data_6PV2 # _entry.id 6PV2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6PV2 pdb_00006pv2 10.2210/pdb6pv2/pdb WWPDB D_1000243147 ? ? BMRB 30643 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'structure of native sequence' 1VA2 unspecified PDB 'structure of native sequence' 1SP2 unspecified BMRB 'Backbone-modified variant of zinc finger 2 from the transcription factor Sp1 DNA binding domain: Orn in the metal-binding turn' 30643 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6PV2 _pdbx_database_status.recvd_initial_deposition_date 2019-07-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rao, S.R.' 1 ? 'Horne, W.S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Pept Sci (Hoboken)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2475-8817 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 112 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Proteomimetic Zinc Finger Domains with Modified Metal-binding beta-Turns.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pep2.24177 _citation.pdbx_database_id_PubMed 33733039 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rao, S.R.' 1 ? primary 'Horne, W.S.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Transcription factor Sp1' 3697.285 1 ? ? 'DNA-binding domain, zinc finger 2 residues 654-684' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'RPF(NLE)CTW(ORN)CGKRFTRSDELQRHKRTHTGEK(NH2)' _entity_poly.pdbx_seq_one_letter_code_can RPFLCTWACGKRFTRSDELQRHKRTHTGEKX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 PRO n 1 3 PHE n 1 4 NLE n 1 5 CYS n 1 6 THR n 1 7 TRP n 1 8 ORN n 1 9 CYS n 1 10 GLY n 1 11 LYS n 1 12 ARG n 1 13 PHE n 1 14 THR n 1 15 ARG n 1 16 SER n 1 17 ASP n 1 18 GLU n 1 19 LEU n 1 20 GLN n 1 21 ARG n 1 22 HIS n 1 23 LYS n 1 24 ARG n 1 25 THR n 1 26 HIS n 1 27 THR n 1 28 GLY n 1 29 GLU n 1 30 LYS n 1 31 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 31 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SP1_HUMAN _struct_ref.pdbx_db_accession P08047 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RPFMCTWSYCGKRFTRSDELQRHKRTHTGEK _struct_ref.pdbx_align_begin 654 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6PV2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08047 _struct_ref_seq.db_align_beg 654 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 684 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6PV2 NLE A 4 ? UNP P08047 MET 657 conflict 4 1 1 6PV2 ORN A 8 ? UNP P08047 SER 661 conflict 8 2 1 6PV2 ? A ? ? UNP P08047 TYR 662 deletion ? 3 1 6PV2 NH2 A 31 ? UNP P08047 ? ? amidation 31 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 NLE 'L-peptide linking' n NORLEUCINE ? 'C6 H13 N O2' 131.173 ORN 'L-peptide linking' n L-ornithine ? 'C5 H12 N2 O2' 132.161 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H COSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH* _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.2 mM zinc finger 2 from transcription factor Sp1 DNA-binding domain, Orn turn variant, 10 mM [U-2H] TRIS, 0.05 mM DSS, 1.8 mM zinc chloride, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6PV2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 6PV2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6PV2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'data analysis' Sparky ? Goddard 3 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; 4 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6PV2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6PV2 _struct.title 'Backbone-modified variant of zinc finger 2 from the transcription factor Sp1 DNA binding domain: Orn in the metal-binding turn' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6PV2 _struct_keywords.text 'zinc finger, proteomimetic, foldamer, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 24 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 15 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 24 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 3 C ? ? ? 1_555 A NLE 4 N ? ? A PHE 3 A NLE 4 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale2 covale both ? A NLE 4 C ? ? ? 1_555 A CYS 5 N ? ? A NLE 4 A CYS 5 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale3 covale both ? A TRP 7 C ? ? ? 1_555 A ORN 8 NE ? ? A TRP 7 A ORN 8 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A ORN 8 C ? ? ? 1_555 A CYS 9 N ? ? A ORN 8 A CYS 9 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale5 covale both ? A LYS 30 C ? ? ? 1_555 A NH2 31 N ? ? A LYS 30 A NH2 31 1_555 ? ? ? ? ? ? ? 1.320 ? ? metalc1 metalc ? ? A CYS 5 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 5 A ZN 101 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 9 A ZN 101 1_555 ? ? ? ? ? ? ? 2.295 ? ? metalc3 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 22 A ZN 101 1_555 ? ? ? ? ? ? ? 1.987 ? ? metalc4 metalc ? ? A HIS 26 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 101 1_555 ? ? ? ? ? ? ? 2.003 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 3 ? NLE A 4 ? PHE A 3 NLE A 4 AA1 2 ARG A 12 ? PHE A 13 ? ARG A 12 PHE A 13 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 3 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 3 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 13 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 13 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 5 ? CYS A 5 . ? 1_555 ? 2 AC1 4 CYS A 9 ? CYS A 9 . ? 1_555 ? 3 AC1 4 HIS A 22 ? HIS A 22 . ? 1_555 ? 4 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? # _atom_sites.entry_id 6PV2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 NLE 4 4 4 NLE NLE A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ORN 8 8 8 ORN ORN A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 NH2 31 31 31 NH2 NH2 A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 32 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 5 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 9 ? A CYS 9 ? 1_555 111.0 ? 2 SG ? A CYS 5 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 109.5 ? 3 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 109.4 ? 4 SG ? A CYS 5 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 107.9 ? 5 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 111.2 ? 6 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 107.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-24 2 'Structure model' 1 1 2021-03-31 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' struct_conn 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_struct_conn.conn_type_id' 8 2 'Structure model' '_struct_conn.id' 9 2 'Structure model' '_struct_conn.pdbx_dist_value' 10 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 11 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 12 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 13 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 2 'Structure model' '_struct_conn.ptnr2_label_seq_id' 22 3 'Structure model' '_database_2.pdbx_DOI' 23 3 'Structure model' '_database_2.pdbx_database_accession' 24 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 6PV2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'zinc finger 2 from transcription factor Sp1 DNA-binding domain, Orn turn variant' 1.2 ? mM 'natural abundance' 1 TRIS 10 ? mM '[U-2H]' 1 DSS 0.05 ? mM 'natural abundance' 1 'zinc chloride' 1.8 ? mM 'natural abundance' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HIS _pdbx_validate_close_contact.auth_seq_id_1 22 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 25 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 6 ? ? -143.11 54.21 2 6 THR A 27 ? ? -106.23 66.65 3 9 GLU A 29 ? ? -140.98 -32.24 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASP N N N N 28 ASP CA C N S 29 ASP C C N N 30 ASP O O N N 31 ASP CB C N N 32 ASP CG C N N 33 ASP OD1 O N N 34 ASP OD2 O N N 35 ASP OXT O N N 36 ASP H H N N 37 ASP H2 H N N 38 ASP HA H N N 39 ASP HB2 H N N 40 ASP HB3 H N N 41 ASP HD2 H N N 42 ASP HXT H N N 43 CYS N N N N 44 CYS CA C N R 45 CYS C C N N 46 CYS O O N N 47 CYS CB C N N 48 CYS SG S N N 49 CYS OXT O N N 50 CYS H H N N 51 CYS H2 H N N 52 CYS HA H N N 53 CYS HB2 H N N 54 CYS HB3 H N N 55 CYS HG H N N 56 CYS HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 HIS N N N N 107 HIS CA C N S 108 HIS C C N N 109 HIS O O N N 110 HIS CB C N N 111 HIS CG C Y N 112 HIS ND1 N Y N 113 HIS CD2 C Y N 114 HIS CE1 C Y N 115 HIS NE2 N Y N 116 HIS OXT O N N 117 HIS H H N N 118 HIS H2 H N N 119 HIS HA H N N 120 HIS HB2 H N N 121 HIS HB3 H N N 122 HIS HD1 H N N 123 HIS HD2 H N N 124 HIS HE1 H N N 125 HIS HE2 H N N 126 HIS HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 MET N N N N 175 MET CA C N S 176 MET C C N N 177 MET O O N N 178 MET CB C N N 179 MET CG C N N 180 MET SD S N N 181 MET CE C N N 182 MET OXT O N N 183 MET H H N N 184 MET H2 H N N 185 MET HA H N N 186 MET HB2 H N N 187 MET HB3 H N N 188 MET HG2 H N N 189 MET HG3 H N N 190 MET HE1 H N N 191 MET HE2 H N N 192 MET HE3 H N N 193 MET HXT H N N 194 NH2 N N N N 195 NH2 HN1 H N N 196 NH2 HN2 H N N 197 NLE N N N N 198 NLE CA C N S 199 NLE C C N N 200 NLE O O N N 201 NLE OXT O N N 202 NLE CB C N N 203 NLE CG C N N 204 NLE CD C N N 205 NLE CE C N N 206 NLE H H N N 207 NLE H2 H N N 208 NLE HA H N N 209 NLE HXT H N N 210 NLE HB2 H N N 211 NLE HB3 H N N 212 NLE HG2 H N N 213 NLE HG3 H N N 214 NLE HD2 H N N 215 NLE HD3 H N N 216 NLE HE1 H N N 217 NLE HE2 H N N 218 NLE HE3 H N N 219 ORN N N N N 220 ORN CA C N S 221 ORN CB C N N 222 ORN CG C N N 223 ORN CD C N N 224 ORN NE N N N 225 ORN C C N N 226 ORN O O N N 227 ORN OXT O N N 228 ORN H H N N 229 ORN H2 H N N 230 ORN HA H N N 231 ORN HB2 H N N 232 ORN HB3 H N N 233 ORN HG2 H N N 234 ORN HG3 H N N 235 ORN HD2 H N N 236 ORN HD3 H N N 237 ORN HE1 H N N 238 ORN HE2 H N N 239 ORN HXT H N N 240 PHE N N N N 241 PHE CA C N S 242 PHE C C N N 243 PHE O O N N 244 PHE CB C N N 245 PHE CG C Y N 246 PHE CD1 C Y N 247 PHE CD2 C Y N 248 PHE CE1 C Y N 249 PHE CE2 C Y N 250 PHE CZ C Y N 251 PHE OXT O N N 252 PHE H H N N 253 PHE H2 H N N 254 PHE HA H N N 255 PHE HB2 H N N 256 PHE HB3 H N N 257 PHE HD1 H N N 258 PHE HD2 H N N 259 PHE HE1 H N N 260 PHE HE2 H N N 261 PHE HZ H N N 262 PHE HXT H N N 263 PRO N N N N 264 PRO CA C N S 265 PRO C C N N 266 PRO O O N N 267 PRO CB C N N 268 PRO CG C N N 269 PRO CD C N N 270 PRO OXT O N N 271 PRO H H N N 272 PRO HA H N N 273 PRO HB2 H N N 274 PRO HB3 H N N 275 PRO HG2 H N N 276 PRO HG3 H N N 277 PRO HD2 H N N 278 PRO HD3 H N N 279 PRO HXT H N N 280 SER N N N N 281 SER CA C N S 282 SER C C N N 283 SER O O N N 284 SER CB C N N 285 SER OG O N N 286 SER OXT O N N 287 SER H H N N 288 SER H2 H N N 289 SER HA H N N 290 SER HB2 H N N 291 SER HB3 H N N 292 SER HG H N N 293 SER HXT H N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TRP N N N N 312 TRP CA C N S 313 TRP C C N N 314 TRP O O N N 315 TRP CB C N N 316 TRP CG C Y N 317 TRP CD1 C Y N 318 TRP CD2 C Y N 319 TRP NE1 N Y N 320 TRP CE2 C Y N 321 TRP CE3 C Y N 322 TRP CZ2 C Y N 323 TRP CZ3 C Y N 324 TRP CH2 C Y N 325 TRP OXT O N N 326 TRP H H N N 327 TRP H2 H N N 328 TRP HA H N N 329 TRP HB2 H N N 330 TRP HB3 H N N 331 TRP HD1 H N N 332 TRP HE1 H N N 333 TRP HE3 H N N 334 TRP HZ2 H N N 335 TRP HZ3 H N N 336 TRP HH2 H N N 337 TRP HXT H N N 338 TYR N N N N 339 TYR CA C N S 340 TYR C C N N 341 TYR O O N N 342 TYR CB C N N 343 TYR CG C Y N 344 TYR CD1 C Y N 345 TYR CD2 C Y N 346 TYR CE1 C Y N 347 TYR CE2 C Y N 348 TYR CZ C Y N 349 TYR OH O N N 350 TYR OXT O N N 351 TYR H H N N 352 TYR H2 H N N 353 TYR HA H N N 354 TYR HB2 H N N 355 TYR HB3 H N N 356 TYR HD1 H N N 357 TYR HD2 H N N 358 TYR HE1 H N N 359 TYR HE2 H N N 360 TYR HH H N N 361 TYR HXT H N N 362 ZN ZN ZN N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASP N CA sing N N 27 ASP N H sing N N 28 ASP N H2 sing N N 29 ASP CA C sing N N 30 ASP CA CB sing N N 31 ASP CA HA sing N N 32 ASP C O doub N N 33 ASP C OXT sing N N 34 ASP CB CG sing N N 35 ASP CB HB2 sing N N 36 ASP CB HB3 sing N N 37 ASP CG OD1 doub N N 38 ASP CG OD2 sing N N 39 ASP OD2 HD2 sing N N 40 ASP OXT HXT sing N N 41 CYS N CA sing N N 42 CYS N H sing N N 43 CYS N H2 sing N N 44 CYS CA C sing N N 45 CYS CA CB sing N N 46 CYS CA HA sing N N 47 CYS C O doub N N 48 CYS C OXT sing N N 49 CYS CB SG sing N N 50 CYS CB HB2 sing N N 51 CYS CB HB3 sing N N 52 CYS SG HG sing N N 53 CYS OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 HIS N CA sing N N 101 HIS N H sing N N 102 HIS N H2 sing N N 103 HIS CA C sing N N 104 HIS CA CB sing N N 105 HIS CA HA sing N N 106 HIS C O doub N N 107 HIS C OXT sing N N 108 HIS CB CG sing N N 109 HIS CB HB2 sing N N 110 HIS CB HB3 sing N N 111 HIS CG ND1 sing Y N 112 HIS CG CD2 doub Y N 113 HIS ND1 CE1 doub Y N 114 HIS ND1 HD1 sing N N 115 HIS CD2 NE2 sing Y N 116 HIS CD2 HD2 sing N N 117 HIS CE1 NE2 sing Y N 118 HIS CE1 HE1 sing N N 119 HIS NE2 HE2 sing N N 120 HIS OXT HXT sing N N 121 LEU N CA sing N N 122 LEU N H sing N N 123 LEU N H2 sing N N 124 LEU CA C sing N N 125 LEU CA CB sing N N 126 LEU CA HA sing N N 127 LEU C O doub N N 128 LEU C OXT sing N N 129 LEU CB CG sing N N 130 LEU CB HB2 sing N N 131 LEU CB HB3 sing N N 132 LEU CG CD1 sing N N 133 LEU CG CD2 sing N N 134 LEU CG HG sing N N 135 LEU CD1 HD11 sing N N 136 LEU CD1 HD12 sing N N 137 LEU CD1 HD13 sing N N 138 LEU CD2 HD21 sing N N 139 LEU CD2 HD22 sing N N 140 LEU CD2 HD23 sing N N 141 LEU OXT HXT sing N N 142 LYS N CA sing N N 143 LYS N H sing N N 144 LYS N H2 sing N N 145 LYS CA C sing N N 146 LYS CA CB sing N N 147 LYS CA HA sing N N 148 LYS C O doub N N 149 LYS C OXT sing N N 150 LYS CB CG sing N N 151 LYS CB HB2 sing N N 152 LYS CB HB3 sing N N 153 LYS CG CD sing N N 154 LYS CG HG2 sing N N 155 LYS CG HG3 sing N N 156 LYS CD CE sing N N 157 LYS CD HD2 sing N N 158 LYS CD HD3 sing N N 159 LYS CE NZ sing N N 160 LYS CE HE2 sing N N 161 LYS CE HE3 sing N N 162 LYS NZ HZ1 sing N N 163 LYS NZ HZ2 sing N N 164 LYS NZ HZ3 sing N N 165 LYS OXT HXT sing N N 166 MET N CA sing N N 167 MET N H sing N N 168 MET N H2 sing N N 169 MET CA C sing N N 170 MET CA CB sing N N 171 MET CA HA sing N N 172 MET C O doub N N 173 MET C OXT sing N N 174 MET CB CG sing N N 175 MET CB HB2 sing N N 176 MET CB HB3 sing N N 177 MET CG SD sing N N 178 MET CG HG2 sing N N 179 MET CG HG3 sing N N 180 MET SD CE sing N N 181 MET CE HE1 sing N N 182 MET CE HE2 sing N N 183 MET CE HE3 sing N N 184 MET OXT HXT sing N N 185 NH2 N HN1 sing N N 186 NH2 N HN2 sing N N 187 NLE N CA sing N N 188 NLE N H sing N N 189 NLE N H2 sing N N 190 NLE CA C sing N N 191 NLE CA CB sing N N 192 NLE CA HA sing N N 193 NLE C O doub N N 194 NLE C OXT sing N N 195 NLE OXT HXT sing N N 196 NLE CB CG sing N N 197 NLE CB HB2 sing N N 198 NLE CB HB3 sing N N 199 NLE CG CD sing N N 200 NLE CG HG2 sing N N 201 NLE CG HG3 sing N N 202 NLE CD CE sing N N 203 NLE CD HD2 sing N N 204 NLE CD HD3 sing N N 205 NLE CE HE1 sing N N 206 NLE CE HE2 sing N N 207 NLE CE HE3 sing N N 208 ORN N CA sing N N 209 ORN N H sing N N 210 ORN N H2 sing N N 211 ORN CA CB sing N N 212 ORN CA C sing N N 213 ORN CA HA sing N N 214 ORN CB CG sing N N 215 ORN CB HB2 sing N N 216 ORN CB HB3 sing N N 217 ORN CG CD sing N N 218 ORN CG HG2 sing N N 219 ORN CG HG3 sing N N 220 ORN CD NE sing N N 221 ORN CD HD2 sing N N 222 ORN CD HD3 sing N N 223 ORN NE HE1 sing N N 224 ORN NE HE2 sing N N 225 ORN C O doub N N 226 ORN C OXT sing N N 227 ORN OXT HXT sing N N 228 PHE N CA sing N N 229 PHE N H sing N N 230 PHE N H2 sing N N 231 PHE CA C sing N N 232 PHE CA CB sing N N 233 PHE CA HA sing N N 234 PHE C O doub N N 235 PHE C OXT sing N N 236 PHE CB CG sing N N 237 PHE CB HB2 sing N N 238 PHE CB HB3 sing N N 239 PHE CG CD1 doub Y N 240 PHE CG CD2 sing Y N 241 PHE CD1 CE1 sing Y N 242 PHE CD1 HD1 sing N N 243 PHE CD2 CE2 doub Y N 244 PHE CD2 HD2 sing N N 245 PHE CE1 CZ doub Y N 246 PHE CE1 HE1 sing N N 247 PHE CE2 CZ sing Y N 248 PHE CE2 HE2 sing N N 249 PHE CZ HZ sing N N 250 PHE OXT HXT sing N N 251 PRO N CA sing N N 252 PRO N CD sing N N 253 PRO N H sing N N 254 PRO CA C sing N N 255 PRO CA CB sing N N 256 PRO CA HA sing N N 257 PRO C O doub N N 258 PRO C OXT sing N N 259 PRO CB CG sing N N 260 PRO CB HB2 sing N N 261 PRO CB HB3 sing N N 262 PRO CG CD sing N N 263 PRO CG HG2 sing N N 264 PRO CG HG3 sing N N 265 PRO CD HD2 sing N N 266 PRO CD HD3 sing N N 267 PRO OXT HXT sing N N 268 SER N CA sing N N 269 SER N H sing N N 270 SER N H2 sing N N 271 SER CA C sing N N 272 SER CA CB sing N N 273 SER CA HA sing N N 274 SER C O doub N N 275 SER C OXT sing N N 276 SER CB OG sing N N 277 SER CB HB2 sing N N 278 SER CB HB3 sing N N 279 SER OG HG sing N N 280 SER OXT HXT sing N N 281 THR N CA sing N N 282 THR N H sing N N 283 THR N H2 sing N N 284 THR CA C sing N N 285 THR CA CB sing N N 286 THR CA HA sing N N 287 THR C O doub N N 288 THR C OXT sing N N 289 THR CB OG1 sing N N 290 THR CB CG2 sing N N 291 THR CB HB sing N N 292 THR OG1 HG1 sing N N 293 THR CG2 HG21 sing N N 294 THR CG2 HG22 sing N N 295 THR CG2 HG23 sing N N 296 THR OXT HXT sing N N 297 TRP N CA sing N N 298 TRP N H sing N N 299 TRP N H2 sing N N 300 TRP CA C sing N N 301 TRP CA CB sing N N 302 TRP CA HA sing N N 303 TRP C O doub N N 304 TRP C OXT sing N N 305 TRP CB CG sing N N 306 TRP CB HB2 sing N N 307 TRP CB HB3 sing N N 308 TRP CG CD1 doub Y N 309 TRP CG CD2 sing Y N 310 TRP CD1 NE1 sing Y N 311 TRP CD1 HD1 sing N N 312 TRP CD2 CE2 doub Y N 313 TRP CD2 CE3 sing Y N 314 TRP NE1 CE2 sing Y N 315 TRP NE1 HE1 sing N N 316 TRP CE2 CZ2 sing Y N 317 TRP CE3 CZ3 doub Y N 318 TRP CE3 HE3 sing N N 319 TRP CZ2 CH2 doub Y N 320 TRP CZ2 HZ2 sing N N 321 TRP CZ3 CH2 sing Y N 322 TRP CZ3 HZ3 sing N N 323 TRP CH2 HH2 sing N N 324 TRP OXT HXT sing N N 325 TYR N CA sing N N 326 TYR N H sing N N 327 TYR N H2 sing N N 328 TYR CA C sing N N 329 TYR CA CB sing N N 330 TYR CA HA sing N N 331 TYR C O doub N N 332 TYR C OXT sing N N 333 TYR CB CG sing N N 334 TYR CB HB2 sing N N 335 TYR CB HB3 sing N N 336 TYR CG CD1 doub Y N 337 TYR CG CD2 sing Y N 338 TYR CD1 CE1 sing Y N 339 TYR CD1 HD1 sing N N 340 TYR CD2 CE2 doub Y N 341 TYR CD2 HD2 sing N N 342 TYR CE1 CZ doub Y N 343 TYR CE1 HE1 sing N N 344 TYR CE2 CZ sing Y N 345 TYR CE2 HE2 sing N N 346 TYR CZ OH sing N N 347 TYR OH HH sing N N 348 TYR OXT HXT sing N N 349 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01GM107161 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ORN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ORN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #