C N S 375 LYS C C N N 376 LYS O O N N 377 LYS CB C N N 378 LYS CG C N N 379 LYS CD C N N 380 LYS CE C N N 381 LYS NZ N N N 382 LYS OXT O N N 383 LYS H H N N 384 LYS H2 H N N 385 LYS HA H N N 386 LYS HB2 H N N 387 LYS HB3 H N N 388 LYS HG2 H N N 389 LYS HG3 H N N 390 LYS HD2 H N N 391 LYS HD3 H N N 392 LYS HE2 H N N 393 LYS HE3 H N N 394 LYS HZ1 H N N 395 LYS HZ2 H N N 396 LYS HZ3 H N N 397 LYS HXT H N N 398 MET N N N N 399 MET CA C N S 400 MET C C N N 401 MET O O N N 402 MET CB C N N 403 MET CG C N N 404 MET SD S N N 405 MET CE C N N 406 MET OXT O N N 407 MET H H N N 408 MET H2 H N N 409 MET HA H N N 410 MET HB2 H N N 411 MET HB3 H N N 412 MET HG2 H N N 413 MET HG3 H N N 414 MET HE1 H N N 415 MET HE2 H N N 416 MET HE3 H N N 417 MET HXT H N N 418 MG MG MG N N 419 NA NA NA N N 420 P6G O1 O N N 421 P6G C2 C N N 422 P6G C3 C N N 423 P6G O4 O N N 424 P6G C5 C N N 425 P6G C6 C N N 426 P6G O7 O N N 427 P6G C8 C N N 428 P6G C9 C N N 429 P6G O10 O N N 430 P6G C11 C N N 431 P6G C12 C N N 432 P6G O13 O N N 433 P6G C14 C N N 434 P6G C15 C N N 435 P6G O16 O N N 436 P6G C17 C N N 437 P6G C18 C N N 438 P6G O19 O N N 439 P6G H1 H N N 440 P6G H21 H N N 441 P6G H22 H N N 442 P6G H31 H N N 443 P6G H32 H N N 444 P6G H51 H N N 445 P6G H52 H N N 446 P6G H61 H N N 447 P6G H62 H N N 448 P6G H81 H N N 449 P6G H82 H N N 450 P6G H91 H N N 451 P6G H92 H N N 452 P6G H111 H N N 453 P6G H112 H N N 454 P6G H121 H N N 455 P6G H122 H N N 456 P6G H141 H N N 457 P6G H142 H N N 458 P6G H151 H N N 459 P6G H152 H N N 460 P6G H171 H N N 461 P6G H172 H N N 462 P6G H181 H N N 463 P6G H182 H N N 464 P6G H19 H N N 465 PG4 O1 O N N 466 PG4 C1 C N N 467 PG4 C2 C N N 468 PG4 O2 O N N 469 PG4 C3 C N N 470 PG4 C4 C N N 471 PG4 O3 O N N 472 PG4 C5 C N N 473 PG4 C6 C N N 474 PG4 O4 O N N 475 PG4 C7 C N N 476 PG4 C8 C N N 477 PG4 O5 O N N 478 PG4 HO1 H N N 479 PG4 H11 H N N 480 PG4 H12 H N N 481 PG4 H21 H N N 482 PG4 H22 H N N 483 PG4 H31 H N N 484 PG4 H32 H N N 485 PG4 H41 H N N 486 PG4 H42 H N N 487 PG4 H51 H N N 488 PG4 H52 H N N 489 PG4 H61 H N N 490 PG4 H62 H N N 491 PG4 H71 H N N 492 PG4 H72 H N N 493 PG4 H81 H N N 494 PG4 H82 H N N 495 PG4 HO5 H N N 496 PGE C1 C N N 497 PGE O1 O N N 498 PGE C2 C N N 499 PGE O2 O N N 500 PGE C3 C N N 501 PGE C4 C N N 502 PGE O4 O N N 503 PGE C6 C N N 504 PGE C5 C N N 505 PGE O3 O N N 506 PGE H1 H N N 507 PGE H12 H N N 508 PGE HO1 H N N 509 PGE H2 H N N 510 PGE H22 H N N 511 PGE H3 H N N 512 PGE H32 H N N 513 PGE H4 H N N 514 PGE H42 H N N 515 PGE HO4 H N N 516 PGE H6 H N N 517 PGE H62 H N N 518 PGE H5 H N N 519 PGE H52 H N N 520 PHE N N N N 521 PHE CA C N S 522 PHE C C N N 523 PHE O O N N 524 PHE CB C N N 525 PHE CG C Y N 526 PHE CD1 C Y N 527 PHE CD2 C Y N 528 PHE CE1 C Y N 529 PHE CE2 C Y N 530 PHE CZ C Y N 531 PHE OXT O N N 532 PHE H H N N 533 PHE H2 H N N 534 PHE HA H N N 535 PHE HB2 H N N 536 PHE HB3 H N N 537 PHE HD1 H N N 538 PHE HD2 H N N 539 PHE HE1 H N N 540 PHE HE2 H N N 541 PHE HZ H N N 542 PHE HXT H N N 543 PRO N N N N 544 PRO CA C N S 545 PRO C C N N 546 PRO O O N N 547 PRO CB C N N 548 PRO CG C N N 549 PRO CD C N N 550 PRO OXT O N N 551 PRO H H N N 552 PRO HA H N N 553 PRO HB2 H N N 554 PRO HB3 H N N 555 PRO HG2 H N N 556 PRO HG3 H N N 557 PRO HD2 H N N 558 PRO HD3 H N N 559 PRO HXT H N N 560 SER N N N N 561 SER CA C N S 562 SER C C N N 563 SER O O N N 564 SER CB C N N 565 SER OG O N N 566 SER OXT O N N 567 SER H H N N 568 SER H2 H N N 569 SER HA H N N 570 SER HB2 H N N 571 SER HB3 H N N 572 SER HG H N N 573 SER HXT H N N 574 THR N N N N 575 THR CA C N S 576 THR C C N N 577 THR O O N N 578 THR CB C N R 579 THR OG1 O N N 580 THR CG2 C N N 581 THR OXT O N N 582 THR H H N N 583 THR H2 H N N 584 THR HA H N N 585 THR HB H N N 586 THR HG1 H N N 587 THR HG21 H N N 588 THR HG22 H N N 589 THR HG23 H N N 590 THR HXT H N N 591 TRP N N N N 592 TRP CA C N S 593 TRP C C N N 594 TRP O O N N 595 TRP CB C N N 596 TRP CG C Y N 597 TRP CD1 C Y N 598 TRP CD2 C Y N 599 TRP NE1 N Y N 600 TRP CE2 C Y N 601 TRP CE3 C Y N 602 TRP CZ2 C Y N 603 TRP CZ3 C Y N 604 TRP CH2 C Y N 605 TRP OXT O N N 606 TRP H H N N 607 TRP H2 H N N 608 TRP HA H N N 609 TRP HB2 H N N 610 TRP HB3 H N N 611 TRP HD1 H N N 612 TRP HE1 H N N 613 TRP HE3 H N N 614 TRP HZ2 H N N 615 TRP HZ3 H N N 616 TRP HH2 H N N 617 TRP HXT H N N 618 TYR N N N N 619 TYR CA C N S 620 TYR C C N N 621 TYR O O N N 622 TYR CB C N N 623 TYR CG C Y N 624 TYR CD1 C Y N 625 TYR CD2 C Y N 626 TYR CE1 C Y N 627 TYR CE2 C Y N 628 TYR CZ C Y N 629 TYR OH O N N 630 TYR OXT O N N 631 TYR H H N N 632 TYR H2 H N N 633 TYR HA H N N 634 TYR HB2 H N N 635 TYR HB3 H N N 636 TYR HD1 H N N 637 TYR HD2 H N N 638 TYR HE1 H N N 639 TYR HE2 H N N 640 TYR HH H N N 641 TYR HXT H N N 642 U OP3 O N N 643 U P P N N 644 U OP1 O N N 645 U OP2 O N N 646 U "O5'" O N N 647 U "C5'" C N N 648 U "C4'" C N R 649 U "O4'" O N N 650 U "C3'" C N S 651 U "O3'" O N N 652 U "C2'" C N R 653 U "O2'" O N N 654 U "C1'" C N R 655 U N1 N N N 656 U C2 C N N 657 U O2 O N N 658 U N3 N N N 659 U C4 C N N 660 U O4 O N N 661 U C5 C N N 662 U C6 C N N 663 U HOP3 H N N 664 U HOP2 H N N 665 U "H5'" H N N 666 U "H5''" H N N 667 U "H4'" H N N 668 U "H3'" H N N 669 U "HO3'" H N N 670 U "H2'" H N N 671 U "HO2'" H N N 672 U "H1'" H N N 673 U H3 H N N 674 U H5 H N N 675 U H6 H N N 676 VAL N N N N 677 VAL CA C N S 678 VAL C C N N 679 VAL O O N N 680 VAL CB C N N 681 VAL CG1 C N N 682 VAL CG2 C N N 683 VAL OXT O N N 684 VAL H H N N 685 VAL H2 H N N 686 VAL HA H N N 687 VAL HB H N N 688 VAL HG11 H N N 689 VAL HG12 H N N 690 VAL HG13 H N N 691 VAL HG21 H N N 692 VAL HG22 H N N 693 VAL HG23 H N N 694 VAL HXT H N N 695 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 C OP3 P sing N N 109 C OP3 HOP3 sing N N 110 C P OP1 doub N N 111 C P OP2 sing N N 112 C P "O5'" sing N N 113 C OP2 