data_6PI4 # _entry.id 6PI4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6PI4 pdb_00006pi4 10.2210/pdb6pi4/pdb WWPDB D_1000242581 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-24 2 'Structure model' 1 1 2024-03-13 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6PI4 _pdbx_database_status.recvd_initial_deposition_date 2019-06-25 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.details . _pdbx_database_related.db_id SSGCID-MysmA.18837.a _pdbx_database_related.content_type unspecified # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of ATP synthase epsion chain ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) from Mycobacterium smegmatis ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abendroth, J.' 1 ? primary 'Dranow, D.M.' 2 ? primary 'Lorimer, D.D.' 3 ? primary 'Horanyi, P.S.' 4 ? primary 'Edwards, T.E.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATP synthase epsilon chain' 14308.896 1 ? ? ? ? 2 non-polymer syn 'CACODYLATE ION' 136.989 1 ? ? ? ? 3 water nat water 18.015 26 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP synthase F1 sector epsilon subunit,F-ATPase epsilon subunit' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMADLNVEIVAVERELWSGPATFVFTRTTAGEIGILPRHIPLVAQLVDDAMVRVEREGEDDLRIAVDGGFLSV TEETVRILVENAQFESEIDADAAKEDAASDDERTAAWGRARLRALGQID ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMADLNVEIVAVERELWSGPATFVFTRTTAGEIGILPRHIPLVAQLVDDAMVRVEREGEDDLRIAVDGGFLSV TEETVRILVENAQFESEIDADAAKEDAASDDERTAAWGRARLRALGQID ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SSGCID-MysmA.18837.a # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CACODYLATE ION' CAC 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 ALA n 1 11 ASP n 1 12 LEU n 1 13 ASN n 1 14 VAL n 1 15 GLU n 1 16 ILE n 1 17 VAL n 1 18 ALA n 1 19 VAL n 1 20 GLU n 1 21 ARG n 1 22 GLU n 1 23 LEU n 1 24 TRP n 1 25 SER n 1 26 GLY n 1 27 PRO n 1 28 ALA n 1 29 THR n 1 30 PHE n 1 31 VAL n 1 32 PHE n 1 33 THR n 1 34 ARG n 1 35 THR n 1 36 THR n 1 37 ALA n 1 38 GLY n 1 39 GLU n 1 40 ILE n 1 41 GLY n 1 42 ILE n 1 43 LEU n 1 44 PRO n 1 45 ARG n 1 46 HIS n 1 47 ILE n 1 48 PRO n 1 49 LEU n 1 50 VAL n 1 51 ALA n 1 52 GLN n 1 53 LEU n 1 54 VAL n 1 55 ASP n 1 56 ASP n 1 57 ALA n 1 58 MET n 1 59 VAL n 1 60 ARG n 1 61 VAL n 1 62 GLU n 1 63 ARG n 1 64 GLU n 1 65 GLY n 1 66 GLU n 1 67 ASP n 1 68 ASP n 1 69 LEU n 1 70 ARG n 1 71 ILE n 1 72 ALA n 1 73 VAL n 1 74 ASP n 1 75 GLY n 1 76 GLY n 1 77 PHE n 1 78 LEU n 1 79 SER n 1 80 VAL n 1 81 THR n 1 82 GLU n 1 83 GLU n 1 84 THR n 1 85 VAL n 1 86 ARG n 1 87 ILE n 1 88 LEU n 1 89 VAL n 1 90 GLU n 1 91 ASN n 1 92 ALA n 1 93 GLN n 1 94 PHE n 1 95 GLU n 1 96 SER n 1 97 GLU n 1 98 ILE n 1 99 ASP n 1 100 ALA n 1 101 ASP n 1 102 ALA n 1 103 ALA n 1 104 LYS n 1 105 GLU n 1 106 ASP n 1 107 ALA n 1 108 ALA n 1 109 SER n 1 110 ASP n 1 111 ASP n 1 112 GLU n 1 113 ARG n 1 114 THR n 1 115 ALA n 1 116 ALA n 1 117 TRP n 1 118 GLY n 1 119 ARG n 1 120 ALA n 1 121 ARG n 1 122 LEU n 1 123 ARG n 1 124 ALA n 1 125 LEU n 1 126 GLY n 1 127 GLN n 1 128 ILE n 1 129 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 129 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'atpC, MSMEG_4935, MSMEI_4808' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700084 / mc(2)155' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 246196 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 7000084 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name MysmA.18337.a.B1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAC non-polymer . 'CACODYLATE ION' dimethylarsinate 'C2 H6 As O2 -1' 136.989 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 ALA 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 HIS 8 0 ? ? ? A . n A 1 9 MET 9 1 ? ? ? A . n A 1 10 ALA 10 2 ? ? ? A . n A 1 11 ASP 11 3 3 ASP ASP A . n A 1 12 LEU 12 4 4 LEU LEU A . n A 1 13 ASN 13 5 5 ASN ASN A . n A 1 14 VAL 14 6 6 VAL VAL A . n A 1 15 GLU 15 7 7 GLU GLU A . n A 1 16 ILE 16 8 8 ILE ILE A . n A 1 17 VAL 17 9 9 VAL VAL A . n A 1 18 ALA 18 10 10 ALA ALA A . n A 1 19 VAL 19 11 11 VAL VAL A . n A 1 20 GLU 20 12 12 GLU GLU A . n A 1 21 ARG 21 13 13 ARG ARG A . n A 1 22 GLU 22 14 14 GLU GLU A . n A 1 23 LEU 23 15 15 LEU LEU A . n A 1 24 TRP 24 16 16 TRP TRP A . n A 1 25 SER 25 17 17 SER SER A . n A 1 26 GLY 26 18 18 GLY GLY A . n A 1 27 PRO 27 19 19 PRO PRO A . n A 1 28 ALA 28 20 20 ALA ALA A . n A 1 29 THR 29 21 21 THR THR A . n A 1 30 PHE 30 22 22 PHE PHE A . n A 1 31 VAL 31 23 23 VAL VAL A . n A 1 32 PHE 32 24 24 PHE PHE A . n A 1 33 THR 33 25 25 THR THR A . n A 1 34 ARG 34 26 26 ARG ARG A . n A 1 35 THR 35 27 27 THR THR A . n A 1 36 THR 36 28 28 THR THR A . n A 1 37 ALA 37 29 29 ALA ALA A . n A 1 38 GLY 38 30 30 GLY GLY A . n A 1 39 GLU 39 31 31 GLU GLU A . n A 1 40 ILE 40 32 32 ILE ILE A . n A 1 41 GLY 41 33 33 GLY GLY A . n A 1 42 ILE 42 34 34 ILE ILE A . n A 1 43 LEU 43 35 35 LEU LEU A . n A 1 44 PRO 44 36 36 PRO PRO A . n A 1 45 ARG 45 37 37 ARG ARG A . n A 1 46 HIS 46 38 38 HIS HIS A . n A 1 47 ILE 47 39 39 ILE ILE A . n A 1 48 PRO 48 40 40 PRO PRO A . n A 1 49 LEU 49 41 41 LEU LEU A . n A 1 50 VAL 50 42 42 VAL VAL A . n A 1 51 ALA 51 43 43 ALA ALA A . n A 1 52 GLN 52 44 44 GLN GLN A . n A 1 53 LEU 53 45 45 LEU LEU A . n A 1 54 VAL 54 46 46 VAL VAL A . n A 1 55 ASP 55 47 47 ASP ASP A . n A 1 56 ASP 56 48 48 ASP ASP A . n A 1 57 ALA 57 49 49 ALA ALA A . n A 1 58 MET 58 50 50 MET MET A . n A 1 59 VAL 59 51 51 VAL VAL A . n A 1 60 ARG 60 52 52 ARG ARG A . n A 1 61 VAL 61 53 53 VAL VAL A . n A 1 62 GLU 62 54 54 GLU GLU A . n A 1 63 ARG 63 55 55 ARG ARG A . n A 1 64 GLU 64 56 56 GLU GLU A . n A 1 65 GLY 65 57 57 GLY GLY A . n A 1 66 GLU 66 58 58 GLU GLU A . n A 1 67 ASP 67 59 59 ASP ASP A . n A 1 68 ASP 68 60 60 ASP ASP A . n A 1 69 LEU 69 61 61 LEU LEU A . n A 1 70 ARG 70 62 62 ARG ARG A . n A 1 71 ILE 71 63 63 ILE ILE A . n A 1 72 ALA 72 64 64 ALA ALA A . n A 1 73 VAL 73 65 65 VAL VAL A . n A 1 74 ASP 74 66 66 ASP ASP A . n A 1 75 GLY 75 67 67 GLY GLY A . n A 1 76 GLY 76 68 68 GLY GLY A . n A 1 77 PHE 77 69 69 PHE PHE A . n A 1 78 LEU 78 70 70 LEU LEU A . n A 1 79 SER 79 71 71 SER SER A . n A 1 80 VAL 80 72 72 VAL VAL A . n A 1 81 THR 81 73 73 THR THR A . n A 1 82 GLU 82 74 74 GLU GLU A . n A 1 83 GLU 83 75 75 GLU GLU A . n A 1 84 THR 84 76 76 THR THR A . n A 1 85 VAL 85 77 77 VAL VAL A . n A 1 86 ARG 86 78 78 ARG ARG A . n A 1 87 ILE 87 79 79 ILE ILE A . n A 1 88 LEU 88 80 80 LEU LEU A . n A 1 89 VAL 89 81 81 VAL VAL A . n A 1 90 GLU 90 82 82 GLU GLU A . n A 1 91 ASN 91 83 83 ASN ASN A . n A 1 92 ALA 92 84 84 ALA ALA A . n A 1 93 GLN 93 85 85 GLN GLN A . n A 1 94 PHE 94 86 86 PHE PHE A . n A 1 95 GLU 95 87 87 GLU GLU A . n A 1 96 SER 96 88 88 SER SER A . n A 1 97 GLU 97 89 89 GLU GLU A . n A 1 98 ILE 98 90 90 ILE ILE A . n A 1 99 ASP 99 91 91 ASP ASP A . n A 1 100 ALA 100 92 92 ALA ALA A . n A 1 101 ASP 101 93 93 ASP ASP A . n A 1 102 ALA 102 94 94 ALA ALA A . n A 1 103 ALA 103 95 95 ALA ALA A . n A 1 104 LYS 104 96 96 LYS LYS A . n A 1 105 GLU 105 97 97 GLU GLU A . n A 1 106 ASP 106 98 98 ASP ASP A . n A 1 107 ALA 107 99 99 ALA ALA A . n A 1 108 ALA 108 100 100 ALA ALA A . n A 1 109 SER 109 101 101 SER SER A . n A 1 110 ASP 110 102 102 ASP ASP A . n A 1 111 ASP 111 103 103 ASP ASP A . n A 1 112 GLU 112 104 104 GLU GLU A . n A 1 113 ARG 113 105 105 ARG ARG A . n A 1 114 THR 114 106 106 THR THR A . n A 1 115 ALA 115 107 107 ALA ALA A . n A 1 116 ALA 116 108 108 ALA ALA A . n A 1 117 TRP 117 109 109 TRP TRP A . n A 1 118 GLY 118 110 110 GLY GLY A . n A 1 119 ARG 119 111 111 ARG ARG A . n A 1 120 ALA 120 112 112 ALA ALA A . n A 1 121 ARG 121 113 113 ARG ARG A . n A 1 122 LEU 122 114 114 LEU LEU A . n A 1 123 ARG 123 115 115 ARG ARG A . n A 1 124 ALA 124 116 116 ALA ALA A . n A 1 125 LEU 125 117 117 LEU LEU A . n A 1 126 GLY 126 118 118 