data_6PDN # _entry.id 6PDN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6PDN WWPDB D_1000242363 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '6PCW contains the same protein-substrate complex with benzothiophene inhibitor 213' 6PCW unspecified PDB '6PDI contains the same protein-substrate complex with benzothiophene inhibitor 224' 6PDI unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6PDN _pdbx_database_status.recvd_initial_deposition_date 2019-06-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Godoi, P.H.C.' 1 0000-0003-1859-3513 'Santiago, A.S.' 2 0000-0002-3973-3370 'Fala, A.M.' 3 0000-0001-7664-2630 'Ramos, P.Z.' 4 0000-0001-6716-2504 'Sriranganadane, D.' 5 0000-0003-1818-1420 'Mascarello, A.' 6 0000-0001-7672-4070 'Segretti, N.' 7 0000-0002-5515-2090 'Azevedo, H.' 8 0000-0001-9233-0696 'Guimaraes, C.R.W.' 9 0000-0003-4062-9965 'Arruda, P.' 10 0000-0002-8365-731X 'Elkins, J.M.' 11 0000-0003-2858-8929 'Counago, R.M.' 12 0000-0003-1847-5090 'Structural Genomics Consortium (SGC)' 13 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Human PIM1' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Godoi, P.H.C.' 1 0000-0003-1859-3513 primary 'Santiago, A.S.' 2 0000-0002-3973-3370 primary 'Fala, A.M.' 3 0000-0001-7664-2630 primary 'Ramos, P.Z.' 4 0000-0001-6716-2504 primary 'Sriranganadane, D.' 5 0000-0003-1818-1420 primary 'Mascarello, A.' 6 0000-0001-7672-4070 primary 'Segretti, N.' 7 0000-0002-5515-2090 primary 'Azevedo, H.' 8 0000-0001-9233-0696 primary 'Guimaraes, C.R.W.' 9 0000-0003-4062-9965 primary 'Arruda, P.' 10 0000-0002-8365-731X primary 'Elkins, J.M.' 11 0000-0003-2858-8929 primary 'Counago, R.M.' 12 0000-0003-1847-5090 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6PDN _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.001 _cell.length_a_esd ? _cell.length_b 98.001 _cell.length_b_esd ? _cell.length_c 80.248 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6PDN _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase pim-1' 35670.477 1 2.7.11.1 ? ? ? 2 polymer syn peptide 1592.850 1 ? ? ? ? 3 non-polymer syn '4-{5-[(3-aminopropyl)carbamoyl]thiophen-2-yl}-1-benzothiophene-2-carboxylic acid' 360.451 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 91 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD IPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; ;SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD IPFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; A ? 2 'polypeptide(L)' no no ARKRRRHPSGPPTA ARKRRRHPSGPPTA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 LEU n 1 4 LEU n 1 5 SER n 1 6 LYS n 1 7 ILE n 1 8 ASN n 1 9 SER n 1 10 LEU n 1 11 ALA n 1 12 HIS n 1 13 LEU n 1 14 ARG n 1 15 ALA n 1 16 ALA n 1 17 PRO n 1 18 CYS n 1 19 ASN n 1 20 ASP n 1 21 LEU n 1 22 HIS n 1 23 ALA n 1 24 THR n 1 25 LYS n 1 26 LEU n 1 27 ALA n 1 28 PRO n 1 29 GLY n 1 30 LYS n 1 31 GLU n 1 32 LYS n 1 33 GLU n 1 34 PRO n 1 35 LEU n 1 36 GLU n 1 37 SER n 1 38 GLN n 1 39 TYR n 1 40 GLN n 1 41 VAL n 1 42 GLY n 1 43 PRO n 1 44 LEU n 1 45 LEU n 1 46 GLY n 1 47 SER n 1 48 GLY n 1 49 GLY n 1 50 PHE n 1 51 GLY n 1 52 SER n 1 53 VAL n 1 54 TYR n 1 55 SER n 1 56 GLY n 1 57 ILE n 1 58 ARG n 1 59 VAL n 1 60 SER n 1 61 ASP n 1 62 ASN n 1 63 LEU n 1 64 PRO n 1 65 VAL n 1 66 ALA n 1 67 ILE n 1 68 LYS n 1 69 HIS n 1 70 VAL n 1 71 GLU n 1 72 LYS n 1 73 ASP n 1 74 ARG n 1 75 ILE n 1 76 SER n 1 77 ASP n 1 78 TRP n 1 79 GLY n 1 80 GLU n 1 81 LEU n 1 82 PRO n 1 83 ASN n 1 84 GLY n 1 85 THR n 1 86 ARG n 1 87 VAL n 1 88 PRO n 1 89 MET n 1 90 GLU n 1 91 VAL n 1 92 VAL n 1 93 LEU n 1 94 LEU n 1 95 LYS n 1 96 LYS n 1 97 VAL n 1 98 SER n 1 99 SER n 1 100 GLY n 1 101 PHE n 1 102 SER n 1 103 GLY n 1 104 VAL n 1 105 ILE n 1 106 ARG n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 TRP n 1 111 PHE n 1 112 GLU n 1 113 ARG n 1 114 PRO n 1 115 ASP n 1 116 SER n 1 117 PHE n 1 118 VAL n 1 119 LEU n 1 120 ILE n 1 121 LEU n 1 122 GLU n 1 123 ARG n 1 