HOP2 sing N N 114 C "O5'" "C5'" sing N N 115 C "C5'" "C4'" sing N N 116 C "C5'" "H5'" sing N N 117 C "C5'" "H5''" sing N N 118 C "C4'" "O4'" sing N N 119 C "C4'" "C3'" sing N N 120 C "C4'" "H4'" sing N N 121 C "O4'" "C1'" sing N N 122 C "C3'" "O3'" sing N N 123 C "C3'" "C2'" sing N N 124 C "C3'" "H3'" sing N N 125 C "O3'" "HO3'" sing N N 126 C "C2'" "O2'" sing N N 127 C "C2'" "C1'" sing N N 128 C "C2'" "H2'" sing N N 129 C "O2'" "HO2'" sing N N 130 C "C1'" N1 sing N N 131 C "C1'" "H1'" sing N N 132 C N1 C2 sing N N 133 C N1 C6 sing N N 134 C C2 O2 doub N N 135 C C2 N3 sing N N 136 C N3 C4 doub N N 137 C C4 N4 sing N N 138 C C4 C5 sing N N 139 C N4 H41 sing N N 140 C N4 H42 sing N N 141 C C5 C6 doub N N 142 C C5 H5 sing N N 143 C C6 H6 sing N N 144 CYS N CA sing N N 145 CYS N H sing N N 146 CYS N H2 sing N N 147 CYS CA C sing N N 148 CYS CA CB sing N N 149 CYS CA HA sing N N 150 CYS C O doub N N 151 CYS C OXT sing N N 152 CYS CB SG sing N N 153 CYS CB HB2 sing N N 154 CYS CB HB3 sing N N 155 CYS SG HG sing N N 156 CYS OXT HXT sing N N 157 DI OP3 P sing N N 158 DI OP3 HOP3 sing N N 159 DI P OP1 doub N N 160 DI P OP2 sing N N 161 DI P "O5'" sing N N 162 DI OP2 HOP2 sing N N 163 DI "O5'" "C5'" sing N N 164 DI "C5'" "C4'" sing N N 165 DI "C5'" "H5'" sing N N 166 DI "C5'" "H5''" sing N N 167 DI "C4'" "O4'" sing N N 168 DI "C4'" "C3'" sing N N 169 DI "C4'" "H4'" sing N N 170 DI "O4'" "C1'" sing N N 171 DI "C3'" "O3'" sing N N 172 DI "C3'" "C2'" sing N N 173 DI "C3'" "H3'" sing N N 174 DI "O3'" "HO3'" sing N N 175 DI "C2'" "C1'" sing N N 176 DI "C2'" "H2'" sing N N 177 DI "C2'" "H2''" sing N N 178 DI "C1'" N9 sing N N 179 DI "C1'" "H1'" sing N N 180 DI N9 C8 sing Y N 181 DI N9 C4 sing Y N 182 DI C8 N7 doub Y N 183 DI C8 H8 sing N N 184 DI N7 C5 sing Y N 185 DI C5 C6 sing N N 186 DI C5 C4 doub Y N 187 DI C6 O6 doub N N 188 DI C6 N1 sing N N 189 DI N1 C2 sing N N 190 DI N1 H1 sing N N 191 DI C2 N3 doub N N 192 DI C2 H2 sing N N 193 DI N3 C4 sing N N 194 EDO C1 O1 sing N N 195 EDO C1 C2 sing N N 196 EDO C1 H11 sing N N 197 EDO C1 H12 sing N N 198 EDO O1 HO1 sing N N 199 EDO C2 O2 sing N N 200 EDO C2 H21 sing N N 201 EDO C2 H22 sing N N 202 EDO O2 HO2 sing N N 203 G OP3 P sing N N 204 G OP3 HOP3 sing N N 205 G P OP1 doub N N 206 G P OP2 sing N N 207 G P "O5'" sing N N 208 G OP2 HOP2 sing N N 209 G "O5'" "C5'" sing N N 210 G "C5'" "C4'" sing N N 211 G "C5'" "H5'" sing N N 212 G "C5'" "H5''" sing N N 213 G "C4'" "O4'" sing N N 214 G "C4'" "C3'" sing N N 215 G "C4'" "H4'" sing N N 216 G "O4'" "C1'" sing N N 217 G "C3'" "O3'" sing N N 218 G "C3'" "C2'" sing N N 219 G "C3'" "H3'" sing N N 220 G "O3'" "HO3'" sing N N 221 G "C2'" "O2'" sing N N 222 G "C2'" "C1'" sing N N 223 G "C2'" "H2'" sing N N 224 G "O2'" "HO2'" sing N N 225 G "C1'" N9 sing N N 226 G "C1'" "H1'" sing N N 227 G N9 C8 sing Y N 228 G N9 C4 sing Y N 229 G C8 N7 doub Y N 230 G C8 H8 sing N N 231 G N7 C5 sing Y N 232 G C5 C6 sing N N 233 G C5 C4 doub Y N 234 G C6 O6 doub N N 235 G C6 N1 sing N N 236 G N1 C2 sing N N 237 G N1 H1 sing N N 238 G C2 N2 sing N N 239 G C2 N3 doub N N 240 G N2 H21 sing N N 241 G N2 H22 sing N N 242 G N3 C4 sing N N 243 GLN N CA sing N N 244 GLN N H sing N N 245 GLN N H2 sing N N 246 GLN CA C sing N N 247 GLN CA CB sing N N 248 GLN CA HA sing N N 249 GLN C O doub N N 250 GLN C OXT sing N N 251 GLN CB CG sing N N 252 GLN CB HB2 sing N N 253 GLN CB HB3 sing N N 254 GLN CG CD sing N N 255 GLN CG HG2 sing N N 256 GLN CG HG3 sing N N 257 GLN CD OE1 doub N N 258 GLN CD NE2 sing N N 259 GLN NE2 HE21 sing N N 260 GLN NE2 HE22 sing N N 261 GLN OXT HXT sing N N 262 GLU N CA sing N N 263 GLU N H sing N N 264 GLU N H2 sing N N 265 GLU CA C sing N N 266 GLU CA CB sing N N 267 GLU CA HA sing N N 268 GLU C O doub N N 269 GLU C OXT sing N N 270 GLU CB CG sing N N 271 GLU CB HB2 sing N N 272 GLU CB HB3 sing N N 273 GLU CG CD sing N N 274 GLU CG HG2 sing N N 275 GLU CG HG3 sing N N 276 GLU CD OE1 doub N N 277 GLU CD OE2 sing N N 278 GLU OE2 HE2 sing N N 279 GLU OXT HXT sing N N 280 GLY N CA sing N N 281 GLY N H sing N N 282 GLY N H2 sing N N 283 GLY CA C sing N N 284 GLY CA HA2 sing N N 285 GLY CA HA3 sing N N 286 GLY C O doub N N 287 GLY C OXT sing N N 288 GLY OXT HXT sing N N 289 GOL C1 O1 sing N N 290 GOL C1 C2 sing N N 291 GOL C1 H11 sing N N 292 GOL C1 H12 sing N N 293 GOL O1 HO1 sing N N 294 GOL C2 O2 sing N N 295 GOL C2 C3 sing N N 296 GOL C2 H2 sing N N 297 GOL O2 HO2 sing N N 298 GOL C3 O3 sing N N 299 GOL C3 H31 sing N N 300 GOL C3 H32 sing N N 301 GOL O3 HO3 sing N N 302 HIS N CA sing N N 303 HIS N H sing N N 304 HIS N H2 sing N N 305 HIS CA C sing N N 306 HIS CA CB sing N N 307 HIS CA HA sing N N 308 HIS C O doub N N 309 HIS C OXT sing N N 310 HIS CB CG sing N N 311 HIS CB HB2 sing N N 312 HIS CB HB3 sing N N 313 HIS CG ND1 sing Y N 314 HIS CG CD2 doub Y N 315 HIS ND1 CE1 doub Y N 316 HIS ND1 HD1 sing N N 317 HIS CD2 NE2 sing Y N 318 HIS CD2 HD2 sing N N 319 HIS CE1 NE2 sing Y N 320 HIS CE1 HE1 sing N N 321 HIS NE2 HE2 sing N N 322 HIS OXT HXT sing N N 323 HOH O H1 sing N N 324 HOH O H2 sing N N 325 ILE N CA sing N N 326 ILE N H sing N N 327 ILE N H2 sing N N 328 ILE CA C sing N N 329 ILE CA CB sing N N 330 ILE CA HA sing N N 331 ILE C O doub N N 332 ILE C OXT sing N N 333 ILE CB CG1 sing N N 334 ILE CB CG2 sing N N 335 ILE CB HB sing N N 336 ILE CG1 CD1 sing N N 337 ILE CG1 HG12 sing N N 338 ILE CG1 HG13 sing N N 339 ILE CG2 HG21 sing N N 340 ILE CG2 HG22 sing N N 341 ILE CG2 HG23 sing N N 342 ILE CD1 HD11 sing N N 343 ILE CD1 HD12 sing N N 344 ILE CD1 HD13 sing N N 345 ILE OXT HXT sing N N 346 LEU N CA sing N N 347 LEU N H sing N N 348 LEU N H2 sing N N 349 LEU CA C sing N N 350 LEU CA CB sing N N 351 LEU CA HA sing N N 352 LEU C O doub N N 353 LEU C OXT sing N N 354 LEU CB CG sing N N 355 LEU CB HB2 sing N N 356 LEU CB HB3 sing N N 357 LEU CG CD1 sing N N 358 LEU CG CD2 sing N N 359 LEU CG HG sing N N 360 LEU CD1 HD11 sing N N 361 LEU CD1 HD12 sing N N 362 LEU CD1 HD13 sing N N 363 LEU CD2 HD21 sing N N 364 LEU CD2 HD22 sing N N 365 LEU CD2 HD23 sing N N 366 LEU OXT HXT sing N N 367 LYS N CA sing N N 368 LYS N H sing N N 369 LYS N H2 sing N N 370 LYS CA C sing N N 371 LYS CA CB sing N N 372 LYS CA HA sing N N 373 LYS C O doub N N 374 LYS C OXT sing N N 375 LYS CB CG sing N N 376 LYS CB HB2 sing N N 377 LYS CB HB3 sing N N 378 LYS CG CD sing N N 379 LYS CG HG2 sing N N 380 LYS CG HG3 sing N N 381 LYS CD CE sing N N 382 LYS CD HD2 sing N N 383 LYS CD HD3 sing N N 384 LYS CE NZ sing N N 385 LYS CE HE2 sing N N 386 LYS CE HE3 sing N N 387 LYS NZ HZ1 sing N N 388 LYS NZ HZ2 sing N N 389 LYS NZ HZ3 sing N N 390 LYS OXT HXT sing N N 391 MET N CA sing N N 392 MET N H sing N N 393 MET N H2 sing N N 394 MET CA C sing N N 395 MET CA CB sing N N 396 MET CA HA sing N N 397 MET C O doub N N 398 MET C OXT sing N N 399 MET CB CG sing N N 400 MET CB HB2 sing N N 401 MET CB HB3 sing N N 402 MET CG SD sing N N 403 MET CG HG2 sing N N 404 MET CG HG3 sing N N 405 MET SD CE sing N N 406 MET CE HE1 sing N N 407 MET CE HE2 sing N N 408 MET CE HE3 sing N N 409 MET OXT HXT sing N N 410 P6G O1 C2 sing N N 411 P6G O1 H1 sing N N 412 P6G C2 C3 sing N N 413 P6G C2 H21 sing N N 414 P6G C2 H22 sing N N 415 P6G C3 O4 sing N N 416 P6G C3 H31 sing N N 417 P6G C3 H32 sing N N 418 P6G O4 C5 sing N N 419 P6G C5 C6 sing N N 420 P6G C5 H51 sing N N 421 P6G C5 H52 sing N N 422 P6G C6 O7 sing N N 423 P6G C6 H61 sing N N 424 P6G C6 H62 sing N N 425 P6G O7 C8 sing N N 426 P6G C8 C9 sing N N 427 P6G C8 H81 sing N N 428 P6G C8 H82 sing N N 429 P6G C9 O10 sing N N 430 P6G C9 H91 sing N N 431 P6G C9 H92 sing N N 432 P6G O10 C11 sing N N 433 P6G C11 C12 sing N N 434 P6G C11 H111 sing N N 435 P6G C11 H112 sing N N 436 P6G C12 O13 sing N N 437 P6G C12 H121 sing N N 438 P6G C12 H122 sing N N 439 P6G O13 C14 sing N N 440 P6G C14 C15 sing N N 441 P6G C14 H141 sing N N 442 P6G C14 H142 sing N N 443 P6G C15 O16 sing N N 444 P6G C15 H151 sing N N 445 P6G C15 H152 sing N N 446 P6G O16 C17 sing N N 447 P6G C17 C18 sing N N 448 P6G C17 H171 sing N N 449 P6G C17 H172 sing N N 450 P6G C18 O19 sing N N 451 P6G C18 H181 sing N N 452 P6G C18 H182 sing N N 453 P6G O19 H19 sing N N 454 PG4 O1 C1 sing N N 455 PG4 O1 HO1 sing N N 456 PG4 C1 C2 sing N N 457 PG4 C1 H11 sing N N 458 PG4 C1 H12 sing N N 459 PG4 C2 O2 sing N N 460 PG4 C2 H21 sing N N 461 PG4 C2 H22 sing N N 462 PG4 O2 C3 sing N N 463 PG4 C3 C4 sing N N 464 PG4 C3 H31 sing N N 465 PG4 C3 H32 sing N N 466 PG4 C4 O3 sing N N 467 PG4 C4 H41 sing N N 468 PG4 C4 H42 sing N N 469 PG4 O3 C5 sing N N 470 PG4 C5 C6 sing N N 471 PG4 C5 H51 sing N N 472 PG4 C5 H52 sing N N 473 PG4 C6 O4 sing N N 474 PG4 C6 H61 sing N N 475 PG4 C6 H62 sing N N 476 PG4 O4 C7 sing N N 477 PG4 C7 C8 sing N N 478 PG4 C7 H71 sing N N 479 PG4 C7 H72 sing N N 480 PG4 C8 O5 sing N N 481 PG4 C8 H81 sing N N 482 PG4 C8 H82 sing N N 483 PG4 O5 HO5 sing N N 484 PGE C1 O1 sing N N 485 PGE C1 C2 sing N N 486 PGE C1 H1 sing N N 487 PGE C1 H12 sing N N 488 PGE O1 HO1 sing N N 489 PGE C2 O2 sing N N 490 PGE C2 H2 sing N N 491 PGE C2 H22 sing N N 492 PGE O2 C3 sing N N 493 PGE C3 C4 sing N N 494 PGE C3 H3 sing N N 495 PGE C3 H32 sing N N 496 PGE C4 O3 sing N N 497 PGE C4 H4 sing N N 498 PGE C4 H42 sing N N 499 PGE O4 C6 sing N N 500 PGE O4 HO4 sing N N 501 PGE C6 C5 sing N N 502 PGE C6 H6 sing N N 503 PGE C6 H62 sing N N 504 PGE C5 O3 sing N N 505 PGE C5 H5 sing N N 506 PGE C5 H52 sing N N 507 PHE N CA sing N N 508 PHE N H sing N N 509 PHE N H2 sing N N 510 PHE CA C sing N N 511 PHE CA CB sing N N 512 PHE CA HA sing N N 513 PHE C O doub N N 514 PHE C OXT sing N N 515 PHE CB CG sing N N 516 PHE CB HB2 sing N N 517 PHE CB HB3 sing N N 518 PHE CG CD1 doub Y N 519 PHE CG CD2 sing Y N 520 PHE CD1 CE1 sing Y N 521 PHE CD1 HD1 sing N N 522 PHE CD2 CE2 doub Y N 523 PHE CD2 HD2 sing N N 524 PHE CE1 CZ doub Y N 525 PHE CE1 HE1 sing N N 526 PHE CE2 CZ sing Y N 527 PHE CE2 HE2 sing N N 528 PHE CZ HZ sing N N 529 PHE OXT HXT sing N N 530 PRO N CA sing N N 531 PRO N CD sing N N 532 PRO N H sing N N 533 PRO CA C sing N N 534 PRO CA CB sing N N 535 PRO CA HA sing N N 536 PRO C O doub N N 537 PRO C OXT sing N N 538 PRO CB CG sing N N 539 PRO CB HB2 sing N N 540 PRO CB HB3 sing N N 541 PRO CG CD sing N N 542 PRO CG HG2 sing N N 543 PRO CG HG3 sing N N 544 PRO CD HD2 sing N N 545 PRO CD HD3 sing N N 546 PRO OXT HXT sing N N 547 SER N CA sing N N 548 SER N H sing N N 549 SER N H2 sing N N 550 SER CA C sing N N 551 SER CA CB sing N N 552 SER CA HA sing N N 553 SER C O doub N N 554 SER C OXT sing N N 555 SER CB OG sing N N 556 SER CB HB2 sing N N 557 SER CB HB3 sing N N 558 SER OG HG sing N N 559 SER OXT HXT sing N N 560 THR N CA sing N N 561 THR N H sing N N 562 THR N H2 sing N N 563 THR CA C sing N N 564 THR CA CB sing N N 565 THR CA HA sing N N 566 THR C O doub N N 567 THR C OXT sing N N 568 THR CB OG1 sing N N 569 THR CB CG2 sing N N 570 THR CB HB sing N N 571 THR OG1 HG1 sing N N 572 THR CG2 HG21 sing N N 573 THR CG2 HG22 sing N N 574 THR CG2 HG23 sing N N 575 THR OXT HXT sing N N 576 TRP N CA sing N N 577 TRP N H sing N N 578 TRP N H2 sing N N 579 TRP CA C sing N N 580 TRP CA CB sing N N 581 TRP CA HA sing N N 582 TRP C O doub N N 583 TRP C OXT sing N N 584 TRP CB CG sing N N 585 TRP CB HB2 sing N N 586 TRP CB HB3 sing N N 587 TRP CG CD1 doub Y N 588 TRP CG CD2 sing Y N 589 TRP CD1 NE1 sing Y N 590 TRP CD1 HD1 sing N N 591 TRP CD2 CE2 doub Y N 592 TRP CD2 CE3 sing Y N 593 TRP NE1 CE2 sing Y N 594 TRP NE1 HE1 sing N N 595 TRP CE2 CZ2 sing Y N 596 TRP CE3 CZ3 doub Y N 597 TRP CE3 HE3 sing N N 598 TRP CZ2 CH2 doub Y N 599 TRP CZ2 HZ2 sing N N 600 TRP CZ3 CH2 sing Y N 601 TRP CZ3 HZ3 sing N N 602 TRP CH2 HH2 sing N N 603 TRP OXT HXT sing N N 604 TYR N CA sing N N 605 TYR N H sing N N 606 TYR N H2 sing N N 607 TYR CA C sing N N 608 TYR CA CB sing N N 609 TYR CA HA sing N N 610 TYR C O doub N N 611 TYR C OXT sing N N 612 TYR CB CG sing N N 613 TYR CB HB2 sing N N 614 TYR CB HB3 sing N N 615 TYR CG CD1 doub Y N 616 TYR CG CD2 sing Y N 617 TYR CD1 CE1 sing Y N 618 TYR CD1 HD1 sing N N 619 TYR CD2 CE2 doub Y N 620 TYR CD2 HD2 sing N N 621 TYR CE1 CZ doub Y N 622 TYR CE1 HE1 sing N N 623 TYR CE2 CZ sing Y N 624 TYR CE2 HE2 sing N N 625 TYR CZ OH sing N N 626 TYR OH HH sing N N 627 TYR OXT HXT sing N N 628 U OP3 P sing N N 629 U OP3 HOP3 sing N N 630 U P OP1 doub N N 631 U P OP2 sing N N 632 U P "O5'" sing N N 633 U OP2 HOP2 sing N N 634 U "O5'" "C5'" sing N N 635 U "C5'" "C4'" sing N N 636 U "C5'" "H5'" sing N N 637 U "C5'" "H5''" sing N N 638 U "C4'" "O4'" sing N N 639 U "C4'" "C3'" sing N N 640 U "C4'" "H4'" sing N N 641 U "O4'" "C1'" sing N N 642 U "C3'" "O3'" sing N N 643 U "C3'" "C2'" sing N N 644 U "C3'" "H3'" sing N N 645 U "O3'" "HO3'" sing N N 646 U "C2'" "O2'" sing N N 647 U "C2'" "C1'" sing N N 648 U "C2'" "H2'" sing N N 649 U "O2'" "HO2'" sing N N 650 U "C1'" N1 sing N N 651 U "C1'" "H1'" sing N N 652 U N1 C2 sing N N 653 U N1 C6 sing N N 654 U C2 O2 doub N N 655 U C2 N3 sing N N 656 U N3 C4 sing N N 657 U N3 H3 sing N N 658 U C4 O4 doub N N 659 U C4 C5 sing N N 660 U C5 C6 doub N N 661 U C5 H5 sing N N 662 U C6 H6 sing N N 663 VAL N CA sing N N 664 VAL N H sing N N 665 VAL N H2 sing N N 666 VAL CA C sing N N 667 VAL CA CB sing N N 668 VAL CA HA sing N N 669 VAL C O doub N N 670 VAL C OXT sing N N 671 VAL CB CG1 sing N N 672 VAL CB CG2 sing N N 673 VAL CB HB sing N N 674 VAL CG1 HG11 sing N N 675 VAL CG1 HG12 sing N N 676 VAL CG1 HG13 sing N N 677 VAL CG2 HG21 sing N N 678 VAL CG2 HG22 sing N N 679 VAL CG2 HG23 sing N N 680 VAL OXT HXT sing N N 681 # _ndb_struct_conf_na.entry_id 6OZS _ndb_struct_conf_na.feature 'a-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 D U 1 1_555 F U 12 1_555 -2.834 -1.723 0.107 -22.869 -4.875 14.326 1 C_U318:U329_D C 318 ? D 329 ? 16 1 1 D A 2 1_555 F U 11 1_555 -0.223 0.060 0.302 5.297 -6.468 4.543 2 C_A319:U328_D C 319 ? D 328 ? 20 1 1 D U 3 1_555 F A 10 1_555 0.278 0.114 0.191 10.162 -4.933 1.221 3 C_U320:A327_D C 320 ? D 327 ? 20 1 1 D G 4 1_555 F C 9 1_555 -0.300 -0.269 0.067 4.202 -8.191 -2.774 4 C_G321:C326_D C 321 ? D 326 ? 19 1 1 D C 5 1_555 F G 8 1_555 -0.209 -0.066 -0.179 5.615 -6.464 1.617 5 C_C322:G325_D C 322 ? D 325 ? 19 1 1 D A 6 1_555 F U 7 1_555 0.102 -0.132 0.293 4.324 -16.593 6.280 6 C_A323:U324_D C 323 ? D 324 ? 20 1 1 D U 7 1_555 F A 6 1_555 -0.235 -0.070 0.155 -3.251 -17.279 7.893 7 C_U324:A323_D C 324 ? D 323 ? 20 1 1 D G 8 1_555 F C 5 1_555 -0.127 -0.063 -0.020 -10.014 -6.558 2.563 8 C_G325:C322_D C 325 ? D 322 ? 19 1 1 D C 9 1_555 F G 4 1_555 -0.241 -0.239 0.022 -2.462 -11.944 -1.642 9 C_C326:G321_D C 326 ? D 321 ? 19 1 1 D A 10 1_555 F U 3 1_555 -0.005 -0.025 -0.274 -9.289 -8.709 -1.438 10 C_A327:U320_D C 327 ? D 320 ? 20 1 1 D U 11 1_555 F A 2 1_555 0.778 0.061 -0.080 -0.811 -11.615 8.532 11 C_U328:A319_D C 328 ? D 319 ? 20 1 1 D U 12 1_555 F U 1 1_555 2.446 -1.222 0.060 23.106 -15.412 30.593 12 C_U329:U318_D C 329 ? D 318 ? 16 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 D U 1 1_555 F U 12 1_555 D A 2 1_555 F U 11 1_555 -0.998 -0.406 2.698 -3.112 5.776 37.838 -1.215 1.197 2.680 8.826 4.755 38.382 1 CC_U318A319:U328U329_DD C 318 ? D 329 ? C 319 ? D 328 ? 1 D A 2 1_555 F U 11 1_555 D U 3 1_555 F A 10 1_555 0.221 -1.506 3.293 1.841 3.729 30.492 -3.554 -0.063 3.099 7.049 -3.479 30.768 2 CC_A319U320:A327U328_DD C 319 ? D 328 ? C 320 ? D 327 ? 1 D U 3 1_555 F A 10 1_555 D G 4 1_555 F C 9 1_555 -0.344 -1.819 3.239 1.173 8.872 28.438 -5.220 0.891 2.552 17.519 -2.315 29.785 3 CC_U320G321:C326A327_DD C 320 ? D 327 ? C 321 ? D 326 ? 1 D G 4 1_555 F C 9 1_555 D C 5 1_555 F G 8 1_555 0.212 -1.619 3.191 0.099 6.158 32.616 -3.798 -0.355 2.846 10.844 -0.175 33.177 4 CC_G321C322:G325C326_DD C 321 ? D 326 ? C 322 ? D 325 ? 1 D C 5 1_555 F G 8 1_555 D A 6 1_555 F U 7 1_555 0.149 -1.554 3.194 -2.636 9.973 30.878 -4.352 -0.683 2.560 18.108 4.787 32.516 5 CC_C322A323:U324G325_DD C 322 ? D 325 ? C 323 ? D 324 ? 1 D A 6 1_555 F U 7 1_555 D U 7 1_555 F A 6 1_555 0.073 -1.354 3.300 0.303 18.802 32.882 -4.300 -0.077 2.232 30.327 -0.488 37.750 6 CC_A323U324:A323U324_DD C 323 ? D 324 ? C 324 ? D 323 ? 1 D U 7 1_555 F A 6 1_555 D G 8 1_555 F C 5 1_555 -0.184 -1.743 3.333 1.076 12.738 29.013 -5.343 0.519 2.369 24.009 -2.028 31.650 7 CC_U324G325:C322A323_DD C 324 ? D 323 ? C 325 ? D 322 ? 1 D G 8 1_555 F C 5 1_555 D C 9 1_555 F G 4 1_555 -0.291 -1.670 3.077 -0.105 1.382 31.546 -3.308 0.517 3.004 2.541 0.193 31.575 8 CC_G325C326:G321C322_DD C 325 ? D 322 ? C 326 ? D 321 ? 1 D C 9 1_555 F G 4 1_555 D A 10 1_555 F U 3 1_555 0.336 -1.600 3.444 2.498 10.002 32.229 -4.348 -0.180 2.852 17.467 -4.363 33.796 9 CC_C326A327:U320G321_DD C 326 ? D 321 ? C 327 ? D 320 ? 1 D A 10 1_555 F U 3 1_555 D U 11 1_555 F A 2 1_555 0.542 -1.236 3.147 1.088 5.005 30.947 -3.168 -0.810 2.933 9.299 -2.022 31.358 10 CC_A327U328:A319U320_DD C 327 ? D 320 ? C 328 ? D 319 ? 1 D U 11 1_555 F A 2 1_555 D U 12 1_555 F U 1 1_555 1.532 -0.067 2.692 4.846 11.135 34.923 -1.390 -1.861 2.727 17.898 -7.789 36.912 11 CC_U328U329:U318A319_DD C 328 ? D 319 ? C 329 ? D 318 ? # _atom_sites.entry_id 6OZS _atom_sites.fract_transf_matrix[1][1] 0.014268 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013651 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006422 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MG N NA O P S # loop_