GLY GLY A . n A 1 127 GLN 127 119 119 GLN GLN A . n A 1 128 ILE 128 120 120 ILE ILE A . n A 1 129 ASP 129 121 121 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CAC 1 201 201 CAC CAC A . C 3 HOH 1 301 31 HOH HOH A . C 3 HOH 2 302 6 HOH HOH A . C 3 HOH 3 303 37 HOH HOH A . C 3 HOH 4 304 33 HOH HOH A . C 3 HOH 5 305 2 HOH HOH A . C 3 HOH 6 306 18 HOH HOH A . C 3 HOH 7 307 17 HOH HOH A . C 3 HOH 8 308 22 HOH HOH A . C 3 HOH 9 309 7 HOH HOH A . C 3 HOH 10 310 1 HOH HOH A . C 3 HOH 11 311 27 HOH HOH A . C 3 HOH 12 312 34 HOH HOH A . C 3 HOH 13 313 36 HOH HOH A . C 3 HOH 14 314 23 HOH HOH A . C 3 HOH 15 315 39 HOH HOH A . C 3 HOH 16 316 5 HOH HOH A . C 3 HOH 17 317 12 HOH HOH A . C 3 HOH 18 318 13 HOH HOH A . C 3 HOH 19 319 14 HOH HOH A . C 3 HOH 20 320 25 HOH HOH A . C 3 HOH 21 321 8 HOH HOH A . C 3 HOH 22 322 32 HOH HOH A . C 3 HOH 23 323 19 HOH HOH A . C 3 HOH 24 324 20 HOH HOH A . C 3 HOH 25 325 16 HOH HOH A . C 3 HOH 26 326 38 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 37 ? CG ? A ARG 45 CG 2 1 Y 1 A ARG 37 ? CD ? A ARG 45 CD 3 1 Y 1 A ARG 37 ? NE ? A ARG 45 NE 4 1 Y 1 A ARG 37 ? CZ ? A ARG 45 CZ 5 1 Y 1 A ARG 37 ? NH1 ? A ARG 45 NH1 6 1 Y 1 A ARG 37 ? NH2 ? A ARG 45 NH2 7 1 Y 1 A ILE 39 ? CG1 ? A ILE 47 CG1 8 1 Y 1 A ILE 39 ? CG2 ? A ILE 47 CG2 9 1 Y 1 A ILE 39 ? CD1 ? A ILE 47 CD1 10 1 Y 1 A GLU 74 ? CG ? A GLU 82 CG 11 1 Y 1 A GLU 74 ? CD ? A GLU 82 CD 12 1 Y 1 A GLU 74 ? OE1 ? A GLU 82 OE1 13 1 Y 1 A GLU 74 ? OE2 ? A GLU 82 OE2 14 1 Y 1 A GLU 75 ? CG ? A GLU 83 CG 15 1 Y 1 A GLU 75 ? CD ? A GLU 83 CD 16 1 Y 1 A GLU 75 ? OE1 ? A GLU 83 OE1 17 1 Y 1 A GLU 75 ? OE2 ? A GLU 83 OE2 18 1 Y 1 A LYS 96 ? CG ? A LYS 104 CG 19 1 Y 1 A LYS 96 ? CD ? A LYS 104 CD 20 1 Y 1 A LYS 96 ? CE ? A LYS 104 CE 21 1 Y 1 A LYS 96 ? NZ ? A LYS 104 NZ 22 1 Y 1 A GLU 97 ? CG ? A GLU 105 CG 23 1 Y 1 A GLU 97 ? CD ? A GLU 105 CD 24 1 Y 1 A GLU 97 ? OE1 ? A GLU 105 OE1 25 1 Y 1 A GLU 97 ? OE2 ? A GLU 105 OE2 26 1 Y 1 A ASP 102 ? CG ? A ASP 110 CG 27 1 Y 1 A ASP 102 ? OD1 ? A ASP 110 OD1 28 1 Y 1 A ASP 102 ? OD2 ? A ASP 110 OD2 29 1 Y 1 A ASP 103 ? CG ? A ASP 111 CG 30 1 Y 1 A ASP 103 ? OD1 ? A ASP 111 OD1 31 1 Y 1 A ASP 103 ? OD2 ? A ASP 111 OD2 32 1 Y 1 A GLU 104 ? CG ? A GLU 112 CG 33 1 Y 1 A GLU 104 ? CD ? A GLU 112 CD 34 1 Y 1 A GLU 104 ? OE1 ? A GLU 112 OE1 35 1 Y 1 A GLU 104 ? OE2 ? A GLU 112 OE2 36 1 Y 1 A ARG 105 ? CG ? A ARG 113 CG 37 1 Y 1 A ARG 105 ? CD ? A ARG 113 CD 38 1 Y 1 A ARG 105 ? NE ? A ARG 113 NE 39 1 Y 1 A ARG 105 ? CZ ? A ARG 113 CZ 40 1 Y 1 A ARG 105 ? NH1 ? A ARG 113 NH1 41 1 Y 1 A ARG 105 ? NH2 ? A ARG 113 NH2 42 1 Y 1 A ILE 120 ? CG1 ? A ILE 128 CG1 43 1 Y 1 A ILE 120 ? CG2 ? A ILE 128 CG2 44 1 Y 1 A ILE 120 ? CD1 ? A ILE 128 CD1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_3500)' 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MR-Rosetta ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6PI4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.870 _cell.length_a_esd ? _cell.length_b 75.320 _cell.length_b_esd ? _cell.length_c 71.020 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6PI4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PI4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.2 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;RigakuReagents JCSG+ screen, B10: 50% PEG 200, 200mM MgCl2, 100mM sodium cacodylate pH 6.5: MysmA.18337.a.B1.PS38196 at 17.3mg/ml + 6mM MgCl2 + 6mM ATP. Cryo: direct: tray 290121 B10: puck nww5-5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'C(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 48.139 _reflns.entry_id 6PI4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 43.817 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8662 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.101 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.280 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.010 _reflns.pdbx_scaling_rejects 6 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 52850 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.100 2.150 ? 3.480 ? 3928 638 ? 631 98.900 ? ? ? ? 0.538 ? ? ? ? ? ? ? ? 6.225 ? ? ? ? 0.587 ? ? 1 1 0.959 ? 2.150 2.210 ? 3.770 ? 3796 613 ? 613 100.000 ? ? ? ? 0.490 ? ? ? ? ? ? ? ? 6.192 ? ? ? ? 0.534 ? ? 2 1 0.952 ? 2.210 2.280 ? 4.310 ? 3751 605 ? 597 98.700 ? ? ? ? 0.423 ? ? ? ? ? ? ? ? 6.283 ? ? ? ? 0.462 ? ? 3 1 0.951 ? 2.280 2.350 ? 5.860 ? 3603 588 ? 582 99.000 ? ? ? ? 0.285 ? ? ? ? ? ? ? ? 6.191 ? ? ? ? 0.311 ? ? 4 1 0.984 ? 2.350 2.420 ? 6.100 ? 3521 570 ? 569 99.800 ? ? ? ? 0.266 ? ? ? ? ? ? ? ? 6.188 ? ? ? ? 0.291 ? ? 5 1 0.986 ? 2.420 2.510 ? 7.220 ? 3255 529 ? 524 99.100 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 6.212 ? ? ? ? 0.242 ? ? 6 1 0.989 ? 2.510 2.600 ? 8.020 ? 3288 537 ? 535 99.600 ? ? ? ? 0.196 ? ? ? ? ? ? ? ? 6.146 ? ? ? ? 0.214 ? ? 7 1 0.989 ? 2.600 2.710 ? 9.900 ? 3222 530 ? 526 99.200 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 6.125 ? ? ? ? 0.160 ? ? 8 1 0.995 ? 2.710 2.830 ? 12.810 ? 2989 482 ? 480 99.600 ? ? ? ? 0.118 ? ? ? ? ? ? ? ? 6.227 ? ? ? ? 0.128 ? ? 9 1 0.996 ? 2.830 2.970 ? 15.960 ? 2873 476 ? 475 99.800 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 6.048 ? ? ? ? 0.092 ? ? 10 1 0.998 ? 2.970 3.130 ? 21.170 ? 2716 448 ? 446 99.600 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 6.090 ? ? ? ? 0.072 ? ? 11 1 0.998 ? 3.130 3.320 ? 26.070 ? 2610 437 ? 434 99.300 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 6.014 ? ? ? ? 0.054 ? ? 12 1 0.999 ? 3.320 3.550 ? 30.590 ? 2424 402 ? 400 99.500 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 6.060 ? ? ? ? 0.046 ? ? 13 1 0.999 ? 3.550 3.830 ? 35.390 ? 2238 375 ? 371 98.900 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 6.032 ? ? ? ? 0.040 ? ? 14 1 0.999 ? 3.830 4.200 ? 37.110 ? 2063 348 ? 345 99.100 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 5.980 ? ? ? ? 0.040 ? ? 15 1 0.999 ? 4.200 4.700 ? 42.320 ? 1890 319 ? 317 99.400 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 5.962 ? ? ? ? 0.035 ? ? 16 1 0.999 ? 4.700 5.420 ? 44.200 ? 1665 284 ? 282 99.300 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 5.904 ? ? ? ? 0.035 ? ? 17 1 0.999 ? 5.420 6.640 ? 42.540 ? 1391 242 ? 239 98.800 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 5.820 ? ? ? ? 0.034 ? ? 18 1 0.999 ? 6.640 9.390 ? 45.130 ? 1071 197 ? 191 97.000 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 5.607 ? ? ? ? 0.032 ? ? 19 1 0.998 ? 9.390 43.817 ? 49.050 ? 556 118 ? 105 89.000 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 5.295 ? ? ? ? 0.030 ? ? 20 1 0.997 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 168.090 _refine.B_iso_mean 70.0120 _refine.B_iso_min 32.940 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6PI4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 43.8170 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8631 _refine.ls_number_reflns_R_free 862 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7800 _refine.ls_percent_reflns_R_free 9.9900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2261 _refine.ls_R_factor_R_free 0.2831 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2200 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 0 _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.9700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 43.8170 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 907 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 119 _refine_hist.pdbx_B_iso_mean_ligand 144.40 _refine_hist.pdbx_B_iso_mean_solvent 58.46 _refine_hist.pdbx_number_atoms_protein 876 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.007 ? ? 891 'X-RAY DIFFRACTION' ? f_angle_d 0.806 ? ? 1217 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 17.593 ? ? 530 'X-RAY DIFFRACTION' ? f_chiral_restr 0.055 ? ? 147 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 163 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1000 2.2316 1434 . 160 1274 99.0000 . . . 0.3954 0.0000 0.3366 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.2316 2.4039 1389 . 156 1233 99.0000 . . . 0.3840 0.0000 0.2952 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.4039 2.6458 1419 . 119 1300 99.0000 . . . 0.3380 0.0000 0.2836 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.6458 3.0285 1434 . 134 1300 99.0000 . . . 0.2951 0.0000 0.2511 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.0285 3.8153 1451 . 150 1301 99.0000 . . . 0.2658 0.0000 0.2164 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.8153 43.8261 1504 . 143 1361 98.0000 . . . 0.2489 0.0000 0.1785 . . . . . . 6 . . . # _struct.entry_id 6PI4 _struct.title ;Crystal structure of ATP synthase epsion chain ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) from Mycobacterium smegmatis ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PI4 _struct_keywords.text 'SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, PROTEIN TRANSPORT' _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATPE_MYCS2 _struct_ref.pdbx_db_accession A0R1Z9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADLNVEIVAVERELWSGPATFVFTRTTAGEIGILPRHIPLVAQLVDDAMVRVEREGEDDLRIAVDGGFLSVTEETVRIL VENAQFESEIDADAAKEDAASDDERTAAWGRARLRALGQID ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6PI4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0R1Z9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6PI4 MET A 1 ? UNP A0R1Z9 ? ? 'initiating methionine' -7 1 1 6PI4 ALA A 2 ? UNP A0R1Z9 ? ? 'expression tag' -6 2 1 6PI4 HIS A 3 ? UNP A0R1Z9 ? ? 'expression tag' -5 3 1 6PI4 HIS A 4 ? UNP A0R1Z9 ? ? 'expression tag' -4 4 1 6PI4 HIS A 5 ? UNP A0R1Z9 ? ? 'expression tag' -3 5 1 6PI4 HIS A 6 ? UNP A0R1Z9 ? ? 'expression tag' -2 6 1 6PI4 HIS A 7 ? UNP A0R1Z9 ? ? 'expression tag' -1 7 1 6PI4 HIS A 8 ? UNP A0R1Z9 ? ? 'expression tag' 0 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3890 ? 1 MORE -15 ? 1 'SSA (A^2)' 12150 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 53.8700000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 35.5100000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 99 ? ALA A 108 ? ASP A 91 ALA A 100 1 ? 10 HELX_P HELX_P2 AA2 ASP A 111 ? LEU A 125 ? ASP A 103 LEU A 117 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 38 ? ILE A 42 ? GLY A 30 ILE A 34 AA1 2 PHE A 30 ? THR A 35 ? PHE A 22 THR A 27 AA1 3 MET A 58 ? GLU A 62 ? MET A 50 GLU A 54 AA1 4 LEU A 69 ? ASP A 74 ? LEU A 61 ASP A 66 AA1 5 ASN A 91 ? PHE A 94 ? ASN A 83 PHE A 86 AA2 1 LEU A 49 ? GLN A 52 ? LEU A 41 GLN A 44 AA2 2 PHE A 77 ? VAL A 80 ? PHE A 69 VAL A 72 AA2 3 VAL A 85 ? LEU A 88 ? VAL A 77 LEU A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 38 ? O GLY A 30 N THR A 35 ? N THR A 27 AA1 2 3 N PHE A 32 ? N PHE A 24 O ARG A 60 ? O ARG A 52 AA1 3 4 N VAL A 61 ? N VAL A 53 O LEU A 69 ? O LEU A 61 AA1 4 5 N ASP A 74 ? N ASP A 66 O ASN A 91 ? O ASN A 83 AA2 1 2 N ALA A 51 ? N ALA A 43 O LEU A 78 ? O LEU A 70 AA2 2 3 N PHE A 77 ? N PHE A 69 O LEU A 88 ? O LEU A 80 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CAC _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue CAC A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 15 ? GLU A 7 . ? 1_555 ? 2 AC1 4 GLU A 22 ? GLU A 14 . ? 3_655 ? 3 AC1 4 GLU A 39 ? GLU A 31 . ? 6_554 ? 4 AC1 4 ASP A 129 ? ASP A 121 . ? 6_554 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 48 ? ? -102.83 44.32 2 1 SER A 101 ? ? -56.62 77.12 3 1 ASP A 102 ? ? -64.15 -75.36 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 324 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 27.9105 14.6835 5.3145 0.3855 ? -0.0913 ? -0.0016 ? 0.4748 ? -0.0244 ? 0.4377 ? 7.3042 ? -0.7057 ? 1.9116 ? 2.2680 ? -2.1483 ? 2.3129 ? 0.1286 ? 0.4919 ? -0.7735 ? -0.3891 ? 0.1457 ? 0.3016 ? 1.1563 ? -0.5832 ? -0.3925 ? 2 'X-RAY DIFFRACTION' ? refined 19.0820 18.0890 35.0354 0.3235 ? 0.0112 ? -0.0046 ? 0.5435 ? -0.0075 ? 0.3192 ? 5.7619 ? 0.8235 ? -0.3311 ? 3.8420 ? 2.2969 ? 7.8534 ? -0.0441 ? -0.8948 ? 0.1351 ? 0.1203 ? -0.0414 ? -0.0549 ? -0.0586 ? 0.4178 ? 0.0296 ? 3 'X-RAY DIFFRACTION' ? refined 15.4036 16.8774 33.9687 0.3171 ? 0.0184 ? 0.0512 ? 0.5619 ? -0.0992 ? 0.4180 ? 6.9101 ? -0.4908 ? 0.5251 ? 4.1383 ? 1.2378 ? 8.1316 ? -0.1781 ? -0.5791 ? -0.1974 ? 0.1770 ? 0.0067 ? -0.0189 ? 0.2501 ? -0.3669 ? 0.1365 ? 4 'X-RAY DIFFRACTION' ? refined 21.8053 21.9263 34.4107 0.3151 ? 0.0354 ? 0.0064 ? 0.4234 ? -0.0790 ? 0.4343 ? 7.9069 ? -0.1481 ? 2.0418 ? 4.2682 ? 1.9132 ? 8.1200 ? -0.1605 ? -1.0138 ? -0.0428 ? 0.1320 ? 0.2511 ? -0.1896 ? -0.5435 ? -0.2179 ? -0.1698 ? 5 'X-RAY DIFFRACTION' ? refined 22.9962 21.3576 28.2856 0.5360 ? -0.0612 ? -0.0653 ? 0.4315 ? -0.0180 ? 0.4341 ? 7.8912 ? -0.7195 ? 0.6778 ? 2.8442 ? -1.0613 ? 3.6733 ? 0.0415 ? 0.2835 ? 0.5825 ? 0.6422 ? -0.2810 ? -0.3524 ? -0.6267 ? -0.0408 ? 0.2884 ? 6 'X-RAY DIFFRACTION' ? refined 12.5174 36.9708 21.6753 1.6436 ? 0.3494 ? -0.0977 ? 0.8979 ? 0.1528 ? 1.2477 ? 8.2709 ? -4.6243 ? 4.3577 ? 3.8983 ? -3.9228 ? 3.9734 ? 1.5100 ? 1.8274 ? 0.6027 ? 0.1523 ? -0.3079 ? 0.6543 ? 0.7714 ? -0.4378 ? -1.3325 ? 7 'X-RAY DIFFRACTION' ? refined 13.0678 31.2546 27.4578 1.1773 ? 0.3757 ? -0.0443 ? 0.7154 ? -0.2010 ? 0.7032 ? 9.1159 ? 3.2670 ? 1.7503 ? 5.8941 ? 1.7252 ? 4.2870 ? -0.3607 ? -0.8537 ? 1.2906 ? 0.3519 ? -0.5577 ? 0.9319 ? -2.6017 ? -1.8180 ? 0.7956 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 3 ? ? A 12 ? ;chain 'A' and (resid 3 through 12 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 13 ? ? A 35 ? ;chain 'A' and (resid 13 through 35 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 36 ? ? A 54 ? ;chain 'A' and (resid 36 through 54 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 55 ? ? A 72 ? ;chain 'A' and (resid 55 through 72 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 73 ? ? A 91 ? ;chain 'A' and (resid 73 through 91 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 92 ? ? A 103 ? ;chain 'A' and (resid 92 through 103 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 104 ? ? A 121 ? ;chain 'A' and (resid 104 through 121 ) ; # _pdbx_entry_details.entry_id 6PI4 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A ALA -6 ? A ALA 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A HIS 0 ? A HIS 8 9 1 Y 1 A MET 1 ? A MET 9 10 1 Y 1 A ALA 2 ? A ALA 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CAC AS AS N N 74 CAC O1 O N N 75 CAC O2 O N N 76 CAC C1 C N N 77 CAC C2 C N N 78 CAC H11 H N N 79 CAC H12 H N N 80 CAC H13 H N N 81 CAC H21 H N N 82 CAC H22 H N N 83 CAC H23 H N N 84 GLN N N N N 85 GLN CA C N S 86 GLN C C N N 87 GLN O O N N 88 GLN CB C N N 89 GLN CG C N N 90 GLN CD C N N 91 GLN OE1 O N N 92 GLN NE2 N N N 93 GLN OXT O N N 94 GLN H H N N 95 GLN H2 H N N 96 GLN HA H N N 97 GLN HB2 H N N 98 GLN HB3 H N N 99 GLN HG2 H N N 100 GLN HG3 H N N 101 GLN HE21 H N N 102 GLN HE22 H N N 103 GLN HXT H N N 104 GLU N N N N 105 GLU CA C N S 106 GLU C C N N 107 GLU O O N N 108 GLU CB C N N 109 GLU CG C N N 110 GLU CD C N N 111 GLU OE1 O N N 112 GLU OE2 O N N 113 GLU OXT O N N 114 GLU H H N N 115 GLU H2 H N N 116 GLU HA H N N 117 GLU HB2 H N N 118 GLU HB3 H N N 119 GLU HG2 H N N 120 GLU HG3 H N N 121 GLU HE2 H N N 122 GLU HXT H N N 123 GLY N N N N 124 GLY CA C N N 125 GLY C C N N 126 GLY O O N N 127 GLY OXT O N N 128 GLY H H N N 129 GLY H2 H N N 130 GLY HA2 H N N 131 GLY HA3 H N N 132 GLY HXT H N N 133 HIS N N N N 134 HIS CA C N S 135 HIS C C N N 136 HIS O O N N 137 HIS CB C N N 138 HIS CG C Y N 139 HIS ND1 N Y N 140 HIS CD2 C Y N 141 HIS CE1 C Y N 142 HIS NE2 N Y N 143 HIS OXT O N N 144 HIS H H N N 145 HIS H2 H N N 146 HIS HA H N N 147 HIS HB2 H N N 148 HIS HB3 H N N 149 HIS HD1 H N N 150 HIS HD2 H N N 151 HIS HE1 H N N 152 HIS HE2 H N N 153 HIS HXT H N N 154 HOH O O N N 155 HOH H1 H N N 156 HOH H2 H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CAC AS O1 doub N N 70 CAC AS O2 sing N N 71 CAC AS C1 sing N N 72 CAC AS C2 sing N N 73 CAC C1 H11 sing N N 74 CAC C1 H12 sing N N 75 CAC C1 H13 sing N N 76 CAC C2 H21 sing N N 77 CAC C2 H22 sing N N 78 CAC C2 H23 sing N N 79 GLN N CA sing N N 80 GLN N H sing N N 81 GLN N H2 sing N N 82 GLN CA C sing N N 83 GLN CA CB sing N N 84 GLN CA HA sing N N 85 GLN C O doub N N 86 GLN C OXT sing N N 87 GLN CB CG sing N N 88 GLN CB HB2 sing N N 89 GLN CB HB3 sing N N 90 GLN CG CD sing N N 91 GLN CG HG2 sing N N 92 GLN CG HG3 sing N N 93 GLN CD OE1 doub N N 94 GLN CD NE2 sing N N 95 GLN NE2 HE21 sing N N 96 GLN NE2 HE22 sing N N 97 GLN OXT HXT sing N N 98 GLU N CA sing N N 99 GLU N H sing N N 100 GLU N H2 sing N N 101 GLU CA C sing N N 102 GLU CA CB sing N N 103 GLU CA HA sing N N 104 GLU C O doub N N 105 GLU C OXT sing N N 106 GLU CB CG sing N N 107 GLU CB HB2 sing N N 108 GLU CB HB3 sing N N 109 GLU CG CD sing N N 110 GLU CG HG2 sing N N 111 GLU CG HG3 sing N N 112 GLU CD OE1 doub N N 113 GLU CD OE2 sing N N 114 GLU OE2 HE2 sing N N 115 GLU OXT HXT sing N N 116 GLY N CA sing N N 117 GLY N H sing N N 118 GLY N H2 sing N N 119 GLY CA C sing N N 120 GLY CA HA2 sing N N 121 GLY CA HA3 sing N N 122 GLY C O doub N N 123 GLY C OXT sing N N 124 GLY OXT HXT sing N N 125 HIS N CA sing N N 126 HIS N H sing N N 127 HIS N H2 sing N N 128 HIS CA C sing N N 129 HIS CA CB sing N N 130 HIS CA HA sing N N 131 HIS C O doub N N 132 HIS C OXT sing N N 133 HIS CB CG sing N N 134 HIS CB HB2 sing N N 135 HIS CB HB3 sing N N 136 HIS CG ND1 sing Y N 137 HIS CG CD2 doub Y N 138 HIS ND1 CE1 doub Y N 139 HIS ND1 HD1 sing N N 140 HIS CD2 NE2 sing Y N 141 HIS CD2 HD2 sing N N 142 HIS CE1 NE2 sing Y N 143 HIS CE1 HE1 sing N N 144 HIS NE2 HE2 sing N N 145 HIS OXT HXT sing N N 146 HOH O H1 sing N N 147 HOH O H2 sing N N 148 ILE N CA sing N N 149 ILE N H sing N N 150 ILE N H2 sing N N 151 ILE CA C sing N N 152 ILE CA CB sing N N 153 ILE CA HA sing N N 154 ILE C O doub N N 155 ILE C OXT sing N N 156 ILE CB CG1 sing N N 157 ILE CB CG2 sing N N 158 ILE CB HB sing N N 159 ILE CG1 CD1 sing N N 160 ILE CG1 HG12 sing N N 161 ILE CG1 HG13 sing N N 162 ILE CG2 HG21 sing N N 163 ILE CG2 HG22 sing N N 164 ILE CG2 HG23 sing N N 165 ILE CD1 HD11 sing N N 166 ILE CD1 HD12 sing N N 167 ILE CD1 HD13 sing N N 168 ILE OXT HXT sing N N 169 LEU N CA sing N N 170 LEU N H sing N N 171 LEU N H2 sing N N 172 LEU CA C sing N N 173 LEU CA CB sing N N 174 LEU CA HA sing N N 175 LEU C O doub N N 176 LEU C OXT sing N N 177 LEU CB CG sing N N 178 LEU CB HB2 sing N N 179 LEU CB HB3 sing N N 180 LEU CG CD1 sing N N 181 LEU CG CD2 sing N N 182 LEU CG HG sing N N 183 LEU CD1 HD11 sing N N 184 LEU CD1 HD12 sing N N 185 LEU CD1 HD13 sing N N 186 LEU CD2 HD21 sing N N 187 LEU CD2 HD22 sing N N 188 LEU CD2 HD23 sing N N 189 LEU OXT HXT sing N N 190 LYS N CA sing N N 191 LYS N H sing N N 192 LYS N H2 sing N N 193 LYS CA C sing N N 194 LYS CA CB sing N N 195 LYS CA HA sing N N 196 LYS C O doub N N 197 LYS C OXT sing N N 198 LYS CB CG sing N N 199 LYS CB HB2 sing N N 200 LYS CB HB3 sing N N 201 LYS CG CD sing N N 202 LYS CG HG2 sing N N 203 LYS CG HG3 sing N N 204 LYS CD CE sing N N 205 LYS CD HD2 sing N N 206 LYS CD HD3 sing N N 207 LYS CE NZ sing N N 208 LYS CE HE2 sing N N 209 LYS CE HE3 sing N N 210 LYS NZ HZ1 sing N N 211 LYS NZ HZ2 sing N N 212 LYS NZ HZ3 sing N N 213 LYS OXT HXT sing N N 214 MET N CA sing N N 215 MET N H sing N N 216 MET N H2 sing N N 217 MET CA C sing N N 218 MET CA CB sing N N 219 MET CA HA sing N N 220 MET C O doub N N 221 MET C OXT sing N N 222 MET CB CG sing N N 223 MET CB HB2 sing N N 224 MET CB HB3 sing N N 225 MET CG SD sing N N 226 MET CG HG2 sing N N 227 MET CG HG3 sing N N 228 MET SD CE sing N N 229 MET CE HE1 sing N N 230 MET CE HE2 sing N N 231 MET CE HE3 sing N N 232 MET OXT HXT sing N N 233 PHE N CA sing N N 234 PHE N H sing N N 235 PHE N H2 sing N N 236 PHE CA C sing N N 237 PHE CA CB sing N N 238 PHE CA HA sing N N 239 PHE C O doub N N 240 PHE C OXT sing N N 241 PHE CB CG sing N N 242 PHE CB HB2 sing N N 243 PHE CB HB3 sing N N 244 PHE CG CD1 doub Y N 245 PHE CG CD2 sing Y N 246 PHE CD1 CE1 sing Y N 247 PHE CD1 HD1 sing N N 248 PHE CD2 CE2 doub Y N 249 PHE CD2 HD2 sing N N 250 PHE CE1 CZ doub Y N 251 PHE CE1 HE1 sing N N 252 PHE CE2 CZ sing Y N 253 PHE CE2 HE2 sing N N 254 PHE CZ HZ sing N N 255 PHE OXT HXT sing N N 256 PRO N CA sing N N 257 PRO N CD sing N N 258 PRO N H sing N N 259 PRO CA C sing N N 260 PRO CA CB sing N N 261 PRO CA HA sing N N 262 PRO C O doub N N 263 PRO C OXT sing N N 264 PRO CB CG sing N N 265 PRO CB HB2 sing N N 266 PRO CB HB3 sing N N 267 PRO CG CD sing N N 268 PRO CG HG2 sing N N 269 PRO CG HG3 sing N N 270 PRO CD HD2 sing N N 271 PRO CD HD3 sing N N 272 PRO OXT HXT sing N N 273 SER N CA sing N N 274 SER N H sing N N 275 SER N H2 sing N N 276 SER CA C sing N N 277 SER CA CB sing N N 278 SER CA HA sing N N 279 SER C O doub N N 280 SER C OXT sing N N 281 SER CB OG sing N N 282 SER CB HB2 sing N N 283 SER CB HB3 sing N N 284 SER OG HG sing N N 285 SER OXT HXT sing N N 286 THR N CA sing N N 287 THR N H sing N N 288 THR N H2 sing N N 289 THR CA C sing N N 290 THR CA CB sing N N 291 THR CA HA sing N N 292 THR C O doub N N 293 THR C OXT sing N N 294 THR CB OG1 sing N N 295 THR CB CG2 sing N N 296 THR CB HB sing N N 297 THR OG1 HG1 sing N N 298 THR CG2 HG21 sing N N 299 THR CG2 HG22 sing N N 300 THR CG2 HG23 sing N N 301 THR OXT HXT sing N N 302 TRP N CA sing N N 303 TRP N H sing N N 304 TRP N H2 sing N N 305 TRP CA C sing N N 306 TRP CA CB sing N N 307 TRP CA HA sing N N 308 TRP C O doub N N 309 TRP C OXT sing N N 310 TRP CB CG sing N N 311 TRP CB HB2 sing N N 312 TRP CB HB3 sing N N 313 TRP CG CD1 doub Y N 314 TRP CG CD2 sing Y N 315 TRP CD1 NE1 sing Y N 316 TRP CD1 HD1 sing N N 317 TRP CD2 CE2 doub Y N 318 TRP CD2 CE3 sing Y N 319 TRP NE1 CE2 sing Y N 320 TRP NE1 HE1 sing N N 321 TRP CE2 CZ2 sing Y N 322 TRP CE3 CZ3 doub Y N 323 TRP CE3 HE3 sing N N 324 TRP CZ2 CH2 doub Y N 325 TRP CZ2 HZ2 sing N N 326 TRP CZ3 CH2 sing Y N 327 TRP CZ3 HZ3 sing N N 328 TRP CH2 HH2 sing N N 329 TRP OXT HXT sing N N 330 VAL N CA sing N N 331 VAL N H sing N N 332 VAL N H2 sing N N 333 VAL CA C sing N N 334 VAL CA CB sing N N 335 VAL CA HA sing N N 336 VAL C O doub N N 337 VAL C OXT sing N N 338 VAL CB CG1 sing N N 339 VAL CB CG2 sing N N 340 VAL CB HB sing N N 341 VAL CG1 HG11 sing N N 342 VAL CG1 HG12 sing N N 343 VAL CG1 HG13 sing N N 344 VAL CG2 HG21 sing N N 345 VAL CG2 HG22 sing N N 346 VAL CG2 HG23 sing N N 347 VAL OXT HXT sing N N 348 # loop_ _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.details 2E5Y 1 ? 'experimental model' PDB 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' 1FS0 2 ? 'experimental model' PDB 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' 6F5D 3 ? 'experimental model' PDB 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' 5IK2 4 ? 'experimental model' PDB 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' 6FKF 5 ? 'experimental model' PDB 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' 6FOC 6 ? 'experimental model' PDB 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' 5DN6 7 ? 'experimental model' PDB 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' 5ZWL 8 ? 'experimental model' PDB 'MR-Rosetta using top 8 hhm hits: 6FOC_H, 1FS0_E, 6FKF_E, 5IK2_P, 5DN6_I, 5ZWL_E, 2E5Y_H, 6F5D_H' # _atom_sites.entry_id 6PI4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018563 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013277 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014081 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol AS C N O S # loop_