124 PRO n 1 125 GLU n 1 126 PRO n 1 127 VAL n 1 128 GLN n 1 129 ASP n 1 130 LEU n 1 131 PHE n 1 132 ASP n 1 133 PHE n 1 134 ILE n 1 135 THR n 1 136 GLU n 1 137 ARG n 1 138 GLY n 1 139 ALA n 1 140 LEU n 1 141 GLN n 1 142 GLU n 1 143 GLU n 1 144 LEU n 1 145 ALA n 1 146 ARG n 1 147 SER n 1 148 PHE n 1 149 PHE n 1 150 TRP n 1 151 GLN n 1 152 VAL n 1 153 LEU n 1 154 GLU n 1 155 ALA n 1 156 VAL n 1 157 ARG n 1 158 HIS n 1 159 CYS n 1 160 HIS n 1 161 ASN n 1 162 CYS n 1 163 GLY n 1 164 VAL n 1 165 LEU n 1 166 HIS n 1 167 ARG n 1 168 ASP n 1 169 ILE n 1 170 LYS n 1 171 ASP n 1 172 GLU n 1 173 ASN n 1 174 ILE n 1 175 LEU n 1 176 ILE n 1 177 ASP n 1 178 LEU n 1 179 ASN n 1 180 ARG n 1 181 GLY n 1 182 GLU n 1 183 LEU n 1 184 LYS n 1 185 LEU n 1 186 ILE n 1 187 ASP n 1 188 PHE n 1 189 GLY n 1 190 SER n 1 191 GLY n 1 192 ALA n 1 193 LEU n 1 194 LEU n 1 195 LYS n 1 196 ASP n 1 197 THR n 1 198 VAL n 1 199 TYR n 1 200 THR n 1 201 ASP n 1 202 PHE n 1 203 ASP n 1 204 GLY n 1 205 THR n 1 206 ARG n 1 207 VAL n 1 208 TYR n 1 209 SER n 1 210 PRO n 1 211 PRO n 1 212 GLU n 1 213 TRP n 1 214 ILE n 1 215 ARG n 1 216 TYR n 1 217 HIS n 1 218 ARG n 1 219 TYR n 1 220 HIS n 1 221 GLY n 1 222 ARG n 1 223 SER n 1 224 ALA n 1 225 ALA n 1 226 VAL n 1 227 TRP n 1 228 SER n 1 229 LEU n 1 230 GLY n 1 231 ILE n 1 232 LEU n 1 233 LEU n 1 234 TYR n 1 235 ASP n 1 236 MET n 1 237 VAL n 1 238 CYS n 1 239 GLY n 1 240 ASP n 1 241 ILE n 1 242 PRO n 1 243 PHE n 1 244 GLU n 1 245 HIS n 1 246 ASP n 1 247 GLU n 1 248 GLU n 1 249 ILE n 1 250 ILE n 1 251 GLY n 1 252 GLY n 1 253 GLN n 1 254 VAL n 1 255 PHE n 1 256 PHE n 1 257 ARG n 1 258 GLN n 1 259 ARG n 1 260 VAL n 1 261 SER n 1 262 SEP n 1 263 GLU n 1 264 CYS n 1 265 GLN n 1 266 HIS n 1 267 LEU n 1 268 ILE n 1 269 ARG n 1 270 TRP n 1 271 CYS n 1 272 LEU n 1 273 ALA n 1 274 LEU n 1 275 ARG n 1 276 PRO n 1 277 SER n 1 278 ASP n 1 279 ARG n 1 280 PRO n 1 281 THR n 1 282 PHE n 1 283 GLU n 1 284 GLU n 1 285 ILE n 1 286 GLN n 1 287 ASN n 1 288 HIS n 1 289 PRO n 1 290 TRP n 1 291 MET n 1 292 GLN n 1 293 ASP n 1 294 VAL n 1 295 LEU n 1 296 LEU n 1 297 PRO n 1 298 GLN n 1 299 GLU n 1 300 THR n 1 301 ALA n 1 302 GLU n 1 303 ILE n 1 304 HIS n 1 305 LEU n 1 306 HIS n 1 307 SER n 1 308 LEU n 1 309 SER n 1 310 PRO n 1 311 GLY n 1 312 PRO n 1 313 SER n 2 1 ALA n 2 2 ARG n 2 3 LYS n 2 4 ARG n 2 5 ARG n 2 6 ARG n 2 7 HIS n 2 8 PRO n 2 9 SER n 2 10 GLY n 2 11 PRO n 2 12 PRO n 2 13 THR n 2 14 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 313 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 14 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PIM1_HUMAN P11309 ? 1 ;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; 1 2 PDB 6PDN 6PDN ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6PDN A 2 ? 313 ? P11309 1 ? 312 ? 1 312 2 2 6PDN B 1 ? 14 ? 6PDN 1 ? 14 ? 1 14 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6PDN SER A 1 ? UNP P11309 ? ? 'expression tag' 0 1 1 6PDN GLY A 251 ? UNP P11309 ARG 250 conflict 250 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OD4 non-polymer . '4-{5-[(3-aminopropyl)carbamoyl]thiophen-2-yl}-1-benzothiophene-2-carboxylic acid' ? 'C17 H16 N2 O3 S2' 360.451 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PDN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG3350, 0.1 M bis-tris propane pH8.5, 0.2 M sodium fluoride, 10% ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9762 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9762 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6PDN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 49.05 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17226 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 18090 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.766 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 1.1700 _refine.aniso_B[1][2] 0.5900 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.1700 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -3.8000 _refine.B_iso_max 123.410 _refine.B_iso_mean 43.0970 _refine.B_iso_min 24.170 _refine.correlation_coeff_Fo_to_Fc 0.9520 _refine.correlation_coeff_Fo_to_Fc_free 0.9270 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6PDN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4000 _refine.ls_d_res_low 49.0500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16388 _refine.ls_number_reflns_R_free 833 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9700 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1902 _refine.ls_R_factor_R_free 0.2234 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1884 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2720 _refine.pdbx_overall_ESU_R_Free 0.2080 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.8330 _refine.overall_SU_ML 0.1540 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4000 _refine_hist.d_res_low 49.0500 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 2385 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 278 _refine_hist.pdbx_B_iso_mean_ligand 70.26 _refine_hist.pdbx_B_iso_mean_solvent 42.98 _refine_hist.pdbx_number_atoms_protein 2264 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.013 2361 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2152 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.323 1.638 3205 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.190 1.576 4970 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.632 5.000 277 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 28.590 20.616 146 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.664 15.000 386 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.846 15.000 23 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.060 0.200 285 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2648 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 541 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.4000 _refine_ls_shell.d_res_low 2.4620 _refine_ls_shell.number_reflns_all 1256 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 57 _refine_ls_shell.number_reflns_R_work 1199 _refine_ls_shell.percent_reflns_obs 99.8400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4520 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3080 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6PDN _struct.title 'Human PIM1 bound to benzothiophene inhibitor 292' _struct.pdbx_descriptor 'Serine/threonine-protein kinase pim-1 (E.C.2.7.11.1), peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PDN _struct_keywords.text ;PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE PIM-1, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE, TRANSFERASE-TRANSFERASE Inhibitor complex ; _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 34 ? GLN A 38 ? PRO A 33 GLN A 37 1 ? 5 HELX_P HELX_P2 AA2 ASP A 73 ? ILE A 75 ? ASP A 72 ILE A 74 5 ? 3 HELX_P HELX_P3 AA3 MET A 89 ? SER A 98 ? MET A 88 SER A 97 1 ? 10 HELX_P HELX_P4 AA4 LEU A 130 ? GLY A 138 ? LEU A 129 GLY A 137 1 ? 9 HELX_P HELX_P5 AA5 GLN A 141 ? CYS A 162 ? GLN A 140 CYS A 161 1 ? 22 HELX_P HELX_P6 AA6 LYS A 170 ? GLU A 172 ? LYS A 169 GLU A 171 5 ? 3 HELX_P HELX_P7 AA7 THR A 205 ? SER A 209 ? THR A 204 SER A 208 5 ? 5 HELX_P HELX_P8 AA8 PRO A 210 ? HIS A 217 ? PRO A 209 HIS A 216 1 ? 8 HELX_P HELX_P9 AA9 HIS A 220 ? GLY A 239 ? HIS A 219 GLY A 238 1 ? 20 HELX_P HELX_P10 AB1 HIS A 245 ? GLY A 252 ? HIS A 244 GLY A 251 1 ? 8 HELX_P HELX_P11 AB2 SER A 261 ? LEU A 272 ? SER A 260 LEU A 271 1 ? 12 HELX_P HELX_P12 AB3 ARG A 275 ? ARG A 279 ? ARG A 274 ARG A 278 5 ? 5 HELX_P HELX_P13 AB4 THR A 281 ? HIS A 288 ? THR A 280 HIS A 287 1 ? 8 HELX_P HELX_P14 AB5 PRO A 289 ? GLN A 292 ? PRO A 288 GLN A 291 5 ? 4 HELX_P HELX_P15 AB6 LEU A 296 ? LEU A 305 ? LEU A 295 LEU A 304 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A SER 261 C ? ? ? 1_555 A SEP 262 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.337 ? covale2 covale both ? A SEP 262 C ? ? ? 1_555 A GLU 263 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.337 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 125 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 124 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 126 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 125 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.59 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 39 ? GLY A 46 ? TYR A 38 GLY A 45 AA1 2 VAL A 53 ? ARG A 58 ? VAL A 52 ARG A 57 AA1 3 PRO A 64 ? GLU A 71 ? PRO A 63 GLU A 70 AA1 4 SER A 116 ? GLU A 122 ? SER A 115 GLU A 121 AA1 5 LEU A 107 ? GLU A 112 ? LEU A 106 GLU A 111 AA2 1 TRP A 78 ? GLU A 80 ? TRP A 77 GLU A 79 AA2 2 ARG A 86 ? PRO A 88 ? ARG A 85 PRO A 87 AA3 1 VAL A 127 ? ASP A 129 ? VAL A 126 ASP A 128 AA3 2 ILE A 174 ? ASP A 177 ? ILE A 173 ASP A 176 AA3 3 GLU A 182 ? LEU A 185 ? GLU A 181 LEU A 184 AA4 1 VAL A 164 ? LEU A 165 ? VAL A 163 LEU A 164 AA4 2 ALA A 192 ? LEU A 193 ? ALA A 191 LEU A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 40 ? N GLN A 39 O ILE A 57 ? O ILE A 56 AA1 2 3 N TYR A 54 ? N TYR A 53 O ILE A 67 ? O ILE A 66 AA1 3 4 N ALA A 66 ? N ALA A 65 O LEU A 121 ? O LEU A 120 AA1 4 5 O ILE A 120 ? O ILE A 119 N ASP A 109 ? N ASP A 108 AA2 1 2 N GLY A 79 ? N GLY A 78 O VAL A 87 ? O VAL A 86 AA3 1 2 N GLN A 128 ? N GLN A 127 O ILE A 176 ? O ILE A 175 AA3 2 3 N ASP A 177 ? N ASP A 176 O GLU A 182 ? O GLU A 181 AA4 1 2 N LEU A 165 ? N LEU A 164 O ALA A 192 ? O ALA A 191 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A OD4 900 ? 7 'binding site for residue OD4 A 900' AC2 Software A GOL 901 ? 7 'binding site for residue GOL A 901' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ALA A 66 ? ALA A 65 . ? 1_555 ? 2 AC1 7 LYS A 68 ? LYS A 67 . ? 1_555 ? 3 AC1 7 GLU A 122 ? GLU A 121 . ? 1_555 ? 4 AC1 7 VAL A 127 ? VAL A 126 . ? 1_555 ? 5 AC1 7 LEU A 175 ? LEU A 174 . ? 1_555 ? 6 AC1 7 ILE A 186 ? ILE A 185 . ? 1_555 ? 7 AC1 7 ASP A 187 ? ASP A 186 . ? 1_555 ? 8 AC2 7 ARG A 137 ? ARG A 136 . ? 1_555 ? 9 AC2 7 ALA A 139 ? ALA A 138 . ? 1_555 ? 10 AC2 7 LEU A 140 ? LEU A 139 . ? 1_555 ? 11 AC2 7 GLN A 141 ? GLN A 140 . ? 1_555 ? 12 AC2 7 LEU A 144 ? LEU A 143 . ? 1_555 ? 13 AC2 7 HIS A 304 ? HIS A 303 . ? 1_555 ? 14 AC2 7 HOH E . ? HOH A 1047 . ? 1_555 ? # _atom_sites.entry_id 6PDN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010204 _atom_sites.fract_transf_matrix[1][2] 0.005891 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011783 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012461 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 LEU 3 2 ? ? ? A . n A 1 4 LEU 4 3 ? ? ? A . n A 1 5 SER 5 4 ? ? ? A . n A 1 6 LYS 6 5 ? ? ? A . n A 1 7 ILE 7 6 ? ? ? A . n A 1 8 ASN 8 7 ? ? ? A . n A 1 9 SER 9 8 ? ? ? A . n A 1 10 LEU 10 9 ? ? ? A . n A 1 11 ALA 11 10 ? ? ? A . n A 1 12 HIS 12 11 ? ? ? A . n A 1 13 LEU 13 12 ? ? ? A . n A 1 14 ARG 14 13 ? ? ? A . n A 1 15 ALA 15 14 ? ? ? A . n A 1 16 ALA 16 15 ? ? ? A . n A 1 17 PRO 17 16 ? ? ? A . n A 1 18 CYS 18 17 ? ? ? A . n A 1 19 ASN 19 18 ? ? ? A . n A 1 20 ASP 20 19 ? ? ? A . n A 1 21 LEU 21 20 ? ? ? A . n A 1 22 HIS 22 21 ? ? ? A . n A 1 23 ALA 23 22 ? ? ? A . n A 1 24 THR 24 23 ? ? ? A . n A 1 25 LYS 25 24 ? ? ? A . n A 1 26 LEU 26 25 ? ? ? A . n A 1 27 ALA 27 26 ? ? ? A . n A 1 28 PRO 28 27 ? ? ? A . n A 1 29 GLY 29 28 ? ? ? A . n A 1 30 LYS 30 29 ? ? ? A . n A 1 31 GLU 31 30 ? ? ? A . n A 1 32 LYS 32 31 ? ? ? A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 GLN 38 37 37 GLN GLN A . n A 1 39 TYR 39 38 38 TYR TYR A . n A 1 40 GLN 40 39 39 GLN GLN A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 PRO 43 42 42 PRO PRO A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 SER 47 46 46 SER SER A . n A 1 48 GLY 48 47 ? ? ? A . n A 1 49 GLY 49 48 ? ? ? A . n A 1 50 PHE 50 49 ? ? ? A . n A 1 51 GLY 51 50 ? ? ? A . n A 1 52 SER 52 51 51 SER SER A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 TYR 54 53 53 TYR TYR A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 ARG 58 57 57 ARG ARG A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 ASN 62 61 61 ASN ASN A . n A 1 63 LEU 63 62 62 LEU LEU A . n A 1 64 PRO 64 63 63 PRO PRO A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 ALA 66 65 65 ALA ALA A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 ILE 75 74 74 ILE ILE A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 TRP 78 77 77 TRP TRP A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 GLU 80 79 79 GLU GLU A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 PRO 82 81 81 PRO PRO A . n A 1 83 ASN 83 82 82 ASN ASN A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 THR 85 84 84 THR THR A . n A 1 86 ARG 86 85 85 ARG ARG A . n A 1 87 VAL 87 86 86 VAL VAL A . n A 1 88 PRO 88 87 87 PRO PRO A . n A 1 89 MET 89 88 88 MET MET A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 LEU 93 92 92 LEU LEU A . n A 1 94 LEU 94 93 93 LEU LEU A . n A 1 95 LYS 95 94 94 LYS LYS A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 SER 98 97 97 SER SER A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 GLY 100 99 99 GLY GLY A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 SER 102 101 101 SER SER A . n A 1 103 GLY 103 102 102 GLY GLY A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 ILE 105 104 104 ILE ILE A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 TRP 110 109 109 TRP TRP A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 GLU 112 111 111 GLU GLU A . n A 1 113 ARG 113 112 112 ARG ARG A . n A 1 114 PRO 114 113 113 PRO PRO A . n A 1 115 ASP 115 114 114 ASP ASP A . n A 1 116 SER 116 115 115 SER SER A . n A 1 117 PHE 117 116 116 PHE PHE A . n A 1 118 VAL 118 117 117 VAL VAL A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 ILE 120 119 119 ILE ILE A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 GLU 122 121 121 GLU GLU A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 PRO 124 123 123 PRO PRO A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 PRO 126 125 125 PRO PRO A . n A 1 127 VAL 127 126 126 VAL VAL A . n A 1 128 GLN 128 127 127 GLN GLN A . n A 1 129 ASP 129 128 128 ASP ASP A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 PHE 131 130 130 PHE PHE A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 THR 135 134 134 THR THR A . n A 1 136 GLU 136 135 135 GLU GLU A . n A 1 137 ARG 137 136 136 ARG ARG A . n A 1 138 GLY 138 137 137 GLY GLY A . n A 1 139 ALA 139 138 138 ALA ALA A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 GLN 141 140 140 GLN GLN A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 LEU 144 143 143 LEU LEU A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 ARG 146 145 145 ARG ARG A . n A 1 147 SER 147 146 146 SER SER A . n A 1 148 PHE 148 147 147 PHE PHE A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 TRP 150 149 149 TRP TRP A . n A 1 151 GLN 151 150 150 GLN GLN A . n A 1 152 VAL 152 151 151 VAL VAL A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 ALA 155 154 154 ALA ALA A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 HIS 158 157 157 HIS HIS A . n A 1 159 CYS 159 158 158 CYS CYS A . n A 1 160 HIS 160 159 159 HIS HIS A . n A 1 161 ASN 161 160 160 ASN ASN A . n A 1 162 CYS 162 161 161 CYS CYS A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 VAL 164 163 163 VAL VAL A . n A 1 165 LEU 165 164 164 LEU LEU A . n A 1 166 HIS 166 165 165 HIS HIS A . n A 1 167 ARG 167 166 166 ARG ARG A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 ILE 169 168 168 ILE ILE A . n A 1 170 LYS 170 169 169 LYS LYS A . n A 1 171 ASP 171 170 170 ASP ASP A . n A 1 172 GLU 172 171 171 GLU GLU A . n A 1 173 ASN 173 172 172 ASN ASN A . n A 1 174 ILE 174 173 173 ILE ILE A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 ILE 176 175 175 ILE ILE A . n A 1 177 ASP 177 176 176 ASP ASP A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 ASN 179 178 178 ASN ASN A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 GLY 181 180 180 GLY GLY A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 LEU 183 182 182 LEU LEU A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 LEU 185 184 184 LEU LEU A . n A 1 186 ILE 186 185 185 ILE ILE A . n A 1 187 ASP 187 186 186 ASP ASP A . n A 1 188 PHE 188 187 187 PHE PHE A . n A 1 189 GLY 189 188 188 GLY GLY A . n A 1 190 SER 190 189 189 SER SER A . n A 1 191 GLY 191 190 190 GLY GLY A . n A 1 192 ALA 192 191 191 ALA ALA A . n A 1 193 LEU 193 192 192 LEU LEU A . n A 1 194 LEU 194 193 193 LEU LEU A . n A 1 195 LYS 195 194 194 LYS LYS A . n A 1 196 ASP 196 195 195 ASP ASP A . n A 1 197 THR 197 196 196 THR THR A . n A 1 198 VAL 198 197 197 VAL VAL A . n A 1 199 TYR 199 198 198 TYR TYR A . n A 1 200 THR 200 199 199 THR THR A . n A 1 201 ASP 201 200 200 ASP ASP A . n A 1 202 PHE 202 201 201 PHE PHE A . n A 1 203 ASP 203 202 202 ASP ASP A . n A 1 204 GLY 204 203 203 GLY GLY A . n A 1 205 THR 205 204 204 THR THR A . n A 1 206 ARG 206 205 205 ARG ARG A . n A 1 207 VAL 207 206 206 VAL VAL A . n A 1 208 TYR 208 207 207 TYR TYR A . n A 1 209 SER 209 208 208 SER SER A . n A 1 210 PRO 210 209 209 PRO PRO A . n A 1 211 PRO 211 210 210 PRO PRO A . n A 1 212 GLU 212 211 211 GLU GLU A . n A 1 213 TRP 213 212 212 TRP TRP A . n A 1 214 ILE 214 213 213 ILE ILE A . n A 1 215 ARG 215 214 214 ARG ARG A . n A 1 216 TYR 216 215 215 TYR TYR A . n A 1 217 HIS 217 216 216 HIS HIS A . n A 1 218 ARG 218 217 217 ARG ARG A . n A 1 219 TYR 219 218 218 TYR TYR A . n A 1 220 HIS 220 219 219 HIS HIS A . n A 1 221 GLY 221 220 220 GLY GLY A . n A 1 222 ARG 222 221 221 ARG ARG A . n A 1 223 SER 223 222 222 SER SER A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 ALA 225 224 224 ALA ALA A . n A 1 226 VAL 226 225 225 VAL VAL A . n A 1 227 TRP 227 226 226 TRP TRP A . n A 1 228 SER 228 227 227 SER SER A . n A 1 229 LEU 229 228 228 LEU LEU A . n A 1 230 GLY 230 229 229 GLY GLY A . n A 1 231 ILE 231 230 230 ILE ILE A . n A 1 232 LEU 232 231 231 LEU LEU A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 TYR 234 233 233 TYR TYR A . n A 1 235 ASP 235 234 234 ASP ASP A . n A 1 236 MET 236 235 235 MET MET A . n A 1 237 VAL 237 236 236 VAL VAL A . n A 1 238 CYS 238 237 237 CYS CYS A . n A 1 239 GLY 239 238 238 GLY GLY A . n A 1 240 ASP 240 239 239 ASP ASP A . n A 1 241 ILE 241 240 240 ILE ILE A . n A 1 242 PRO 242 241 241 PRO PRO A . n A 1 243 PHE 243 242 242 PHE PHE A . n A 1 244 GLU 244 243 243 GLU GLU A . n A 1 245 HIS 245 244 244 HIS HIS A . n A 1 246 ASP 246 245 245 ASP ASP A . n A 1 247 GLU 247 246 246 GLU GLU A . n A 1 248 GLU 248 247 247 GLU GLU A . n A 1 249 ILE 249 248 248 ILE ILE A . n A 1 250 ILE 250 249 249 ILE ILE A . n A 1 251 GLY 251 250 250 GLY GLY A . n A 1 252 GLY 252 251 251 GLY GLY A . n A 1 253 GLN 253 252 252 GLN GLN A . n A 1 254 VAL 254 253 253 VAL VAL A . n A 1 255 PHE 255 254 254 PHE PHE A . n A 1 256 PHE 256 255 255 PHE PHE A . n A 1 257 ARG 257 256 256 ARG ARG A . n A 1 258 GLN 258 257 257 GLN GLN A . n A 1 259 ARG 259 258 258 ARG ARG A . n A 1 260 VAL 260 259 259 VAL VAL A . n A 1 261 SER 261 260 260 SER SER A . n A 1 262 SEP 262 261 261 SEP SEP A . n A 1 263 GLU 263 262 262 GLU GLU A . n A 1 264 CYS 264 263 263 CYS CYS A . n A 1 265 GLN 265 264 264 GLN GLN A . n A 1 266 HIS 266 265 265 HIS HIS A . n A 1 267 LEU 267 266 266 LEU LEU A . n A 1 268 ILE 268 267 267 ILE ILE A . n A 1 269 ARG 269 268 268 ARG ARG A . n A 1 270 TRP 270 269 269 TRP TRP A . n A 1 271 CYS 271 270 270 CYS CYS A . n A 1 272 LEU 272 271 271 LEU LEU A . n A 1 273 ALA 273 272 272 ALA ALA A . n A 1 274 LEU 274 273 273 LEU LEU A . n A 1 275 ARG 275 274 274 ARG ARG A . n A 1 276 PRO 276 275 275 PRO PRO A . n A 1 277 SER 277 276 276 SER SER A . n A 1 278 ASP 278 277 277 ASP ASP A . n A 1 279 ARG 279 278 278 ARG ARG A . n A 1 280 PRO 280 279 279 PRO PRO A . n A 1 281 THR 281 280 280 THR THR A . n A 1 282 PHE 282 281 281 PHE PHE A . n A 1 283 GLU 283 282 282 GLU GLU A . n A 1 284 GLU 284 283 283 GLU GLU A . n A 1 285 ILE 285 284 284 ILE ILE A . n A 1 286 GLN 286 285 285 GLN GLN A . n A 1 287 ASN 287 286 286 ASN ASN A . n A 1 288 HIS 288 287 287 HIS HIS A . n A 1 289 PRO 289 288 288 PRO PRO A . n A 1 290 TRP 290 289 289 TRP TRP A . n A 1 291 MET 291 290 290 MET MET A . n A 1 292 GLN 292 291 291 GLN GLN A . n A 1 293 ASP 293 292 292 ASP ASP A . n A 1 294 VAL 294 293 293 VAL VAL A . n A 1 295 LEU 295 294 294 LEU LEU A . n A 1 296 LEU 296 295 295 LEU LEU A . n A 1 297 PRO 297 296 296 PRO PRO A . n A 1 298 GLN 298 297 297 GLN GLN A . n A 1 299 GLU 299 298 298 GLU GLU A . n A 1 300 THR 300 299 299 THR THR A . n A 1 301 ALA 301 300 300 ALA ALA A . n A 1 302 GLU 302 301 301 GLU GLU A . n A 1 303 ILE 303 302 302 ILE ILE A . n A 1 304 HIS 304 303 303 HIS HIS A . n A 1 305 LEU 305 304 304 LEU LEU A . n A 1 306 HIS 306 305 305 HIS HIS A . n A 1 307 SER 307 306 ? ? ? A . n A 1 308 LEU 308 307 ? ? ? A . n A 1 309 SER 309 308 ? ? ? A . n A 1 310 PRO 310 309 ? ? ? A . n A 1 311 GLY 311 310 ? ? ? A . n A 1 312 PRO 312 311 ? ? ? A . n A 1 313 SER 313 312 ? ? ? A . n B 2 1 ALA 1 1 ? ? ? B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 LYS 3 3 3 LYS LYS B . n B 2 4 ARG 4 4 4 ARG ARG B . n B 2 5 ARG 5 5 5 ARG ARG B . n B 2 6 ARG 6 6 6 ARG ARG B . n B 2 7 HIS 7 7 7 HIS HIS B . n B 2 8 PRO 8 8 8 PRO PRO B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 GLY 10 10 ? ? ? B . n B 2 11 PRO 11 11 ? ? ? B . n B 2 12 PRO 12 12 ? ? ? B . n B 2 13 THR 13 13 ? ? ? B . n B 2 14 ALA 14 14 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 OD4 1 900 900 OD4 292 A . D 4 GOL 1 901 901 GOL GOL A . E 5 HOH 1 1001 1048 HOH HOH A . E 5 HOH 2 1002 1133 HOH HOH A . E 5 HOH 3 1003 1046 HOH HOH A . E 5 HOH 4 1004 1014 HOH HOH A . E 5 HOH 5 1005 1051 HOH HOH A . E 5 HOH 6 1006 1035 HOH HOH A . E 5 HOH 7 1007 1123 HOH HOH A . E 5 HOH 8 1008 1065 HOH HOH A . E 5 HOH 9 1009 1005 HOH HOH A . E 5 HOH 10 1010 1089 HOH HOH A . E 5 HOH 11 1011 1026 HOH HOH A . E 5 HOH 12 1012 1043 HOH HOH A . E 5 HOH 13 1013 1022 HOH HOH A . E 5 HOH 14 1014 1038 HOH HOH A . E 5 HOH 15 1015 1009 HOH HOH A . E 5 HOH 16 1016 1015 HOH HOH A . E 5 HOH 17 1017 1025 HOH HOH A . E 5 HOH 18 1018 1064 HOH HOH A . E 5 HOH 19 1019 1067 HOH HOH A . E 5 HOH 20 1020 1088 HOH HOH A . E 5 HOH 21 1021 1090 HOH HOH A . E 5 HOH 22 1022 1003 HOH HOH A . E 5 HOH 23 1023 1019 HOH HOH A . E 5 HOH 24 1024 1113 HOH HOH A . E 5 HOH 25 1025 1007 HOH HOH A . E 5 HOH 26 1026 1066 HOH HOH A . E 5 HOH 27 1027 1030 HOH HOH A . E 5 HOH 28 1028 1012 HOH HOH A . E 5 HOH 29 1029 1140 HOH HOH A . E 5 HOH 30 1030 1044 HOH HOH A . E 5 HOH 31 1031 1085 HOH HOH A . E 5 HOH 32 1032 1057 HOH HOH A . E 5 HOH 33 1033 1052 HOH HOH A . E 5 HOH 34 1034 1002 HOH HOH A . E 5 HOH 35 1035 1001 HOH HOH A . E 5 HOH 36 1036 1061 HOH HOH A . E 5 HOH 37 1037 1021 HOH HOH A . E 5 HOH 38 1038 1004 HOH HOH A . E 5 HOH 39 1039 1138 HOH HOH A . E 5 HOH 40 1040 1081 HOH HOH A . E 5 HOH 41 1041 1100 HOH HOH A . E 5 HOH 42 1042 1062 HOH HOH A . E 5 HOH 43 1043 1124 HOH HOH A . E 5 HOH 44 1044 1118 HOH HOH A . E 5 HOH 45 1045 1034 HOH HOH A . E 5 HOH 46 1046 1006 HOH HOH A . E 5 HOH 47 1047 1122 HOH HOH A . E 5 HOH 48 1048 1031 HOH HOH A . E 5 HOH 49 1049 1049 HOH HOH A . E 5 HOH 50 1050 1008 HOH HOH A . E 5 HOH 51 1051 1128 HOH HOH A . E 5 HOH 52 1052 1134 HOH HOH A . E 5 HOH 53 1053 1077 HOH HOH A . E 5 HOH 54 1054 1011 HOH HOH A . E 5 HOH 55 1055 1070 HOH HOH A . E 5 HOH 56 1056 1029 HOH HOH A . E 5 HOH 57 1057 1023 HOH HOH A . E 5 HOH 58 1058 1036 HOH HOH A . E 5 HOH 59 1059 1053 HOH HOH A . E 5 HOH 60 1060 1042 HOH HOH A . E 5 HOH 61 1061 1060 HOH HOH A . E 5 HOH 62 1062 1056 HOH HOH A . E 5 HOH 63 1063 1139 HOH HOH A . E 5 HOH 64 1064 1059 HOH HOH A . E 5 HOH 65 1065 1039 HOH HOH A . E 5 HOH 66 1066 1074 HOH HOH A . E 5 HOH 67 1067 1013 HOH HOH A . E 5 HOH 68 1068 1107 HOH HOH A . E 5 HOH 69 1069 1095 HOH HOH A . E 5 HOH 70 1070 1018 HOH HOH A . E 5 HOH 71 1071 1082 HOH HOH A . E 5 HOH 72 1072 1080 HOH HOH A . E 5 HOH 73 1073 1099 HOH HOH A . E 5 HOH 74 1074 1073 HOH HOH A . E 5 HOH 75 1075 1114 HOH HOH A . E 5 HOH 76 1076 1027 HOH HOH A . E 5 HOH 77 1077 1040 HOH HOH A . E 5 HOH 78 1078 1063 HOH HOH A . E 5 HOH 79 1079 1033 HOH HOH A . E 5 HOH 80 1080 1101 HOH HOH A . E 5 HOH 81 1081 1132 HOH HOH A . E 5 HOH 82 1082 1108 HOH HOH A . E 5 HOH 83 1083 1137 HOH HOH A . E 5 HOH 84 1084 1109 HOH HOH A . E 5 HOH 85 1085 1097 HOH HOH A . E 5 HOH 86 1086 1072 HOH HOH A . E 5 HOH 87 1087 1079 HOH HOH A . F 5 HOH 1 101 1141 HOH HOH B . F 5 HOH 2 102 1096 HOH HOH B . F 5 HOH 3 103 1054 HOH HOH B . F 5 HOH 4 104 1078 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 262 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 261 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-24 2 'Structure model' 1 1 2020-01-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20190315 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2 5 # _pdbx_entry_details.entry_id 6PDN _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 59 ? ? -57.05 -7.22 2 1 ASP A 60 ? ? -171.00 15.06 3 1 THR A 84 ? ? -39.50 116.10 4 1 SER A 97 ? ? -88.59 32.22 5 1 ASP A 167 ? ? -146.34 45.73 6 1 ASP A 186 ? ? 63.69 84.09 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 79 ? CG ? A GLU 80 CG 2 1 Y 1 A GLU 79 ? CD ? A GLU 80 CD 3 1 Y 1 A GLU 79 ? OE1 ? A GLU 80 OE1 4 1 Y 1 A GLU 79 ? OE2 ? A GLU 80 OE2 5 1 Y 1 A ASN 82 ? CG ? A ASN 83 CG 6 1 Y 1 A ASN 82 ? OD1 ? A ASN 83 OD1 7 1 Y 1 A ASN 82 ? ND2 ? A ASN 83 ND2 8 1 Y 1 A THR 84 ? OG1 ? A THR 85 OG1 9 1 Y 1 A THR 84 ? CG2 ? A THR 85 CG2 10 1 Y 1 A ARG 274 ? CG ? A ARG 275 CG 11 1 Y 1 A ARG 274 ? CD ? A ARG 275 CD 12 1 Y 1 A ARG 274 ? NE ? A ARG 275 NE 13 1 Y 1 A ARG 274 ? CZ ? A ARG 275 CZ 14 1 Y 1 A ARG 274 ? NH1 ? A ARG 275 NH1 15 1 Y 1 A ARG 274 ? NH2 ? A ARG 275 NH2 16 1 Y 1 B LYS 3 ? CG ? B LYS 3 CG 17 1 Y 1 B LYS 3 ? CD ? B LYS 3 CD 18 1 Y 1 B LYS 3 ? CE ? B LYS 3 CE 19 1 Y 1 B LYS 3 ? NZ ? B LYS 3 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 0 ? A SER 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A LEU 2 ? A LEU 3 4 1 Y 1 A LEU 3 ? A LEU 4 5 1 Y 1 A SER 4 ? A SER 5 6 1 Y 1 A LYS 5 ? A LYS 6 7 1 Y 1 A ILE 6 ? A ILE 7 8 1 Y 1 A ASN 7 ? A ASN 8 9 1 Y 1 A SER 8 ? A SER 9 10 1 Y 1 A LEU 9 ? A LEU 10 11 1 Y 1 A ALA 10 ? A ALA 11 12 1 Y 1 A HIS 11 ? A HIS 12 13 1 Y 1 A LEU 12 ? A LEU 13 14 1 Y 1 A ARG 13 ? A ARG 14 15 1 Y 1 A ALA 14 ? A ALA 15 16 1 Y 1 A ALA 15 ? A ALA 16 17 1 Y 1 A PRO 16 ? A PRO 17 18 1 Y 1 A CYS 17 ? A CYS 18 19 1 Y 1 A ASN 18 ? A ASN 19 20 1 Y 1 A ASP 19 ? A ASP 20 21 1 Y 1 A LEU 20 ? A LEU 21 22 1 Y 1 A HIS 21 ? A HIS 22 23 1 Y 1 A ALA 22 ? A ALA 23 24 1 Y 1 A THR 23 ? A THR 24 25 1 Y 1 A LYS 24 ? A LYS 25 26 1 Y 1 A LEU 25 ? A LEU 26 27 1 Y 1 A ALA 26 ? A ALA 27 28 1 Y 1 A PRO 27 ? A PRO 28 29 1 Y 1 A GLY 28 ? A GLY 29 30 1 Y 1 A LYS 29 ? A LYS 30 31 1 Y 1 A GLU 30 ? A GLU 31 32 1 Y 1 A LYS 31 ? A LYS 32 33 1 Y 1 A GLY 47 ? A GLY 48 34 1 Y 1 A GLY 48 ? A GLY 49 35 1 Y 1 A PHE 49 ? A PHE 50 36 1 Y 1 A GLY 50 ? A GLY 51 37 1 Y 1 A SER 306 ? A SER 307 38 1 Y 1 A LEU 307 ? A LEU 308 39 1 Y 1 A SER 308 ? A SER 309 40 1 Y 1 A PRO 309 ? A PRO 310 41 1 Y 1 A GLY 310 ? A GLY 311 42 1 Y 1 A PRO 311 ? A PRO 312 43 1 Y 1 A SER 312 ? A SER 313 44 1 Y 1 B ALA 1 ? B ALA 1 45 1 Y 1 B GLY 10 ? B GLY 10 46 1 Y 1 B PRO 11 ? B PRO 11 47 1 Y 1 B PRO 12 ? B PRO 12 48 1 Y 1 B THR 13 ? B THR 13 49 1 Y 1 B ALA 14 ? B ALA 14 # _pdbx_audit_support.funding_organization 'Sao Paulo Research Foundation (FAPESP)' _pdbx_audit_support.country Brazil _pdbx_audit_support.grant_number 13/50724-5 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id OD4 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id OD4 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '4-{5-[(3-aminopropyl)carbamoyl]thiophen-2-yl}-1-benzothiophene-2-carboxylic acid' OD4 4 GLYCEROL GOL 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #