data_6QH4 # _entry.id 6QH4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QH4 pdb_00006qh4 10.2210/pdb6qh4/pdb WWPDB D_1292100139 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-02-27 2 'Structure model' 1 1 2019-11-20 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_struct_conn_angle 2 2 'Structure model' struct_conn 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.pdbx_dist_value' 4 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 5 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6QH4 _pdbx_database_status.recvd_initial_deposition_date 2019-01-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bailey, H.J.' 1 ? 'Chaikuid, A.' 2 ? 'Krysztofinska, E.' 3 ? 'Froese, D.S.' 4 ? 'Sorrell, F.J.' 5 ? 'Diaz-Saez, L.' 6 ? 'Kennedy, E.' 7 ? 'Edwards, A.M.' 8 ? 'Bountra, C.' 9 ? 'Yue, W.W.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of human Methylmalonyl-CoA epimerase (MCEE) p.Arg143Cys variant' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bailey, H.J.' 1 ? primary 'Chaikuid, A.' 2 ? primary 'Krysztofinska, E.' 3 ? primary 'Froese, D.S.' 4 ? primary 'Sorrell, F.J.' 5 ? primary 'Diaz-Saez, L.' 6 ? primary 'Kennedy, E.' 7 ? primary 'Edwards, A.M.' 8 ? primary 'Bountra, C.' 9 ? primary 'Yue, W.W.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methylmalonyl-CoA epimerase, mitochondrial' 16799.504 4 5.1.99.1 ? ? ? 2 non-polymer nat 'COBALT (II) ION' 58.933 4 ? ? ? ? 3 water nat water 18.015 90 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DL-methylmalonyl-CoA racemase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSMLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHP LGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKICSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHP LGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKICSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA ; _entity_poly.pdbx_strand_id C,A,B,D _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COBALT (II) ION' CO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MET n 1 24 LEU n 1 25 GLY n 1 26 ARG n 1 27 LEU n 1 28 ASN n 1 29 HIS n 1 30 VAL n 1 31 ALA n 1 32 ILE n 1 33 ALA n 1 34 VAL n 1 35 PRO n 1 36 ASP n 1 37 LEU n 1 38 GLU n 1 39 LYS n 1 40 ALA n 1 41 ALA n 1 42 ALA n 1 43 PHE n 1 44 TYR n 1 45 LYS n 1 46 ASN n 1 47 ILE n 1 48 LEU n 1 49 GLY n 1 50 ALA n 1 51 GLN n 1 52 VAL n 1 53 SER n 1 54 GLU n 1 55 ALA n 1 56 VAL n 1 57 PRO n 1 58 LEU n 1 59 PRO n 1 60 GLU n 1 61 HIS n 1 62 GLY n 1 63 VAL n 1 64 SER n 1 65 VAL n 1 66 VAL n 1 67 PHE n 1 68 VAL n 1 69 ASN n 1 70 LEU n 1 71 GLY n 1 72 ASN n 1 73 THR n 1 74 LYS n 1 75 MET n 1 76 GLU n 1 77 LEU n 1 78 LEU n 1 79 HIS n 1 80 PRO n 1 81 LEU n 1 82 GLY n 1 83 LEU n 1 84 ASP n 1 85 SER n 1 86 PRO n 1 87 ILE n 1 88 ALA n 1 89 GLY n 1 90 PHE n 1 91 LEU n 1 92 GLN n 1 93 LYS n 1 94 ASN n 1 95 LYS n 1 96 ALA n 1 97 GLY n 1 98 GLY n 1 99 MET n 1 100 HIS n 1 101 HIS n 1 102 ILE n 1 103 CYS n 1 104 ILE n 1 105 GLU n 1 106 VAL n 1 107 ASP n 1 108 ASN n 1 109 ILE n 1 110 ASN n 1 111 ALA n 1 112 ALA n 1 113 VAL n 1 114 MET n 1 115 ASP n 1 116 LEU n 1 117 LYS n 1 118 LYS n 1 119 LYS n 1 120 LYS n 1 121 ILE n 1 122 CYS n 1 123 SER n 1 124 LEU n 1 125 SER n 1 126 GLU n 1 127 GLU n 1 128 VAL n 1 129 LYS n 1 130 ILE n 1 131 GLY n 1 132 ALA n 1 133 HIS n 1 134 GLY n 1 135 LYS n 1 136 PRO n 1 137 VAL n 1 138 ILE n 1 139 PHE n 1 140 LEU n 1 141 HIS n 1 142 PRO n 1 143 LYS n 1 144 ASP n 1 145 CYS n 1 146 GLY n 1 147 GLY n 1 148 VAL n 1 149 LEU n 1 150 VAL n 1 151 GLU n 1 152 LEU n 1 153 GLU n 1 154 GLN n 1 155 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 155 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MCEE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CO non-polymer . 'COBALT (II) ION' ? 'Co 2' 58.933 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 22 ? ? ? C . n A 1 2 HIS 2 23 ? ? ? C . n A 1 3 HIS 3 24 ? ? ? C . n A 1 4 HIS 4 25 ? ? ? C . n A 1 5 HIS 5 26 ? ? ? C . n A 1 6 HIS 6 27 ? ? ? C . n A 1 7 HIS 7 28 ? ? ? C . n A 1 8 SER 8 29 ? ? ? C . n A 1 9 SER 9 30 ? ? ? C . n A 1 10 GLY 10 31 ? ? ? C . n A 1 11 VAL 11 32 ? ? ? C . n A 1 12 ASP 12 33 ? ? ? C . n A 1 13 LEU 13 34 ? ? ? C . n A 1 14 GLY 14 35 ? ? ? C . n A 1 15 THR 15 36 ? ? ? C . n A 1 16 GLU 16 37 37 GLU GLU C . n A 1 17 ASN 17 38 38 ASN ASN C . n A 1 18 LEU 18 39 39 LEU LEU C . n A 1 19 TYR 19 40 40 TYR TYR C . n A 1 20 PHE 20 41 41 PHE PHE C . n A 1 21 GLN 21 42 42 GLN GLN C . n A 1 22 SER 22 43 43 SER SER C . n A 1 23 MET 23 44 44 MET MET C . n A 1 24 LEU 24 45 45 LEU LEU C . n A 1 25 GLY 25 46 46 GLY GLY C . n A 1 26 ARG 26 47 47 ARG ARG C . n A 1 27 LEU 27 48 48 LEU LEU C . n A 1 28 ASN 28 49 49 ASN ASN C . n A 1 29 HIS 29 50 50 HIS HIS C . n A 1 30 VAL 30 51 51 VAL VAL C . n A 1 31 ALA 31 52 52 ALA ALA C . n A 1 32 ILE 32 53 53 ILE ILE C . n A 1 33 ALA 33 54 54 ALA ALA C . n A 1 34 VAL 34 55 55 VAL VAL C . n A 1 35 PRO 35 56 56 PRO PRO C . n A 1 36 ASP 36 57 57 ASP ASP C . n A 1 37 LEU 37 58 58 LEU LEU C . n A 1 38 GLU 38 59 59 GLU GLU C . n A 1 39 LYS 39 60 60 LYS LYS C . n A 1 40 ALA 40 61 61 ALA ALA C . n A 1 41 ALA 41 62 62 ALA ALA C . n A 1 42 ALA 42 63 63 ALA ALA C . n A 1 43 PHE 43 64 64 PHE PHE C . n A 1 44 TYR 44 65 65 TYR TYR C . n A 1 45 LYS 45 66 66 LYS LYS C . n A 1 46 ASN 46 67 67 ASN ASN C . n A 1 47 ILE 47 68 68 ILE ILE C . n A 1 48 LEU 48 69 69 LEU LEU C . n A 1 49 GLY 49 70 70 GLY GLY C . n A 1 50 ALA 50 71 71 ALA ALA C . n A 1 51 GLN 51 72 72 GLN GLN C . n A 1 52 VAL 52 73 73 VAL VAL C . n A 1 53 SER 53 74 74 SER SER C . n A 1 54 GLU 54 75 75 GLU GLU C . n A 1 55 ALA 55 76 76 ALA ALA C . n A 1 56 VAL 56 77 77 VAL VAL C . n A 1 57 PRO 57 78 78 PRO PRO C . n A 1 58 LEU 58 79 79 LEU LEU C . n A 1 59 PRO 59 80 80 PRO PRO C . n A 1 60 GLU 60 81 81 GLU GLU C . n A 1 61 HIS 61 82 82 HIS HIS C . n A 1 62 GLY 62 83 83 GLY GLY C . n A 1 63 VAL 63 84 84 VAL VAL C . n A 1 64 SER 64 85 85 SER SER C . n A 1 65 VAL 65 86 86 VAL VAL C . n A 1 66 VAL 66 87 87 VAL VAL C . n A 1 67 PHE 67 88 88 PHE PHE C . n A 1 68 VAL 68 89 89 VAL VAL C . n A 1 69 ASN 69 90 90 ASN ASN C . n A 1 70 LEU 70 91 91 LEU LEU C . n A 1 71 GLY 71 92 92 GLY GLY C . n A 1 72 ASN 72 93 93 ASN ASN C . n A 1 73 THR 73 94 94 THR THR C . n A 1 74 LYS 74 95 95 LYS LYS C . n A 1 75 MET 75 96 96 MET MET C . n A 1 76 GLU 76 97 97 GLU GLU C . n A 1 77 LEU 77 98 98 LEU LEU C . n A 1 78 LEU 78 99 99 LEU LEU C . n A 1 79 HIS 79 100 100 HIS HIS C . n A 1 80 PRO 80 101 101 PRO PRO C . n A 1 81 LEU 81 102 102 LEU LEU C . n A 1 82 GLY 82 103 103 GLY GLY C . n A 1 83 LEU 83 104 104 LEU LEU C . n A 1 84 ASP 84 105 105 ASP ASP C . n A 1 85 SER 85 106 106 SER SER C . n A 1 86 PRO 86 107 107 PRO PRO C . n A 1 87 ILE 87 108 108 ILE ILE C . n A 1 88 ALA 88 109 109 ALA ALA C . n A 1 89 GLY 89 110 110 GLY GLY C . n A 1 90 PHE 90 111 111 PHE PHE C . n A 1 91 LEU 91 112 112 LEU LEU C . n A 1 92 GLN 92 113 113 GLN GLN C . n A 1 93 LYS 93 114 114 LYS LYS C . n A 1 94 ASN 94 115 115 ASN ASN C . n A 1 95 LYS 95 116 116 LYS LYS C . n A 1 96 ALA 96 117 117 ALA ALA C . n A 1 97 GLY 97 118 118 GLY GLY C . n A 1 98 GLY 98 119 119 GLY GLY C . n A 1 99 MET 99 120 120 MET MET C . n A 1 100 HIS 100 121 121 HIS HIS C . n A 1 101 HIS 101 122 122 HIS HIS C . n A 1 102 ILE 102 123 123 ILE ILE C . n A 1 103 CYS 103 124 124 CYS CYS C . n A 1 104 ILE 104 125 125 ILE ILE C . n A 1 105 GLU 105 126 126 GLU GLU C . n A 1 106 VAL 106 127 127 VAL VAL C . n A 1 107 ASP 107 128 128 ASP ASP C . n A 1 108 ASN 108 129 129 ASN ASN C . n A 1 109 ILE 109 130 130 ILE ILE C . n A 1 110 ASN 110 131 131 ASN ASN C . n A 1 111 ALA 111 132 132 ALA ALA C . n A 1 112 ALA 112 133 133 ALA ALA C . n A 1 113 VAL 113 134 134 VAL VAL C . n A 1 114 MET 114 135 135 MET MET C . n A 1 115 ASP 115 136 136 ASP ASP C . n A 1 116 LEU 116 137 137 LEU LEU C . n A 1 117 LYS 117 138 138 LYS LYS C . n A 1 118 LYS 118 139 139 LYS LYS C . n A 1 119 LYS 119 140 140 LYS LYS C . n A 1 120 LYS 120 141 141 LYS LYS C . n A 1 121 ILE 121 142 142 ILE ILE C . n A 1 122 CYS 122 143 143 CYS CYS C . n A 1 123 SER 123 144 144 SER SER C . n A 1 124 LEU 124 145 145 LEU LEU C . n A 1 125 SER 125 146 146 SER SER C . n A 1 126 GLU 126 147 ? ? ? C . n A 1 127 GLU 127 148 ? ? ? C . n A 1 128 VAL 128 149 149 VAL VAL C . n A 1 129 LYS 129 150 150 LYS LYS C . n A 1 130 ILE 130 151 151 ILE ILE C . n A 1 131 GLY 131 152 152 GLY GLY C . n A 1 132 ALA 132 153 153 ALA ALA C . n A 1 133 HIS 133 154 154 HIS HIS C . n A 1 134 GLY 134 155 155 GLY GLY C . n A 1 135 LYS 135 156 156 LYS LYS C . n A 1 136 PRO 136 157 157 PRO PRO C . n A 1 137 VAL 137 158 158 VAL VAL C . n A 1 138 ILE 138 159 159 ILE ILE C . n A 1 139 PHE 139 160 160 PHE PHE C . n A 1 140 LEU 140 161 161 LEU LEU C . n A 1 141 HIS 141 162 162 HIS HIS C . n A 1 142 PRO 142 163 163 PRO PRO C . n A 1 143 LYS 143 164 164 LYS LYS C . n A 1 144 ASP 144 165 165 ASP ASP C . n A 1 145 CYS 145 166 166 CYS CYS C . n A 1 146 GLY 146 167 167 GLY GLY C . n A 1 147 GLY 147 168 168 GLY GLY C . n A 1 148 VAL 148 169 169 VAL VAL C . n A 1 149 LEU 149 170 170 LEU LEU C . n A 1 150 VAL 150 171 171 VAL VAL C . n A 1 151 GLU 151 172 172 GLU GLU C . n A 1 152 LEU 152 173 173 LEU LEU C . n A 1 153 GLU 153 174 174 GLU GLU C . n A 1 154 GLN 154 175 175 GLN GLN C . n A 1 155 ALA 155 176 176 ALA ALA C . n B 1 1 MET 1 22 ? ? ? A . n B 1 2 HIS 2 23 ? ? ? A . n B 1 3 HIS 3 24 ? ? ? A . n B 1 4 HIS 4 25 ? ? ? A . n B 1 5 HIS 5 26 ? ? ? A . n B 1 6 HIS 6 27 ? ? ? A . n B 1 7 HIS 7 28 ? ? ? A . n B 1 8 SER 8 29 ? ? ? A . n B 1 9 SER 9 30 ? ? ? A . n B 1 10 GLY 10 31 ? ? ? A . n B 1 11 VAL 11 32 ? ? ? A . n B 1 12 ASP 12 33 ? ? ? A . n B 1 13 LEU 13 34 ? ? ? A . n B 1 14 GLY 14 35 ? ? ? A . n B 1 15 THR 15 36 ? ? ? A . n B 1 16 GLU 16 37 ? ? ? A . n B 1 17 ASN 17 38 ? ? ? A . n B 1 18 LEU 18 39 ? ? ? A . n B 1 19 TYR 19 40 ? ? ? A . n B 1 20 PHE 20 41 ? ? ? A . n B 1 21 GLN 21 42 ? ? ? A . n B 1 22 SER 22 43 43 SER SER A . n B 1 23 MET 23 44 44 MET MET A . n B 1 24 LEU 24 45 45 LEU LEU A . n B 1 25 GLY 25 46 46 GLY GLY A . n B 1 26 ARG 26 47 47 ARG ARG A . n B 1 27 LEU 27 48 48 LEU LEU A . n B 1 28 ASN 28 49 49 ASN ASN A . n B 1 29 HIS 29 50 50 HIS HIS A . n B 1 30 VAL 30 51 51 VAL VAL A . n B 1 31 ALA 31 52 52 ALA ALA A . n B 1 32 ILE 32 53 53 ILE ILE A . n B 1 33 ALA 33 54 54 ALA ALA A . n B 1 34 VAL 34 55 55 VAL VAL A . n B 1 35 PRO 35 56 56 PRO PRO A . n B 1 36 ASP 36 57 57 ASP ASP A . n B 1 37 LEU 37 58 58 LEU LEU A . n B 1 38 GLU 38 59 59 GLU GLU A . n B 1 39 LYS 39 60 60 LYS LYS A . n B 1 40 ALA 40 61 61 ALA ALA A . n B 1 41 ALA 41 62 62 ALA ALA A . n B 1 42 ALA 42 63 63 ALA ALA A . n B 1 43 PHE 43 64 64 PHE PHE A . n B 1 44 TYR 44 65 65 TYR TYR A . n B 1 45 LYS 45 66 66 LYS LYS A . n B 1 46 ASN 46 67 67 ASN ASN A . n B 1 47 ILE 47 68 68 ILE ILE A . n B 1 48 LEU 48 69 69 LEU LEU A . n B 1 49 GLY 49 70 70 GLY GLY A . n B 1 50 ALA 50 71 71 ALA ALA A . n B 1 51 GLN 51 72 72 GLN GLN A . n B 1 52 VAL 52 73 73 VAL VAL A . n B 1 53 SER 53 74 74 SER SER A . n B 1 54 GLU 54 75 75 GLU GLU A . n B 1 55 ALA 55 76 76 ALA ALA A . n B 1 56 VAL 56 77 77 VAL VAL A . n B 1 57 PRO 57 78 78 PRO PRO A . n B 1 58 LEU 58 79 79 LEU LEU A . n B 1 59 PRO 59 80 80 PRO PRO A . n B 1 60 GLU 60 81 81 GLU GLU A . n B 1 61 HIS 61 82 82 HIS HIS A . n B 1 62 GLY 62 83 83 GLY GLY A . n B 1 63 VAL 63 84 84 VAL VAL A . n B 1 64 SER 64 85 85 SER SER A . n B 1 65 VAL 65 86 86 VAL VAL A . n B 1 66 VAL 66 87 87 VAL VAL A . n B 1 67 PHE 67 88 88 PHE PHE A . n B 1 68 VAL 68 89 89 VAL VAL A . n B 1 69 ASN 69 90 90 ASN ASN A . n B 1 70 LEU 70 91 91 LEU LEU A . n B 1 71 GLY 71 92 92 GLY GLY A . n B 1 72 ASN 72 93 93 ASN ASN A . n B 1 73 THR 73 94 94 THR THR A . n B 1 74 LYS 74 95 95 LYS LYS A . n B 1 75 MET 75 96 96 MET MET A . n B 1 76 GLU 76 97 97 GLU GLU A . n B 1 77 LEU 77 98 98 LEU LEU A . n B 1 78 LEU 78 99 99 LEU LEU A . n B 1 79 HIS 79 100 100 HIS HIS A . n B 1 80 PRO 80 101 101 PRO PRO A . n B 1 81 LEU 81 102 102 LEU LEU A . n B 1 82 GLY 82 103 103 GLY GLY A . n B 1 83 LEU 83 104 104 LEU LEU A . n B 1 84 ASP 84 105 105 ASP ASP A . n B 1 85 SER 85 106 106 SER SER A . n B 1 86 PRO 86 107 107 PRO PRO A . n B 1 87 ILE 87 108 108 ILE ILE A . n B 1 88 ALA 88 109 109 ALA ALA A . n B 1 89 GLY 89 110 110 GLY GLY A . n B 1 90 PHE 90 111 111 PHE PHE A . n B 1 91 LEU 91 112 112 LEU LEU A . n B 1 92 GLN 92 113 113 GLN GLN A . n B 1 93 LYS 93 114 114 LYS LYS A . n B 1 94 ASN 94 115 115 ASN ASN A . n B 1 95 LYS 95 116 116 LYS LYS A . n B 1 96 ALA 96 117 117 ALA ALA A . n B 1 97 GLY 97 118 118 GLY GLY A . n B 1 98 GLY 98 119 119 GLY GLY A . n B 1 99 MET 99 120 120 MET MET A . n B 1 100 HIS 100 121 121 HIS HIS A . n B 1 101 HIS 101 122 122 HIS HIS A . n B 1 102 ILE 102 123 123 ILE ILE A . n B 1 103 CYS 103 124 124 CYS CYS A . n B 1 104 ILE 104 125 125 ILE ILE A . n B 1 105 GLU 105 126 126 GLU GLU A . n B 1 106 VAL 106 127 127 VAL VAL A . n B 1 107 ASP 107 128 128 ASP ASP A . n B 1 108 ASN 108 129 129 ASN ASN A . n B 1 109 ILE 109 130 130 ILE ILE A . n B 1 110 ASN 110 131 131 ASN ASN A . n B 1 111 ALA 111 132 132 ALA ALA A . n B 1 112 ALA 112 133 133 ALA ALA A . n B 1 113 VAL 113 134 134 VAL VAL A . n B 1 114 MET 114 135 135 MET MET A . n B 1 115 ASP 115 136 136 ASP ASP A . n B 1 116 LEU 116 137 137 LEU LEU A . n B 1 117 LYS 117 138 138 LYS LYS A . n B 1 118 LYS 118 139 139 LYS LYS A . n B 1 119 LYS 119 140 140 LYS LYS A . n B 1 120 LYS 120 141 141 LYS LYS A . n B 1 121 ILE 121 142 142 ILE ILE A . n B 1 122 CYS 122 143 ? ? ? A . n B 1 123 SER 123 144 ? ? ? A . n B 1 124 LEU 124 145 145 LEU LEU A . n B 1 125 SER 125 146 146 SER SER A . n B 1 126 GLU 126 147 147 GLU GLU A . n B 1 127 GLU 127 148 ? ? ? A . n B 1 128 VAL 128 149 149 VAL VAL A . n B 1 129 LYS 129 150 150 LYS LYS A . n B 1 130 ILE 130 151 151 ILE ILE A . n B 1 131 GLY 131 152 152 GLY GLY A . n B 1 132 ALA 132 153 153 ALA ALA A . n B 1 133 HIS 133 154 154 HIS HIS A . n B 1 134 GLY 134 155 155 GLY GLY A . n B 1 135 LYS 135 156 156 LYS LYS A . n B 1 136 PRO 136 157 157 PRO PRO A . n B 1 137 VAL 137 158 158 VAL VAL A . n B 1 138 ILE 138 159 159 ILE ILE A . n B 1 139 PHE 139 160 160 PHE PHE A . n B 1 140 LEU 140 161 161 LEU LEU A . n B 1 141 HIS 141 162 162 HIS HIS A . n B 1 142 PRO 142 163 163 PRO PRO A . n B 1 143 LYS 143 164 164 LYS LYS A . n B 1 144 ASP 144 165 165 ASP ASP A . n B 1 145 CYS 145 166 166 CYS CYS A . n B 1 146 GLY 146 167 167 GLY GLY A . n B 1 147 GLY 147 168 168 GLY GLY A . n B 1 148 VAL 148 169 169 VAL VAL A . n B 1 149 LEU 149 170 170 LEU LEU A . n B 1 150 VAL 150 171 171 VAL VAL A . n B 1 151 GLU 151 172 172 GLU GLU A . n B 1 152 LEU 152 173 173 LEU LEU A . n B 1 153 GLU 153 174 174 GLU GLU A . n B 1 154 GLN 154 175 175 GLN GLN A . n B 1 155 ALA 155 176 176 ALA ALA A . n C 1 1 MET 1 22 ? ? ? B . n C 1 2 HIS 2 23 ? ? ? B . n C 1 3 HIS 3 24 ? ? ? B . n C 1 4 HIS 4 25 ? ? ? B . n C 1 5 HIS 5 26 ? ? ? B . n C 1 6 HIS 6 27 ? ? ? B . n C 1 7 HIS 7 28 ? ? ? B . n C 1 8 SER 8 29 ? ? ? B . n C 1 9 SER 9 30 ? ? ? B . n C 1 10 GLY 10 31 ? ? ? B . n C 1 11 VAL 11 32 ? ? ? B . n C 1 12 ASP 12 33 ? ? ? B . n C 1 13 LEU 13 34 ? ? ? B . n C 1 14 GLY 14 35 ? ? ? B . n C 1 15 THR 15 36 ? ? ? B . n C 1 16 GLU 16 37 ? ? ? B . n C 1 17 ASN 17 38 ? ? ? B . n C 1 18 LEU 18 39 ? ? ? B . n C 1 19 TYR 19 40 ? ? ? B . n C 1 20 PHE 20 41 ? ? ? B . n C 1 21 GLN 21 42 ? ? ? B . n C 1 22 SER 22 43 ? ? ? B . n C 1 23 MET 23 44 44 MET MET B . n C 1 24 LEU 24 45 45 LEU LEU B . n C 1 25 GLY 25 46 46 GLY GLY B . n C 1 26 ARG 26 47 47 ARG ARG B . n C 1 27 LEU 27 48 48 LEU LEU B . n C 1 28 ASN 28 49 49 ASN ASN B . n C 1 29 HIS 29 50 50 HIS HIS B . n C 1 30 VAL 30 51 51 VAL VAL B . n C 1 31 ALA 31 52 52 ALA ALA B . n C 1 32 ILE 32 53 53 ILE ILE B . n C 1 33 ALA 33 54 54 ALA ALA B . n C 1 34 VAL 34 55 55 VAL VAL B . n C 1 35 PRO 35 56 56 PRO PRO B . n C 1 36 ASP 36 57 57 ASP ASP B . n C 1 37 LEU 37 58 58 LEU LEU B . n C 1 38 GLU 38 59 59 GLU GLU B . n C 1 39 LYS 39 60 60 LYS LYS B . n C 1 40 ALA 40 61 61 ALA ALA B . n C 1 41 ALA 41 62 62 ALA ALA B . n C 1 42 ALA 42 63 63 ALA ALA B . n C 1 43 PHE 43 64 64 PHE PHE B . n C 1 44 TYR 44 65 65 TYR TYR B . n C 1 45 LYS 45 66 66 LYS LYS B . n C 1 46 ASN 46 67 67 ASN ASN B . n C 1 47 ILE 47 68 68 ILE ILE B . n C 1 48 LEU 48 69 69 LEU LEU B . n C 1 49 GLY 49 70 70 GLY GLY B . n C 1 50 ALA 50 71 71 ALA ALA B . n C 1 51 GLN 51 72 72 GLN GLN B . n C 1 52 VAL 52 73 73 VAL VAL B . n C 1 53 SER 53 74 74 SER SER B . n C 1 54 GLU 54 75 75 GLU GLU B . n C 1 55 ALA 55 76 76 ALA ALA B . n C 1 56 VAL 56 77 77 VAL VAL B . n C 1 57 PRO 57 78 78 PRO PRO B . n C 1 58 LEU 58 79 79 LEU LEU B . n C 1 59 PRO 59 80 80 PRO PRO B . n C 1 60 GLU 60 81 81 GLU GLU B . n C 1 61 HIS 61 82 82 HIS HIS B . n C 1 62 GLY 62 83 83 GLY GLY B . n C 1 63 VAL 63 84 84 VAL VAL B . n C 1 64 SER 64 85 85 SER SER B . n C 1 65 VAL 65 86 86 VAL VAL B . n C 1 66 VAL 66 87 87 VAL VAL B . n C 1 67 PHE 67 88 88 PHE PHE B . n C 1 68 VAL 68 89 89 VAL VAL B . n C 1 69 ASN 69 90 90 ASN ASN B . n C 1 70 LEU 70 91 91 LEU LEU B . n C 1 71 GLY 71 92 92 GLY GLY B . n C 1 72 ASN 72 93 93 ASN ASN B . n C 1 73 THR 73 94 94 THR THR B . n C 1 74 LYS 74 95 95 LYS LYS B . n C 1 75 MET 75 96 96 MET MET B . n C 1 76 GLU 76 97 97 GLU GLU B . n C 1 77 LEU 77 98 98 LEU LEU B . n C 1 78 LEU 78 99 99 LEU LEU B . n C 1 79 HIS 79 100 100 HIS HIS B . n C 1 80 PRO 80 101 101 PRO PRO B . n C 1 81 LEU 81 102 102 LEU LEU B . n C 1 82 GLY 82 103 103 GLY GLY B . n C 1 83 LEU 83 104 104 LEU LEU B . n C 1 84 ASP 84 105 105 ASP ASP B . n C 1 85 SER 85 106 106 SER SER B . n C 1 86 PRO 86 107 107 PRO PRO B . n C 1 87 ILE 87 108 108 ILE ILE B . n C 1 88 ALA 88 109 109 ALA ALA B . n C 1 89 GLY 89 110 110 GLY GLY B . n C 1 90 PHE 90 111 111 PHE PHE B . n C 1 91 LEU 91 112 112 LEU LEU B . n C 1 92 GLN 92 113 113 GLN GLN B . n C 1 93 LYS 93 114 114 LYS LYS B . n C 1 94 ASN 94 115 115 ASN ASN B . n C 1 95 LYS 95 116 116 LYS LYS B . n C 1 96 ALA 96 117 117 ALA ALA B . n C 1 97 GLY 97 118 118 GLY GLY B . n C 1 98 GLY 98 119 119 GLY GLY B . n C 1 99 MET 99 120 120 MET MET B . n C 1 100 HIS 100 121 121 HIS HIS B . n C 1 101 HIS 101 122 122 HIS HIS B . n C 1 102 ILE 102 123 123 ILE ILE B . n C 1 103 CYS 103 124 124 CYS CYS B . n C 1 104 ILE 104 125 125 ILE ILE B . n C 1 105 GLU 105 126 126 GLU GLU B . n C 1 106 VAL 106 127 127 VAL VAL B . n C 1 107 ASP 107 128 128 ASP ASP B . n C 1 108 ASN 108 129 129 ASN ASN B . n C 1 109 ILE 109 130 130 ILE ILE B . n C 1 110 ASN 110 131 131 ASN ASN B . n C 1 111 ALA 111 132 132 ALA ALA B . n C 1 112 ALA 112 133 133 ALA ALA B . n C 1 113 VAL 113 134 134 VAL VAL B . n C 1 114 MET 114 135 135 MET MET B . n C 1 115 ASP 115 136 136 ASP ASP B . n C 1 116 LEU 116 137 137 LEU LEU B . n C 1 117 LYS 117 138 138 LYS LYS B . n C 1 118 LYS 118 139 139 LYS LYS B . n C 1 119 LYS 119 140 140 LYS LYS B . n C 1 120 LYS 120 141 141 LYS LYS B . n C 1 121 ILE 121 142 142 ILE ILE B . n C 1 122 CYS 122 143 143 CYS CYS B . n C 1 123 SER 123 144 144 SER SER B . n C 1 124 LEU 124 145 145 LEU LEU B . n C 1 125 SER 125 146 ? ? ? B . n C 1 126 GLU 126 147 ? ? ? B . n C 1 127 GLU 127 148 148 GLU GLU B . n C 1 128 VAL 128 149 149 VAL VAL B . n C 1 129 LYS 129 150 150 LYS LYS B . n C 1 130 ILE 130 151 151 ILE ILE B . n C 1 131 GLY 131 152 152 GLY GLY B . n C 1 132 ALA 132 153 153 ALA ALA B . n C 1 133 HIS 133 154 154 HIS HIS B . n C 1 134 GLY 134 155 155 GLY GLY B . n C 1 135 LYS 135 156 156 LYS LYS B . n C 1 136 PRO 136 157 157 PRO PRO B . n C 1 137 VAL 137 158 158 VAL VAL B . n C 1 138 ILE 138 159 159 ILE ILE B . n C 1 139 PHE 139 160 160 PHE PHE B . n C 1 140 LEU 140 161 161 LEU LEU B . n C 1 141 HIS 141 162 162 HIS HIS B . n C 1 142 PRO 142 163 163 PRO PRO B . n C 1 143 LYS 143 164 164 LYS LYS B . n C 1 144 ASP 144 165 165 ASP ASP B . n C 1 145 CYS 145 166 166 CYS CYS B . n C 1 146 GLY 146 167 167 GLY GLY B . n C 1 147 GLY 147 168 168 GLY GLY B . n C 1 148 VAL 148 169 169 VAL VAL B . n C 1 149 LEU 149 170 170 LEU LEU B . n C 1 150 VAL 150 171 171 VAL VAL B . n C 1 151 GLU 151 172 172 GLU GLU B . n C 1 152 LEU 152 173 173 LEU LEU B . n C 1 153 GLU 153 174 174 GLU GLU B . n C 1 154 GLN 154 175 175 GLN GLN B . n C 1 155 ALA 155 176 176 ALA ALA B . n D 1 1 MET 1 22 ? ? ? D . n D 1 2 HIS 2 23 ? ? ? D . n D 1 3 HIS 3 24 ? ? ? D . n D 1 4 HIS 4 25 ? ? ? D . n D 1 5 HIS 5 26 ? ? ? D . n D 1 6 HIS 6 27 ? ? ? D . n D 1 7 HIS 7 28 ? ? ? D . n D 1 8 SER 8 29 ? ? ? D . n D 1 9 SER 9 30 ? ? ? D . n D 1 10 GLY 10 31 ? ? ? D . n D 1 11 VAL 11 32 ? ? ? D . n D 1 12 ASP 12 33 ? ? ? D . n D 1 13 LEU 13 34 ? ? ? D . n D 1 14 GLY 14 35 ? ? ? D . n D 1 15 THR 15 36 ? ? ? D . n D 1 16 GLU 16 37 ? ? ? D . n D 1 17 ASN 17 38 ? ? ? D . n D 1 18 LEU 18 39 ? ? ? D . n D 1 19 TYR 19 40 ? ? ? D . n D 1 20 PHE 20 41 ? ? ? D . n D 1 21 GLN 21 42 ? ? ? D . n D 1 22 SER 22 43 43 SER SER D . n D 1 23 MET 23 44 44 MET MET D . n D 1 24 LEU 24 45 45 LEU LEU D . n D 1 25 GLY 25 46 46 GLY GLY D . n D 1 26 ARG 26 47 47 ARG ARG D . n D 1 27 LEU 27 48 48 LEU LEU D . n D 1 28 ASN 28 49 49 ASN ASN D . n D 1 29 HIS 29 50 50 HIS HIS D . n D 1 30 VAL 30 51 51 VAL VAL D . n D 1 31 ALA 31 52 52 ALA ALA D . n D 1 32 ILE 32 53 53 ILE ILE D . n D 1 33 ALA 33 54 54 ALA ALA D . n D 1 34 VAL 34 55 55 VAL VAL D . n D 1 35 PRO 35 56 56 PRO PRO D . n D 1 36 ASP 36 57 57 ASP ASP D . n D 1 37 LEU 37 58 58 LEU LEU D . n D 1 38 GLU 38 59 59 GLU GLU D . n D 1 39 LYS 39 60 60 LYS LYS D . n D 1 40 ALA 40 61 61 ALA ALA D . n D 1 41 ALA 41 62 62 ALA ALA D . n D 1 42 ALA 42 63 63 ALA ALA D . n D 1 43 PHE 43 64 64 PHE PHE D . n D 1 44 TYR 44 65 65 TYR TYR D . n D 1 45 LYS 45 66 66 LYS LYS D . n D 1 46 ASN 46 67 67 ASN ASN D . n D 1 47 ILE 47 68 68 ILE ILE D . n D 1 48 LEU 48 69 69 LEU LEU D . n D 1 49 GLY 49 70 70 GLY GLY D . n D 1 50 ALA 50 71 71 ALA ALA D . n D 1 51 GLN 51 72 72 GLN GLN D . n D 1 52 VAL 52 73 73 VAL VAL D . n D 1 53 SER 53 74 74 SER SER D . n D 1 54 GLU 54 75 75 GLU GLU D . n D 1 55 ALA 55 76 76 ALA ALA D . n D 1 56 VAL 56 77 77 VAL VAL D . n D 1 57 PRO 57 78 78 PRO PRO D . n D 1 58 LEU 58 79 79 LEU LEU D . n D 1 59 PRO 59 80 80 PRO PRO D . n D 1 60 GLU 60 81 81 GLU GLU D . n D 1 61 HIS 61 82 82 HIS HIS D . n D 1 62 GLY 62 83 83 GLY GLY D . n D 1 63 VAL 63 84 84 VAL VAL D . n D 1 64 SER 64 85 85 SER SER D . n D 1 65 VAL 65 86 86 VAL VAL D . n D 1 66 VAL 66 87 87 VAL VAL D . n D 1 67 PHE 67 88 88 PHE PHE D . n D 1 68 VAL 68 89 89 VAL VAL D . n D 1 69 ASN 69 90 90 ASN ASN D . n D 1 70 LEU 70 91 91 LEU LEU D . n D 1 71 GLY 71 92 92 GLY GLY D . n D 1 72 ASN 72 93 93 ASN ASN D . n D 1 73 THR 73 94 94 THR THR D . n D 1 74 LYS 74 95 95 LYS LYS D . n D 1 75 MET 75 96 96 MET MET D . n D 1 76 GLU 76 97 97 GLU GLU D . n D 1 77 LEU 77 98 98 LEU LEU D . n D 1 78 LEU 78 99 99 LEU LEU D . n D 1 79 HIS 79 100 100 HIS HIS D . n D 1 80 PRO 80 101 101 PRO PRO D . n D 1 81 LEU 81 102 102 LEU LEU D . n D 1 82 GLY 82 103 103 GLY GLY D . n D 1 83 LEU 83 104 104 LEU LEU D . n D 1 84 ASP 84 105 105 ASP ASP D . n D 1 85 SER 85 106 106 SER SER D . n D 1 86 PRO 86 107 107 PRO PRO D . n D 1 87 ILE 87 108 108 ILE ILE D . n D 1 88 ALA 88 109 109 ALA ALA D . n D 1 89 GLY 89 110 110 GLY GLY D . n D 1 90 PHE 90 111 111 PHE PHE D . n D 1 91 LEU 91 112 112 LEU LEU D . n D 1 92 GLN 92 113 113 GLN GLN D . n D 1 93 LYS 93 114 114 LYS LYS D . n D 1 94 ASN 94 115 115 ASN ASN D . n D 1 95 LYS 95 116 116 LYS LYS D . n D 1 96 ALA 96 117 117 ALA ALA D . n D 1 97 GLY 97 118 118 GLY GLY D . n D 1 98 GLY 98 119 119 GLY GLY D . n D 1 99 MET 99 120 120 MET MET D . n D 1 100 HIS 100 121 121 HIS HIS D . n D 1 101 HIS 101 122 122 HIS HIS D . n D 1 102 ILE 102 123 123 ILE ILE D . n D 1 103 CYS 103 124 124 CYS CYS D . n D 1 104 ILE 104 125 125 ILE ILE D . n D 1 105 GLU 105 126 126 GLU GLU D . n D 1 106 VAL 106 127 127 VAL VAL D . n D 1 107 ASP 107 128 128 ASP ASP D . n D 1 108 ASN 108 129 129 ASN ASN D . n D 1 109 ILE 109 130 130 ILE ILE D . n D 1 110 ASN 110 131 131 ASN ASN D . n D 1 111 ALA 111 132 132 ALA ALA D . n D 1 112 ALA 112 133 133 ALA ALA D . n D 1 113 VAL 113 134 134 VAL VAL D . n D 1 114 MET 114 135 135 MET MET D . n D 1 115 ASP 115 136 136 ASP ASP D . n D 1 116 LEU 116 137 137 LEU LEU D . n D 1 117 LYS 117 138 138 LYS LYS D . n D 1 118 LYS 118 139 139 LYS LYS D . n D 1 119 LYS 119 140 140 LYS LYS D . n D 1 120 LYS 120 141 141 LYS LYS D . n D 1 121 ILE 121 142 142 ILE ILE D . n D 1 122 CYS 122 143 143 CYS CYS D . n D 1 123 SER 123 144 144 SER SER D . n D 1 124 LEU 124 145 145 LEU LEU D . n D 1 125 SER 125 146 146 SER SER D . n D 1 126 GLU 126 147 147 GLU GLU D . n D 1 127 GLU 127 148 148 GLU GLU D . n D 1 128 VAL 128 149 149 VAL VAL D . n D 1 129 LYS 129 150 150 LYS LYS D . n D 1 130 ILE 130 151 151 ILE ILE D . n D 1 131 GLY 131 152 152 GLY GLY D . n D 1 132 ALA 132 153 153 ALA ALA D . n D 1 133 HIS 133 154 154 HIS HIS D . n D 1 134 GLY 134 155 155 GLY GLY D . n D 1 135 LYS 135 156 156 LYS LYS D . n D 1 136 PRO 136 157 157 PRO PRO D . n D 1 137 VAL 137 158 158 VAL VAL D . n D 1 138 ILE 138 159 159 ILE ILE D . n D 1 139 PHE 139 160 160 PHE PHE D . n D 1 140 LEU 140 161 161 LEU LEU D . n D 1 141 HIS 141 162 162 HIS HIS D . n D 1 142 PRO 142 163 163 PRO PRO D . n D 1 143 LYS 143 164 164 LYS LYS D . n D 1 144 ASP 144 165 165 ASP ASP D . n D 1 145 CYS 145 166 166 CYS CYS D . n D 1 146 GLY 146 167 167 GLY GLY D . n D 1 147 GLY 147 168 168 GLY GLY D . n D 1 148 VAL 148 169 169 VAL VAL D . n D 1 149 LEU 149 170 170 LEU LEU D . n D 1 150 VAL 150 171 171 VAL VAL D . n D 1 151 GLU 151 172 172 GLU GLU D . n D 1 152 LEU 152 173 173 LEU LEU D . n D 1 153 GLU 153 174 174 GLU GLU D . n D 1 154 GLN 154 175 175 GLN GLN D . n D 1 155 ALA 155 176 176 ALA ALA D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 CO 1 201 3 CO CO C . F 2 CO 1 201 4 CO CO A . G 2 CO 1 201 5 CO CO B . H 2 CO 1 201 6 CO CO D . I 3 HOH 1 301 79 HOH HOH C . I 3 HOH 2 302 65 HOH HOH C . I 3 HOH 3 303 4 HOH HOH C . I 3 HOH 4 304 8 HOH HOH C . I 3 HOH 5 305 62 HOH HOH C . I 3 HOH 6 306 13 HOH HOH C . I 3 HOH 7 307 5 HOH HOH C . I 3 HOH 8 308 77 HOH HOH C . I 3 HOH 9 309 26 HOH HOH C . I 3 HOH 10 310 55 HOH HOH C . I 3 HOH 11 311 45 HOH HOH C . I 3 HOH 12 312 14 HOH HOH C . I 3 HOH 13 313 7 HOH HOH C . I 3 HOH 14 314 76 HOH HOH C . I 3 HOH 15 315 3 HOH HOH C . I 3 HOH 16 316 98 HOH HOH C . I 3 HOH 17 317 9 HOH HOH C . I 3 HOH 18 318 57 HOH HOH C . I 3 HOH 19 319 2 HOH HOH C . I 3 HOH 20 320 69 HOH HOH C . I 3 HOH 21 321 83 HOH HOH C . I 3 HOH 22 322 97 HOH HOH C . J 3 HOH 1 301 99 HOH HOH A . J 3 HOH 2 302 16 HOH HOH A . J 3 HOH 3 303 61 HOH HOH A . J 3 HOH 4 304 29 HOH HOH A . J 3 HOH 5 305 18 HOH HOH A . J 3 HOH 6 306 49 HOH HOH A . J 3 HOH 7 307 22 HOH HOH A . J 3 HOH 8 308 20 HOH HOH A . J 3 HOH 9 309 15 HOH HOH A . J 3 HOH 10 310 70 HOH HOH A . J 3 HOH 11 311 63 HOH HOH A . J 3 HOH 12 312 27 HOH HOH A . J 3 HOH 13 313 21 HOH HOH A . J 3 HOH 14 314 10 HOH HOH A . J 3 HOH 15 315 28 HOH HOH A . J 3 HOH 16 316 84 HOH HOH A . J 3 HOH 17 317 93 HOH HOH A . J 3 HOH 18 318 24 HOH HOH A . J 3 HOH 19 319 23 HOH HOH A . J 3 HOH 20 320 19 HOH HOH A . J 3 HOH 21 321 17 HOH HOH A . J 3 HOH 22 322 43 HOH HOH A . J 3 HOH 23 323 71 HOH HOH A . J 3 HOH 24 324 78 HOH HOH A . J 3 HOH 25 325 44 HOH HOH A . J 3 HOH 26 326 25 HOH HOH A . J 3 HOH 27 327 46 HOH HOH A . J 3 HOH 28 328 6 HOH HOH A . J 3 HOH 29 329 82 HOH HOH A . K 3 HOH 1 301 50 HOH HOH B . K 3 HOH 2 302 86 HOH HOH B . K 3 HOH 3 303 87 HOH HOH B . K 3 HOH 4 304 30 HOH HOH B . K 3 HOH 5 305 74 HOH HOH B . K 3 HOH 6 306 31 HOH HOH B . K 3 HOH 7 307 64 HOH HOH B . K 3 HOH 8 308 73 HOH HOH B . K 3 HOH 9 309 35 HOH HOH B . K 3 HOH 10 310 72 HOH HOH B . K 3 HOH 11 311 53 HOH HOH B . K 3 HOH 12 312 33 HOH HOH B . K 3 HOH 13 313 51 HOH HOH B . K 3 HOH 14 314 32 HOH HOH B . K 3 HOH 15 315 88 HOH HOH B . K 3 HOH 16 316 47 HOH HOH B . L 3 HOH 1 301 56 HOH HOH D . L 3 HOH 2 302 59 HOH HOH D . L 3 HOH 3 303 90 HOH HOH D . L 3 HOH 4 304 39 HOH HOH D . L 3 HOH 5 305 96 HOH HOH D . L 3 HOH 6 306 41 HOH HOH D . L 3 HOH 7 307 95 HOH HOH D . L 3 HOH 8 308 66 HOH HOH D . L 3 HOH 9 309 60 HOH HOH D . L 3 HOH 10 310 40 HOH HOH D . L 3 HOH 11 311 36 HOH HOH D . L 3 HOH 12 312 11 HOH HOH D . L 3 HOH 13 313 54 HOH HOH D . L 3 HOH 14 314 58 HOH HOH D . L 3 HOH 15 315 81 HOH HOH D . L 3 HOH 16 316 48 HOH HOH D . L 3 HOH 17 317 38 HOH HOH D . L 3 HOH 18 318 94 HOH HOH D . L 3 HOH 19 319 89 HOH HOH D . L 3 HOH 20 320 91 HOH HOH D . L 3 HOH 21 321 37 HOH HOH D . L 3 HOH 22 322 68 HOH HOH D . L 3 HOH 23 323 52 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C GLN 42 ? CG ? A GLN 21 CG 2 1 Y 1 C GLN 42 ? CD ? A GLN 21 CD 3 1 Y 1 C GLN 42 ? OE1 ? A GLN 21 OE1 4 1 Y 1 C GLN 42 ? NE2 ? A GLN 21 NE2 5 1 Y 1 C ARG 47 ? NE ? A ARG 26 NE 6 1 Y 1 C ARG 47 ? CZ ? A ARG 26 CZ 7 1 Y 1 C ARG 47 ? NH1 ? A ARG 26 NH1 8 1 Y 1 C ARG 47 ? NH2 ? A ARG 26 NH2 9 1 Y 1 C GLU 59 ? CG ? A GLU 38 CG 10 1 Y 1 C GLU 59 ? CD ? A GLU 38 CD 11 1 Y 1 C GLU 59 ? OE1 ? A GLU 38 OE1 12 1 Y 1 C GLU 59 ? OE2 ? A GLU 38 OE2 13 1 Y 1 C LYS 60 ? CE ? A LYS 39 CE 14 1 Y 1 C LYS 60 ? NZ ? A LYS 39 NZ 15 1 Y 1 C LEU 104 ? CG ? A LEU 83 CG 16 1 Y 1 C LEU 104 ? CD1 ? A LEU 83 CD1 17 1 Y 1 C LEU 104 ? CD2 ? A LEU 83 CD2 18 1 Y 1 C ASP 105 ? CG ? A ASP 84 CG 19 1 Y 1 C ASP 105 ? OD1 ? A ASP 84 OD1 20 1 Y 1 C ASP 105 ? OD2 ? A ASP 84 OD2 21 1 Y 1 C GLN 113 ? CG ? A GLN 92 CG 22 1 Y 1 C GLN 113 ? CD ? A GLN 92 CD 23 1 Y 1 C GLN 113 ? OE1 ? A GLN 92 OE1 24 1 Y 1 C GLN 113 ? NE2 ? A GLN 92 NE2 25 1 Y 1 C LYS 114 ? CG ? A LYS 93 CG 26 1 Y 1 C LYS 114 ? CD ? A LYS 93 CD 27 1 Y 1 C LYS 114 ? CE ? A LYS 93 CE 28 1 Y 1 C LYS 114 ? NZ ? A LYS 93 NZ 29 1 Y 1 C LYS 116 ? CG ? A LYS 95 CG 30 1 Y 1 C LYS 116 ? CD ? A LYS 95 CD 31 1 Y 1 C LYS 116 ? CE ? A LYS 95 CE 32 1 Y 1 C LYS 116 ? NZ ? A LYS 95 NZ 33 1 Y 1 C LYS 138 ? CG ? A LYS 117 CG 34 1 Y 1 C LYS 138 ? CD ? A LYS 117 CD 35 1 Y 1 C LYS 138 ? CE ? A LYS 117 CE 36 1 Y 1 C LYS 138 ? NZ ? A LYS 117 NZ 37 1 Y 1 C LYS 141 ? CG ? A LYS 120 CG 38 1 Y 1 C LYS 141 ? CD ? A LYS 120 CD 39 1 Y 1 C LYS 141 ? CE ? A LYS 120 CE 40 1 Y 1 C LYS 141 ? NZ ? A LYS 120 NZ 41 1 Y 1 C LYS 156 ? CE ? A LYS 135 CE 42 1 Y 1 C LYS 156 ? NZ ? A LYS 135 NZ 43 1 Y 1 C LYS 164 ? CG ? A LYS 143 CG 44 1 Y 1 C LYS 164 ? CD ? A LYS 143 CD 45 1 Y 1 C LYS 164 ? CE ? A LYS 143 CE 46 1 Y 1 C LYS 164 ? NZ ? A LYS 143 NZ 47 1 Y 1 A ARG 47 ? NE ? B ARG 26 NE 48 1 Y 1 A ARG 47 ? CZ ? B ARG 26 CZ 49 1 Y 1 A ARG 47 ? NH1 ? B ARG 26 NH1 50 1 Y 1 A ARG 47 ? NH2 ? B ARG 26 NH2 51 1 Y 1 A LEU 104 ? CG ? B LEU 83 CG 52 1 Y 1 A LEU 104 ? CD1 ? B LEU 83 CD1 53 1 Y 1 A LEU 104 ? CD2 ? B LEU 83 CD2 54 1 Y 1 A ASP 105 ? CG ? B ASP 84 CG 55 1 Y 1 A ASP 105 ? OD1 ? B ASP 84 OD1 56 1 Y 1 A ASP 105 ? OD2 ? B ASP 84 OD2 57 1 Y 1 A LYS 114 ? CG ? B LYS 93 CG 58 1 Y 1 A LYS 114 ? CD ? B LYS 93 CD 59 1 Y 1 A LYS 114 ? CE ? B LYS 93 CE 60 1 Y 1 A LYS 114 ? NZ ? B LYS 93 NZ 61 1 Y 1 A LYS 138 ? CG ? B LYS 117 CG 62 1 Y 1 A LYS 138 ? CD ? B LYS 117 CD 63 1 Y 1 A LYS 138 ? CE ? B LYS 117 CE 64 1 Y 1 A LYS 138 ? NZ ? B LYS 117 NZ 65 1 Y 1 A GLU 147 ? CG ? B GLU 126 CG 66 1 Y 1 A GLU 147 ? CD ? B GLU 126 CD 67 1 Y 1 A GLU 147 ? OE1 ? B GLU 126 OE1 68 1 Y 1 A GLU 147 ? OE2 ? B GLU 126 OE2 69 1 Y 1 A LYS 150 ? CG ? B LYS 129 CG 70 1 Y 1 A LYS 150 ? CD ? B LYS 129 CD 71 1 Y 1 A LYS 150 ? CE ? B LYS 129 CE 72 1 Y 1 A LYS 150 ? NZ ? B LYS 129 NZ 73 1 Y 1 A LYS 156 ? CE ? B LYS 135 CE 74 1 Y 1 A LYS 156 ? NZ ? B LYS 135 NZ 75 1 Y 1 A LYS 164 ? CG ? B LYS 143 CG 76 1 Y 1 A LYS 164 ? CD ? B LYS 143 CD 77 1 Y 1 A LYS 164 ? CE ? B LYS 143 CE 78 1 Y 1 A LYS 164 ? NZ ? B LYS 143 NZ 79 1 Y 1 B MET 44 ? CG ? C MET 23 CG 80 1 Y 1 B MET 44 ? SD ? C MET 23 SD 81 1 Y 1 B MET 44 ? CE ? C MET 23 CE 82 1 Y 1 B GLU 59 ? CG ? C GLU 38 CG 83 1 Y 1 B GLU 59 ? CD ? C GLU 38 CD 84 1 Y 1 B GLU 59 ? OE1 ? C GLU 38 OE1 85 1 Y 1 B GLU 59 ? OE2 ? C GLU 38 OE2 86 1 Y 1 B LYS 60 ? CE ? C LYS 39 CE 87 1 Y 1 B LYS 60 ? NZ ? C LYS 39 NZ 88 1 Y 1 B LEU 104 ? CG ? C LEU 83 CG 89 1 Y 1 B LEU 104 ? CD1 ? C LEU 83 CD1 90 1 Y 1 B LEU 104 ? CD2 ? C LEU 83 CD2 91 1 Y 1 B ASP 105 ? CG ? C ASP 84 CG 92 1 Y 1 B ASP 105 ? OD1 ? C ASP 84 OD1 93 1 Y 1 B ASP 105 ? OD2 ? C ASP 84 OD2 94 1 Y 1 B GLN 113 ? CG ? C GLN 92 CG 95 1 Y 1 B GLN 113 ? CD ? C GLN 92 CD 96 1 Y 1 B GLN 113 ? OE1 ? C GLN 92 OE1 97 1 Y 1 B GLN 113 ? NE2 ? C GLN 92 NE2 98 1 Y 1 B LYS 114 ? CG ? C LYS 93 CG 99 1 Y 1 B LYS 114 ? CD ? C LYS 93 CD 100 1 Y 1 B LYS 114 ? CE ? C LYS 93 CE 101 1 Y 1 B LYS 114 ? NZ ? C LYS 93 NZ 102 1 Y 1 B ASP 128 ? CG ? C ASP 107 CG 103 1 Y 1 B ASP 128 ? OD1 ? C ASP 107 OD1 104 1 Y 1 B ASP 128 ? OD2 ? C ASP 107 OD2 105 1 Y 1 B MET 135 ? SD ? C MET 114 SD 106 1 Y 1 B MET 135 ? CE ? C MET 114 CE 107 1 Y 1 B LYS 138 ? CE ? C LYS 117 CE 108 1 Y 1 B LYS 138 ? NZ ? C LYS 117 NZ 109 1 Y 1 B LYS 141 ? CG ? C LYS 120 CG 110 1 Y 1 B LYS 141 ? CD ? C LYS 120 CD 111 1 Y 1 B LYS 141 ? CE ? C LYS 120 CE 112 1 Y 1 B LYS 141 ? NZ ? C LYS 120 NZ 113 1 Y 1 B GLU 148 ? CG ? C GLU 127 CG 114 1 Y 1 B GLU 148 ? CD ? C GLU 127 CD 115 1 Y 1 B GLU 148 ? OE1 ? C GLU 127 OE1 116 1 Y 1 B GLU 148 ? OE2 ? C GLU 127 OE2 117 1 Y 1 B LYS 150 ? CD ? C LYS 129 CD 118 1 Y 1 B LYS 150 ? CE ? C LYS 129 CE 119 1 Y 1 B LYS 150 ? NZ ? C LYS 129 NZ 120 1 Y 1 B LYS 156 ? NZ ? C LYS 135 NZ 121 1 Y 1 B LYS 164 ? CG ? C LYS 143 CG 122 1 Y 1 B LYS 164 ? CD ? C LYS 143 CD 123 1 Y 1 B LYS 164 ? CE ? C LYS 143 CE 124 1 Y 1 B LYS 164 ? NZ ? C LYS 143 NZ 125 1 Y 1 D GLU 59 ? CG ? D GLU 38 CG 126 1 Y 1 D GLU 59 ? CD ? D GLU 38 CD 127 1 Y 1 D GLU 59 ? OE1 ? D GLU 38 OE1 128 1 Y 1 D GLU 59 ? OE2 ? D GLU 38 OE2 129 1 Y 1 D LYS 66 ? CD ? D LYS 45 CD 130 1 Y 1 D LYS 66 ? CE ? D LYS 45 CE 131 1 Y 1 D LYS 66 ? NZ ? D LYS 45 NZ 132 1 Y 1 D GLU 75 ? CG ? D GLU 54 CG 133 1 Y 1 D GLU 75 ? CD ? D GLU 54 CD 134 1 Y 1 D GLU 75 ? OE1 ? D GLU 54 OE1 135 1 Y 1 D GLU 75 ? OE2 ? D GLU 54 OE2 136 1 Y 1 D GLN 113 ? CG ? D GLN 92 CG 137 1 Y 1 D GLN 113 ? CD ? D GLN 92 CD 138 1 Y 1 D GLN 113 ? OE1 ? D GLN 92 OE1 139 1 Y 1 D GLN 113 ? NE2 ? D GLN 92 NE2 140 1 Y 1 D LYS 114 ? NZ ? D LYS 93 NZ 141 1 Y 1 D LYS 138 ? CG ? D LYS 117 CG 142 1 Y 1 D LYS 138 ? CD ? D LYS 117 CD 143 1 Y 1 D LYS 138 ? CE ? D LYS 117 CE 144 1 Y 1 D LYS 138 ? NZ ? D LYS 117 NZ 145 1 Y 1 D CYS 143 ? SG ? D CYS 122 SG 146 1 Y 1 D GLU 147 ? CG ? D GLU 126 CG 147 1 Y 1 D GLU 147 ? CD ? D GLU 126 CD 148 1 Y 1 D GLU 147 ? OE1 ? D GLU 126 OE1 149 1 Y 1 D GLU 147 ? OE2 ? D GLU 126 OE2 150 1 Y 1 D GLU 148 ? CG ? D GLU 127 CG 151 1 Y 1 D GLU 148 ? CD ? D GLU 127 CD 152 1 Y 1 D GLU 148 ? OE1 ? D GLU 127 OE1 153 1 Y 1 D GLU 148 ? OE2 ? D GLU 127 OE2 154 1 Y 1 D LYS 150 ? CG ? D LYS 129 CG 155 1 Y 1 D LYS 150 ? CD ? D LYS 129 CD 156 1 Y 1 D LYS 150 ? CE ? D LYS 129 CE 157 1 Y 1 D LYS 150 ? NZ ? D LYS 129 NZ 158 1 Y 1 D LYS 156 ? CE ? D LYS 135 CE 159 1 Y 1 D LYS 156 ? NZ ? D LYS 135 NZ 160 1 Y 1 D LYS 164 ? CG ? D LYS 143 CG 161 1 Y 1 D LYS 164 ? CD ? D LYS 143 CD 162 1 Y 1 D LYS 164 ? CE ? D LYS 143 CE 163 1 Y 1 D LYS 164 ? NZ ? D LYS 143 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.020 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6QH4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.162 _cell.length_a_esd ? _cell.length_b 66.990 _cell.length_b_esd ? _cell.length_c 77.125 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QH4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QH4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG4000, 10% 2-propanol and 0.1M HEPES pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-09-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6QH4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.92 _reflns.d_resolution_low 77.13 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19630 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 48.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.92 _reflns_shell.d_res_low 2.12 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 983 _reflns_shell.percent_possible_all 10.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.56 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 104.340 _refine.B_iso_mean 35.6023 _refine.B_iso_min 9.700 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6QH4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9220 _refine.ls_d_res_low 77.1250 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19625 _refine.ls_number_reflns_R_free 1028 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 47.4000 _refine.ls_percent_reflns_R_free 5.2400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2302 _refine.ls_R_factor_R_free 0.2756 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2278 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3RMU _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.8500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9220 _refine_hist.d_res_low 77.1250 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 90 _refine_hist.number_atoms_total 3940 _refine_hist.pdbx_number_residues_total 534 _refine_hist.pdbx_B_iso_mean_ligand 41.63 _refine_hist.pdbx_B_iso_mean_solvent 30.03 _refine_hist.pdbx_number_atoms_protein 3846 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 1468 0.870 ? ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 1468 0.870 ? ? ? ? ? ? ? 3 'X-RAY DIFFRACTION' 1 3 TORSIONAL C 1468 0.870 ? ? ? ? ? ? ? 4 'X-RAY DIFFRACTION' 1 4 TORSIONAL D 1468 0.870 ? ? ? ? ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9217 2.0231 182 . 10 172 3.0000 . . . 0.4485 0.0000 0.3388 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.0231 2.1498 1165 . 62 1103 20.0000 . . . 0.3934 0.0000 0.3332 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.1498 2.3158 1855 . 97 1758 31.0000 . . . 0.2750 0.0000 0.3051 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.3158 2.5489 2372 . 127 2245 40.0000 . . . 0.3492 0.0000 0.2942 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.5489 2.9177 3209 . 161 3048 54.0000 . . . 0.3043 0.0000 0.2823 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.9177 3.6760 4901 . 260 4641 83.0000 . . . 0.3078 0.0000 0.2257 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.6760 77.1871 5941 . 311 5630 98.0000 . . . 0.2357 0.0000 0.1961 . . . . . . 7 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 3 or resid 45 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 112 or (resid 113 through 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; 1 2 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; 1 3 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; 1 4 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? A 3 A 3 ;(chain A and (resid 3 or resid 45 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 112 or (resid 113 through 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 1 2 ? A 45 A 58 ;(chain A and (resid 3 or resid 45 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 112 or (resid 113 through 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 1 3 ? A 59 A 59 ;(chain A and (resid 3 or resid 45 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 112 or (resid 113 through 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 1 4 ? A 43 A 176 ;(chain A and (resid 3 or resid 45 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 112 or (resid 113 through 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 1 5 ? A 43 A 176 ;(chain A and (resid 3 or resid 45 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 112 or (resid 113 through 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 1 6 ? A 43 A 176 ;(chain A and (resid 3 or resid 45 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 112 or (resid 113 through 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 1 7 ? A 43 A 176 ;(chain A and (resid 3 or resid 45 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 112 or (resid 113 through 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 2 1 ? B 3 B 3 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 2 2 ? B 45 B 46 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 2 3 ? B 47 B 47 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 2 4 ? B 44 B 176 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 2 5 ? B 44 B 176 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 2 6 ? B 44 B 176 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 2 7 ? B 44 B 176 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 2 8 ? B 44 B 176 ;(chain B and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 137 or (resid 138 and (name N or name CA or name C or name O or name CB )) or resid 139 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 155 or (resid 156 through 157 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 158 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 3 1 ? C 3 C 3 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 3 2 ? C 45 C 65 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 3 3 ? C 66 C 66 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 3 4 ? C 37 C 176 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 3 5 ? C 37 C 176 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 3 6 ? C 37 C 176 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 3 7 ? C 37 C 176 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 3 8 ? C 37 C 176 ;(chain C and (resid 3 or resid 45 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB or name CG )) or resid 67 through 74 or (resid 75 through 76 and (name N or name CA or name C or name O or name CB )) or resid 77 through 106 or resid 108 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 142 or resid 144 or resid 149 or (resid 150 and (name N or name CA or name C or name O or name CB )) or resid 151 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 1 ? D 3 D 3 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 2 ? D 45 D 46 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 3 ? D 47 D 47 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 4 ? D 43 D 176 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 5 ? D 43 D 176 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 6 ? D 43 D 176 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 7 ? D 43 D 176 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 8 ? D 43 D 176 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? 1 4 9 ? D 43 D 176 ;(chain D and (resid 3 or resid 45 through 46 or (resid 47 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 48 through 59 or (resid 60 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 61 through 103 or (resid 104 through 105 and (name N or name CA or name C or name O or name CB )) or resid 106 or resid 108 through 113 or (resid 114 and (name N or name CA or name C or name O or name CB )) or resid 115 or (resid 116 through 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 127 or (resid 128 and (name N or name CA or name C or name O or name CB )) or resid 129 through 134 or (resid 135 and (name N or name CA or name C or name O or name CB or name CG )) or resid 136 through 140 or (resid 141 and (name N or name CA or name C or name O or name CB )) or resid 142 or resid 146 or resid 149 through 176)) ; ? ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6QH4 _struct.title 'Crystal structure of human Methylmalonyl-CoA epimerase (MCEE) p.Arg143Cys variant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QH4 _struct_keywords.text 'Methylmalonyl-CoA epimerase, mitochondrial, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MCEE_HUMAN _struct_ref.pdbx_db_accession Q96PE7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHIC IEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA ; _struct_ref.pdbx_align_begin 45 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6QH4 C 24 ? 155 ? Q96PE7 45 ? 176 ? 45 176 2 1 6QH4 A 24 ? 155 ? Q96PE7 45 ? 176 ? 45 176 3 1 6QH4 B 24 ? 155 ? Q96PE7 45 ? 176 ? 45 176 4 1 6QH4 D 24 ? 155 ? Q96PE7 45 ? 176 ? 45 176 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QH4 MET C 1 ? UNP Q96PE7 ? ? 'initiating methionine' 22 1 1 6QH4 HIS C 2 ? UNP Q96PE7 ? ? 'expression tag' 23 2 1 6QH4 HIS C 3 ? UNP Q96PE7 ? ? 'expression tag' 24 3 1 6QH4 HIS C 4 ? UNP Q96PE7 ? ? 'expression tag' 25 4 1 6QH4 HIS C 5 ? UNP Q96PE7 ? ? 'expression tag' 26 5 1 6QH4 HIS C 6 ? UNP Q96PE7 ? ? 'expression tag' 27 6 1 6QH4 HIS C 7 ? UNP Q96PE7 ? ? 'expression tag' 28 7 1 6QH4 SER C 8 ? UNP Q96PE7 ? ? 'expression tag' 29 8 1 6QH4 SER C 9 ? UNP Q96PE7 ? ? 'expression tag' 30 9 1 6QH4 GLY C 10 ? UNP Q96PE7 ? ? 'expression tag' 31 10 1 6QH4 VAL C 11 ? UNP Q96PE7 ? ? 'expression tag' 32 11 1 6QH4 ASP C 12 ? UNP Q96PE7 ? ? 'expression tag' 33 12 1 6QH4 LEU C 13 ? UNP Q96PE7 ? ? 'expression tag' 34 13 1 6QH4 GLY C 14 ? UNP Q96PE7 ? ? 'expression tag' 35 14 1 6QH4 THR C 15 ? UNP Q96PE7 ? ? 'expression tag' 36 15 1 6QH4 GLU C 16 ? UNP Q96PE7 ? ? 'expression tag' 37 16 1 6QH4 ASN C 17 ? UNP Q96PE7 ? ? 'expression tag' 38 17 1 6QH4 LEU C 18 ? UNP Q96PE7 ? ? 'expression tag' 39 18 1 6QH4 TYR C 19 ? UNP Q96PE7 ? ? 'expression tag' 40 19 1 6QH4 PHE C 20 ? UNP Q96PE7 ? ? 'expression tag' 41 20 1 6QH4 GLN C 21 ? UNP Q96PE7 ? ? 'expression tag' 42 21 1 6QH4 SER C 22 ? UNP Q96PE7 ? ? 'expression tag' 43 22 1 6QH4 MET C 23 ? UNP Q96PE7 ? ? 'expression tag' 44 23 1 6QH4 LEU C 83 ? UNP Q96PE7 ARG 104 variant 104 24 1 6QH4 CYS C 122 ? UNP Q96PE7 ARG 143 'engineered mutation' 143 25 2 6QH4 MET A 1 ? UNP Q96PE7 ? ? 'initiating methionine' 22 26 2 6QH4 HIS A 2 ? UNP Q96PE7 ? ? 'expression tag' 23 27 2 6QH4 HIS A 3 ? UNP Q96PE7 ? ? 'expression tag' 24 28 2 6QH4 HIS A 4 ? UNP Q96PE7 ? ? 'expression tag' 25 29 2 6QH4 HIS A 5 ? UNP Q96PE7 ? ? 'expression tag' 26 30 2 6QH4 HIS A 6 ? UNP Q96PE7 ? ? 'expression tag' 27 31 2 6QH4 HIS A 7 ? UNP Q96PE7 ? ? 'expression tag' 28 32 2 6QH4 SER A 8 ? UNP Q96PE7 ? ? 'expression tag' 29 33 2 6QH4 SER A 9 ? UNP Q96PE7 ? ? 'expression tag' 30 34 2 6QH4 GLY A 10 ? UNP Q96PE7 ? ? 'expression tag' 31 35 2 6QH4 VAL A 11 ? UNP Q96PE7 ? ? 'expression tag' 32 36 2 6QH4 ASP A 12 ? UNP Q96PE7 ? ? 'expression tag' 33 37 2 6QH4 LEU A 13 ? UNP Q96PE7 ? ? 'expression tag' 34 38 2 6QH4 GLY A 14 ? UNP Q96PE7 ? ? 'expression tag' 35 39 2 6QH4 THR A 15 ? UNP Q96PE7 ? ? 'expression tag' 36 40 2 6QH4 GLU A 16 ? UNP Q96PE7 ? ? 'expression tag' 37 41 2 6QH4 ASN A 17 ? UNP Q96PE7 ? ? 'expression tag' 38 42 2 6QH4 LEU A 18 ? UNP Q96PE7 ? ? 'expression tag' 39 43 2 6QH4 TYR A 19 ? UNP Q96PE7 ? ? 'expression tag' 40 44 2 6QH4 PHE A 20 ? UNP Q96PE7 ? ? 'expression tag' 41 45 2 6QH4 GLN A 21 ? UNP Q96PE7 ? ? 'expression tag' 42 46 2 6QH4 SER A 22 ? UNP Q96PE7 ? ? 'expression tag' 43 47 2 6QH4 MET A 23 ? UNP Q96PE7 ? ? 'expression tag' 44 48 2 6QH4 LEU A 83 ? UNP Q96PE7 ARG 104 variant 104 49 2 6QH4 CYS A 122 ? UNP Q96PE7 ARG 143 'engineered mutation' 143 50 3 6QH4 MET B 1 ? UNP Q96PE7 ? ? 'initiating methionine' 22 51 3 6QH4 HIS B 2 ? UNP Q96PE7 ? ? 'expression tag' 23 52 3 6QH4 HIS B 3 ? UNP Q96PE7 ? ? 'expression tag' 24 53 3 6QH4 HIS B 4 ? UNP Q96PE7 ? ? 'expression tag' 25 54 3 6QH4 HIS B 5 ? UNP Q96PE7 ? ? 'expression tag' 26 55 3 6QH4 HIS B 6 ? UNP Q96PE7 ? ? 'expression tag' 27 56 3 6QH4 HIS B 7 ? UNP Q96PE7 ? ? 'expression tag' 28 57 3 6QH4 SER B 8 ? UNP Q96PE7 ? ? 'expression tag' 29 58 3 6QH4 SER B 9 ? UNP Q96PE7 ? ? 'expression tag' 30 59 3 6QH4 GLY B 10 ? UNP Q96PE7 ? ? 'expression tag' 31 60 3 6QH4 VAL B 11 ? UNP Q96PE7 ? ? 'expression tag' 32 61 3 6QH4 ASP B 12 ? UNP Q96PE7 ? ? 'expression tag' 33 62 3 6QH4 LEU B 13 ? UNP Q96PE7 ? ? 'expression tag' 34 63 3 6QH4 GLY B 14 ? UNP Q96PE7 ? ? 'expression tag' 35 64 3 6QH4 THR B 15 ? UNP Q96PE7 ? ? 'expression tag' 36 65 3 6QH4 GLU B 16 ? UNP Q96PE7 ? ? 'expression tag' 37 66 3 6QH4 ASN B 17 ? UNP Q96PE7 ? ? 'expression tag' 38 67 3 6QH4 LEU B 18 ? UNP Q96PE7 ? ? 'expression tag' 39 68 3 6QH4 TYR B 19 ? UNP Q96PE7 ? ? 'expression tag' 40 69 3 6QH4 PHE B 20 ? UNP Q96PE7 ? ? 'expression tag' 41 70 3 6QH4 GLN B 21 ? UNP Q96PE7 ? ? 'expression tag' 42 71 3 6QH4 SER B 22 ? UNP Q96PE7 ? ? 'expression tag' 43 72 3 6QH4 MET B 23 ? UNP Q96PE7 ? ? 'expression tag' 44 73 3 6QH4 LEU B 83 ? UNP Q96PE7 ARG 104 variant 104 74 3 6QH4 CYS B 122 ? UNP Q96PE7 ARG 143 'engineered mutation' 143 75 4 6QH4 MET D 1 ? UNP Q96PE7 ? ? 'initiating methionine' 22 76 4 6QH4 HIS D 2 ? UNP Q96PE7 ? ? 'expression tag' 23 77 4 6QH4 HIS D 3 ? UNP Q96PE7 ? ? 'expression tag' 24 78 4 6QH4 HIS D 4 ? UNP Q96PE7 ? ? 'expression tag' 25 79 4 6QH4 HIS D 5 ? UNP Q96PE7 ? ? 'expression tag' 26 80 4 6QH4 HIS D 6 ? UNP Q96PE7 ? ? 'expression tag' 27 81 4 6QH4 HIS D 7 ? UNP Q96PE7 ? ? 'expression tag' 28 82 4 6QH4 SER D 8 ? UNP Q96PE7 ? ? 'expression tag' 29 83 4 6QH4 SER D 9 ? UNP Q96PE7 ? ? 'expression tag' 30 84 4 6QH4 GLY D 10 ? UNP Q96PE7 ? ? 'expression tag' 31 85 4 6QH4 VAL D 11 ? UNP Q96PE7 ? ? 'expression tag' 32 86 4 6QH4 ASP D 12 ? UNP Q96PE7 ? ? 'expression tag' 33 87 4 6QH4 LEU D 13 ? UNP Q96PE7 ? ? 'expression tag' 34 88 4 6QH4 GLY D 14 ? UNP Q96PE7 ? ? 'expression tag' 35 89 4 6QH4 THR D 15 ? UNP Q96PE7 ? ? 'expression tag' 36 90 4 6QH4 GLU D 16 ? UNP Q96PE7 ? ? 'expression tag' 37 91 4 6QH4 ASN D 17 ? UNP Q96PE7 ? ? 'expression tag' 38 92 4 6QH4 LEU D 18 ? UNP Q96PE7 ? ? 'expression tag' 39 93 4 6QH4 TYR D 19 ? UNP Q96PE7 ? ? 'expression tag' 40 94 4 6QH4 PHE D 20 ? UNP Q96PE7 ? ? 'expression tag' 41 95 4 6QH4 GLN D 21 ? UNP Q96PE7 ? ? 'expression tag' 42 96 4 6QH4 SER D 22 ? UNP Q96PE7 ? ? 'expression tag' 43 97 4 6QH4 MET D 23 ? UNP Q96PE7 ? ? 'expression tag' 44 98 4 6QH4 LEU D 83 ? UNP Q96PE7 ARG 104 variant 104 99 4 6QH4 CYS D 122 ? UNP Q96PE7 ARG 143 'engineered mutation' 143 100 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3500 ? 1 MORE -58 ? 1 'SSA (A^2)' 12420 ? 2 'ABSA (A^2)' 3390 ? 2 MORE -58 ? 2 'SSA (A^2)' 11960 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F,I,J 2 1 C,G,K 2 2 D,H,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_445 -x-1,y-1/2,-z -1.0000000000 0.0000000000 0.0000000000 -53.1620000000 0.0000000000 1.0000000000 0.0000000000 -33.4950000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 36 ? ILE A 47 ? ASP C 57 ILE C 68 1 ? 12 HELX_P HELX_P2 AA2 PRO A 59 ? HIS A 61 ? PRO C 80 HIS C 82 5 ? 3 HELX_P HELX_P3 AA3 ILE A 87 ? ASN A 94 ? ILE C 108 ASN C 115 1 ? 8 HELX_P HELX_P4 AA4 ASN A 108 ? LYS A 119 ? ASN C 129 LYS C 140 1 ? 12 HELX_P HELX_P5 AA5 HIS A 141 ? GLY A 146 ? HIS C 162 GLY C 167 5 ? 6 HELX_P HELX_P6 AA6 ASP B 36 ? ILE B 47 ? ASP A 57 ILE A 68 1 ? 12 HELX_P HELX_P7 AA7 PRO B 59 ? HIS B 61 ? PRO A 80 HIS A 82 5 ? 3 HELX_P HELX_P8 AA8 ILE B 87 ? ASN B 94 ? ILE A 108 ASN A 115 1 ? 8 HELX_P HELX_P9 AA9 ASN B 108 ? LYS B 119 ? ASN A 129 LYS A 140 1 ? 12 HELX_P HELX_P10 AB1 HIS B 141 ? GLY B 146 ? HIS A 162 GLY A 167 1 ? 6 HELX_P HELX_P11 AB2 ASP C 36 ? ILE C 47 ? ASP B 57 ILE B 68 1 ? 12 HELX_P HELX_P12 AB3 PRO C 59 ? HIS C 61 ? PRO B 80 HIS B 82 5 ? 3 HELX_P HELX_P13 AB4 ILE C 87 ? ASN C 94 ? ILE B 108 ASN B 115 1 ? 8 HELX_P HELX_P14 AB5 ASN C 108 ? LYS C 119 ? ASN B 129 LYS B 140 1 ? 12 HELX_P HELX_P15 AB6 HIS C 141 ? GLY C 146 ? HIS B 162 GLY B 167 1 ? 6 HELX_P HELX_P16 AB7 ASP D 36 ? ILE D 47 ? ASP D 57 ILE D 68 1 ? 12 HELX_P HELX_P17 AB8 PRO D 59 ? HIS D 61 ? PRO D 80 HIS D 82 5 ? 3 HELX_P HELX_P18 AB9 ILE D 87 ? ASN D 94 ? ILE D 108 ASN D 115 1 ? 8 HELX_P HELX_P19 AC1 ASN D 108 ? LYS D 119 ? ASN D 129 LYS D 140 1 ? 12 HELX_P HELX_P20 AC2 HIS D 141 ? GLY D 146 ? HIS D 162 GLY D 167 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 E CO . CO ? ? C HIS 50 C CO 201 1_555 ? ? ? ? ? ? ? 2.235 ? ? metalc2 metalc ? ? A HIS 101 NE2 ? ? ? 1_555 E CO . CO ? ? C HIS 122 C CO 201 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc3 metalc ? ? A GLU 151 OE2 ? ? ? 1_555 E CO . CO ? ? C GLU 172 C CO 201 1_555 ? ? ? ? ? ? ? 2.410 ? ? metalc4 metalc ? ? B HIS 29 NE2 ? ? ? 1_555 F CO . CO ? ? A HIS 50 A CO 201 1_555 ? ? ? ? ? ? ? 2.443 ? ? metalc5 metalc ? ? B HIS 101 NE2 ? ? ? 1_555 F CO . CO ? ? A HIS 122 A CO 201 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc6 metalc ? ? B GLU 151 OE2 ? ? ? 1_555 F CO . CO ? ? A GLU 172 A CO 201 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc7 metalc ? ? F CO . CO ? ? ? 1_555 J HOH . O ? ? A CO 201 A HOH 302 1_555 ? ? ? ? ? ? ? 2.498 ? ? metalc8 metalc ? ? C HIS 29 NE2 ? ? ? 1_555 G CO . CO ? ? B HIS 50 B CO 201 1_555 ? ? ? ? ? ? ? 2.601 ? ? metalc9 metalc ? ? C HIS 101 NE2 ? ? ? 1_555 G CO . CO ? ? B HIS 122 B CO 201 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc10 metalc ? ? C GLU 151 OE1 ? ? ? 1_555 G CO . CO ? ? B GLU 172 B CO 201 1_555 ? ? ? ? ? ? ? 2.393 ? ? metalc11 metalc ? ? D HIS 29 NE2 ? ? ? 1_555 H CO . CO ? ? D HIS 50 D CO 201 1_555 ? ? ? ? ? ? ? 2.569 ? ? metalc12 metalc ? ? D HIS 101 NE2 ? ? ? 1_555 H CO . CO ? ? D HIS 122 D CO 201 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc13 metalc ? ? D GLU 151 OE1 ? ? ? 1_555 H CO . CO ? ? D GLU 172 D CO 201 1_555 ? ? ? ? ? ? ? 2.605 ? ? metalc14 metalc ? ? H CO . CO ? ? ? 1_555 L HOH . O ? ? D CO 201 D HOH 308 1_555 ? ? ? ? ? ? ? 2.351 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 29 ? C HIS 50 ? 1_555 CO ? E CO . ? C CO 201 ? 1_555 NE2 ? A HIS 101 ? C HIS 122 ? 1_555 84.9 ? 2 NE2 ? A HIS 29 ? C HIS 50 ? 1_555 CO ? E CO . ? C CO 201 ? 1_555 OE2 ? A GLU 151 ? C GLU 172 ? 1_555 112.3 ? 3 NE2 ? A HIS 101 ? C HIS 122 ? 1_555 CO ? E CO . ? C CO 201 ? 1_555 OE2 ? A GLU 151 ? C GLU 172 ? 1_555 79.5 ? 4 NE2 ? B HIS 29 ? A HIS 50 ? 1_555 CO ? F CO . ? A CO 201 ? 1_555 NE2 ? B HIS 101 ? A HIS 122 ? 1_555 86.8 ? 5 NE2 ? B HIS 29 ? A HIS 50 ? 1_555 CO ? F CO . ? A CO 201 ? 1_555 OE2 ? B GLU 151 ? A GLU 172 ? 1_555 100.0 ? 6 NE2 ? B HIS 101 ? A HIS 122 ? 1_555 CO ? F CO . ? A CO 201 ? 1_555 OE2 ? B GLU 151 ? A GLU 172 ? 1_555 73.9 ? 7 NE2 ? B HIS 29 ? A HIS 50 ? 1_555 CO ? F CO . ? A CO 201 ? 1_555 O ? J HOH . ? A HOH 302 ? 1_555 93.9 ? 8 NE2 ? B HIS 101 ? A HIS 122 ? 1_555 CO ? F CO . ? A CO 201 ? 1_555 O ? J HOH . ? A HOH 302 ? 1_555 101.2 ? 9 OE2 ? B GLU 151 ? A GLU 172 ? 1_555 CO ? F CO . ? A CO 201 ? 1_555 O ? J HOH . ? A HOH 302 ? 1_555 164.8 ? 10 NE2 ? C HIS 29 ? B HIS 50 ? 1_555 CO ? G CO . ? B CO 201 ? 1_555 NE2 ? C HIS 101 ? B HIS 122 ? 1_555 85.3 ? 11 NE2 ? C HIS 29 ? B HIS 50 ? 1_555 CO ? G CO . ? B CO 201 ? 1_555 OE1 ? C GLU 151 ? B GLU 172 ? 1_555 96.9 ? 12 NE2 ? C HIS 101 ? B HIS 122 ? 1_555 CO ? G CO . ? B CO 201 ? 1_555 OE1 ? C GLU 151 ? B GLU 172 ? 1_555 81.3 ? 13 NE2 ? D HIS 29 ? D HIS 50 ? 1_555 CO ? H CO . ? D CO 201 ? 1_555 NE2 ? D HIS 101 ? D HIS 122 ? 1_555 86.2 ? 14 NE2 ? D HIS 29 ? D HIS 50 ? 1_555 CO ? H CO . ? D CO 201 ? 1_555 OE1 ? D GLU 151 ? D GLU 172 ? 1_555 93.5 ? 15 NE2 ? D HIS 101 ? D HIS 122 ? 1_555 CO ? H CO . ? D CO 201 ? 1_555 OE1 ? D GLU 151 ? D GLU 172 ? 1_555 76.2 ? 16 NE2 ? D HIS 29 ? D HIS 50 ? 1_555 CO ? H CO . ? D CO 201 ? 1_555 O ? L HOH . ? D HOH 308 ? 1_555 100.2 ? 17 NE2 ? D HIS 101 ? D HIS 122 ? 1_555 CO ? H CO . ? D CO 201 ? 1_555 O ? L HOH . ? D HOH 308 ? 1_555 95.4 ? 18 OE1 ? D GLU 151 ? D GLU 172 ? 1_555 CO ? H CO . ? D CO 201 ? 1_555 O ? L HOH . ? D HOH 308 ? 1_555 163.5 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 8 ? AA3 ? 3 ? AA4 ? 8 ? AA5 ? 3 ? AA6 ? 8 ? AA7 ? 3 ? AA8 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? parallel AA4 4 5 ? anti-parallel AA4 5 6 ? parallel AA4 6 7 ? anti-parallel AA4 7 8 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? parallel AA6 4 5 ? anti-parallel AA6 5 6 ? parallel AA6 6 7 ? anti-parallel AA6 7 8 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA8 3 4 ? parallel AA8 4 5 ? anti-parallel AA8 5 6 ? parallel AA8 6 7 ? anti-parallel AA8 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 51 ? VAL A 52 ? GLN C 72 VAL C 73 AA1 2 VAL A 63 ? ASN A 69 ? VAL C 84 ASN C 90 AA1 3 VAL A 56 ? LEU A 58 ? VAL C 77 LEU C 79 AA2 1 GLN A 51 ? VAL A 52 ? GLN C 72 VAL C 73 AA2 2 VAL A 63 ? ASN A 69 ? VAL C 84 ASN C 90 AA2 3 LYS A 74 ? PRO A 80 ? LYS C 95 PRO C 101 AA2 4 LEU A 24 ? ALA A 33 ? LEU C 45 ALA C 54 AA2 5 GLY A 98 ? VAL A 106 ? GLY C 119 VAL C 127 AA2 6 LEU A 149 ? GLN A 154 ? LEU C 170 GLN C 175 AA2 7 PRO A 136 ? LEU A 140 ? PRO C 157 LEU C 161 AA2 8 LYS A 129 ? ILE A 130 ? LYS C 150 ILE C 151 AA3 1 GLN B 51 ? VAL B 52 ? GLN A 72 VAL A 73 AA3 2 VAL B 63 ? ASN B 69 ? VAL A 84 ASN A 90 AA3 3 VAL B 56 ? LEU B 58 ? VAL A 77 LEU A 79 AA4 1 GLN B 51 ? VAL B 52 ? GLN A 72 VAL A 73 AA4 2 VAL B 63 ? ASN B 69 ? VAL A 84 ASN A 90 AA4 3 LYS B 74 ? PRO B 80 ? LYS A 95 PRO A 101 AA4 4 LEU B 24 ? ALA B 33 ? LEU A 45 ALA A 54 AA4 5 GLY B 98 ? VAL B 106 ? GLY A 119 VAL A 127 AA4 6 LEU B 149 ? GLN B 154 ? LEU A 170 GLN A 175 AA4 7 PRO B 136 ? LEU B 140 ? PRO A 157 LEU A 161 AA4 8 LYS B 129 ? ILE B 130 ? LYS A 150 ILE A 151 AA5 1 GLN C 51 ? VAL C 52 ? GLN B 72 VAL B 73 AA5 2 VAL C 63 ? ASN C 69 ? VAL B 84 ASN B 90 AA5 3 VAL C 56 ? LEU C 58 ? VAL B 77 LEU B 79 AA6 1 GLN C 51 ? VAL C 52 ? GLN B 72 VAL B 73 AA6 2 VAL C 63 ? ASN C 69 ? VAL B 84 ASN B 90 AA6 3 LYS C 74 ? PRO C 80 ? LYS B 95 PRO B 101 AA6 4 LEU C 24 ? ALA C 33 ? LEU B 45 ALA B 54 AA6 5 GLY C 98 ? VAL C 106 ? GLY B 119 VAL B 127 AA6 6 LEU C 149 ? GLN C 154 ? LEU B 170 GLN B 175 AA6 7 PRO C 136 ? LEU C 140 ? PRO B 157 LEU B 161 AA6 8 LYS C 129 ? ILE C 130 ? LYS B 150 ILE B 151 AA7 1 GLN D 51 ? VAL D 52 ? GLN D 72 VAL D 73 AA7 2 VAL D 63 ? ASN D 69 ? VAL D 84 ASN D 90 AA7 3 VAL D 56 ? LEU D 58 ? VAL D 77 LEU D 79 AA8 1 GLN D 51 ? VAL D 52 ? GLN D 72 VAL D 73 AA8 2 VAL D 63 ? ASN D 69 ? VAL D 84 ASN D 90 AA8 3 LYS D 74 ? PRO D 80 ? LYS D 95 PRO D 101 AA8 4 LEU D 24 ? ALA D 33 ? LEU D 45 ALA D 54 AA8 5 GLY D 98 ? VAL D 106 ? GLY D 119 VAL D 127 AA8 6 LEU D 149 ? GLN D 154 ? LEU D 170 GLN D 175 AA8 7 PRO D 136 ? LEU D 140 ? PRO D 157 LEU D 161 AA8 8 LYS D 129 ? ILE D 130 ? LYS D 150 ILE D 151 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 51 ? N GLN C 72 O ASN A 69 ? O ASN C 90 AA1 2 3 O VAL A 65 ? O VAL C 86 N VAL A 56 ? N VAL C 77 AA2 1 2 N GLN A 51 ? N GLN C 72 O ASN A 69 ? O ASN C 90 AA2 2 3 N VAL A 68 ? N VAL C 89 O MET A 75 ? O MET C 96 AA2 3 4 O LEU A 78 ? O LEU C 99 N ILE A 32 ? N ILE C 53 AA2 4 5 N ALA A 31 ? N ALA C 52 O HIS A 101 ? O HIS C 122 AA2 5 6 N ILE A 102 ? N ILE C 123 O GLU A 151 ? O GLU C 172 AA2 6 7 O VAL A 150 ? O VAL C 171 N LEU A 140 ? N LEU C 161 AA2 7 8 O VAL A 137 ? O VAL C 158 N LYS A 129 ? N LYS C 150 AA3 1 2 N GLN B 51 ? N GLN A 72 O ASN B 69 ? O ASN A 90 AA3 2 3 O VAL B 65 ? O VAL A 86 N VAL B 56 ? N VAL A 77 AA4 1 2 N GLN B 51 ? N GLN A 72 O ASN B 69 ? O ASN A 90 AA4 2 3 N VAL B 68 ? N VAL A 89 O MET B 75 ? O MET A 96 AA4 3 4 O GLU B 76 ? O GLU A 97 N ILE B 32 ? N ILE A 53 AA4 4 5 N ALA B 31 ? N ALA A 52 O HIS B 101 ? O HIS A 122 AA4 5 6 N ILE B 102 ? N ILE A 123 O GLU B 151 ? O GLU A 172 AA4 6 7 O VAL B 150 ? O VAL A 171 N LEU B 140 ? N LEU A 161 AA4 7 8 O VAL B 137 ? O VAL A 158 N LYS B 129 ? N LYS A 150 AA5 1 2 N GLN C 51 ? N GLN B 72 O ASN C 69 ? O ASN B 90 AA5 2 3 O VAL C 65 ? O VAL B 86 N VAL C 56 ? N VAL B 77 AA6 1 2 N GLN C 51 ? N GLN B 72 O ASN C 69 ? O ASN B 90 AA6 2 3 N VAL C 68 ? N VAL B 89 O MET C 75 ? O MET B 96 AA6 3 4 O GLU C 76 ? O GLU B 97 N ILE C 32 ? N ILE B 53 AA6 4 5 N ALA C 31 ? N ALA B 52 O HIS C 101 ? O HIS B 122 AA6 5 6 N ILE C 102 ? N ILE B 123 O GLU C 151 ? O GLU B 172 AA6 6 7 O VAL C 150 ? O VAL B 171 N LEU C 140 ? N LEU B 161 AA6 7 8 O VAL C 137 ? O VAL B 158 N LYS C 129 ? N LYS B 150 AA7 1 2 N GLN D 51 ? N GLN D 72 O ASN D 69 ? O ASN D 90 AA7 2 3 O VAL D 65 ? O VAL D 86 N VAL D 56 ? N VAL D 77 AA8 1 2 N GLN D 51 ? N GLN D 72 O ASN D 69 ? O ASN D 90 AA8 2 3 N VAL D 68 ? N VAL D 89 O MET D 75 ? O MET D 96 AA8 3 4 O GLU D 76 ? O GLU D 97 N ILE D 32 ? N ILE D 53 AA8 4 5 N ALA D 31 ? N ALA D 52 O HIS D 101 ? O HIS D 122 AA8 5 6 N ILE D 102 ? N ILE D 123 O GLU D 151 ? O GLU D 172 AA8 6 7 O VAL D 150 ? O VAL D 171 N LEU D 140 ? N LEU D 161 AA8 7 8 O VAL D 137 ? O VAL D 158 N LYS D 129 ? N LYS D 150 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software C CO 201 ? 3 'binding site for residue CO C 201' AC2 Software A CO 201 ? 4 'binding site for residue CO A 201' AC3 Software B CO 201 ? 3 'binding site for residue CO B 201' AC4 Software D CO 201 ? 4 'binding site for residue CO D 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 29 ? HIS C 50 . ? 1_555 ? 2 AC1 3 HIS A 101 ? HIS C 122 . ? 1_555 ? 3 AC1 3 GLU A 151 ? GLU C 172 . ? 1_555 ? 4 AC2 4 HIS B 29 ? HIS A 50 . ? 1_555 ? 5 AC2 4 HIS B 101 ? HIS A 122 . ? 1_555 ? 6 AC2 4 GLU B 151 ? GLU A 172 . ? 1_555 ? 7 AC2 4 HOH J . ? HOH A 302 . ? 1_555 ? 8 AC3 3 HIS C 29 ? HIS B 50 . ? 1_555 ? 9 AC3 3 HIS C 101 ? HIS B 122 . ? 1_555 ? 10 AC3 3 GLU C 151 ? GLU B 172 . ? 1_555 ? 11 AC4 4 HIS D 29 ? HIS D 50 . ? 1_555 ? 12 AC4 4 HIS D 101 ? HIS D 122 . ? 1_555 ? 13 AC4 4 GLU D 151 ? GLU D 172 . ? 1_555 ? 14 AC4 4 HOH L . ? HOH D 308 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG1 C VAL 134 ? ? CB C VAL 134 ? ? CG2 C VAL 134 ? ? 121.08 110.90 10.18 1.60 N 2 1 CG1 A VAL 134 ? ? CB A VAL 134 ? ? CG2 A VAL 134 ? ? 121.83 110.90 10.93 1.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP C 105 ? ? -91.80 38.02 2 1 ASP A 105 ? ? -92.69 36.07 3 1 ASP B 105 ? ? -92.50 37.65 4 1 ASP D 105 ? ? -93.22 38.85 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 3.6237 28.5383 34.2551 0.3384 0.4759 0.2826 -0.0591 0.0480 -0.2777 7.1527 5.1116 4.1326 3.8064 1.1048 1.6788 0.3286 0.0256 0.1821 0.1354 0.6383 0.2249 0.3355 0.0548 0.4656 'X-RAY DIFFRACTION' 2 ? refined -8.8491 12.4797 10.9279 0.1077 0.1723 0.2777 0.0225 0.0272 -0.0318 2.9810 1.4287 1.8805 -1.7106 0.8183 -1.3296 -0.0010 0.0308 -0.1464 0.3615 -0.3361 0.4038 -0.0788 0.0097 -0.0778 'X-RAY DIFFRACTION' 3 ? refined -3.5724 15.9475 7.0987 0.1376 0.4069 0.1423 0.0161 0.0068 -0.0403 6.2265 3.1149 0.9987 -1.5613 -2.1560 0.0712 0.2491 -0.1085 -0.1502 0.0354 0.6843 -0.0961 -0.1550 -0.0509 0.3952 'X-RAY DIFFRACTION' 4 ? refined -1.6040 11.8514 11.6096 0.1269 0.3609 0.2843 -0.0430 0.0109 -0.0693 3.2394 4.2297 4.1316 -0.6966 0.0113 -0.3633 0.3171 -0.6033 0.1517 1.3998 -0.2153 -0.2636 0.0196 0.3836 -0.2873 'X-RAY DIFFRACTION' 5 ? refined 0.3838 9.8315 18.8617 0.1076 0.3111 0.1647 -0.0041 0.0106 -0.0028 5.2046 3.8817 2.5740 0.8461 -0.5942 0.1986 -0.0091 -0.0280 0.0782 -0.3269 -0.2293 0.1722 -0.3489 0.0653 0.3032 'X-RAY DIFFRACTION' 6 ? refined 13.3001 15.4219 24.1013 0.0951 0.4960 0.3130 0.1088 -0.0212 -0.0066 3.9164 6.7902 8.2487 2.4589 0.8912 0.1451 -0.0656 0.1948 -0.1008 0.3982 -0.4827 -0.4883 -0.4190 0.4508 0.4926 'X-RAY DIFFRACTION' 7 ? refined 3.9990 6.8422 29.3279 0.2826 0.4592 0.3911 -0.1409 -0.0311 0.0642 3.7554 6.8661 4.1253 -3.0077 -3.8576 3.9381 -0.2278 0.7028 -0.1516 -0.3458 -0.2135 0.1069 0.0500 0.4483 0.8694 'X-RAY DIFFRACTION' 8 ? refined 6.9765 17.7906 21.3161 0.2381 0.7188 0.1793 0.0244 -0.1073 0.0518 5.5885 4.3711 5.8122 2.3222 3.0310 4.1332 -0.4017 0.2186 0.2887 1.5575 0.7851 0.4274 -1.0545 -0.4452 0.3640 'X-RAY DIFFRACTION' 9 ? refined -10.9911 15.8679 25.5875 0.2084 0.0699 0.1432 0.0605 0.0597 -0.0168 3.6430 1.5798 1.3182 -0.4487 -0.0370 -0.4284 0.0823 -0.0174 0.2555 -0.2392 0.1587 -0.1372 0.0206 -0.2972 0.2285 'X-RAY DIFFRACTION' 10 ? refined 0.9502 16.1570 37.9086 0.2270 0.2902 0.1696 -0.0092 0.0175 0.0167 5.5657 2.2660 1.9629 0.0587 -0.4178 0.6869 0.0531 0.1692 -0.0487 -0.6824 0.3231 -0.0900 -0.0019 -0.1064 0.2977 'X-RAY DIFFRACTION' 11 ? refined -13.0281 14.3338 37.7663 0.2642 0.1026 0.1045 0.0022 0.0582 -0.1296 0.9118 6.0087 1.7934 -0.4819 1.2092 -1.6858 0.1213 0.1315 0.5196 -0.3303 0.0171 0.6382 0.0462 -0.1214 0.0165 'X-RAY DIFFRACTION' 12 ? refined -6.9341 16.2244 31.3328 0.1209 0.2667 0.1225 -0.0020 0.0378 -0.0002 3.4646 9.4698 4.0168 4.3425 -3.3033 -5.9354 -0.3078 0.5260 -0.2981 0.0046 0.1880 -0.3182 0.3668 -0.1621 -0.6207 'X-RAY DIFFRACTION' 13 ? refined -16.7366 9.7383 25.4140 0.1422 0.3741 0.2395 -0.0910 -0.0049 -0.0711 1.8418 1.6700 2.2282 -1.1083 0.7155 -1.1658 -0.0061 -0.1885 0.0700 0.0616 -0.0688 0.1082 0.1821 0.1370 -0.4146 'X-RAY DIFFRACTION' 14 ? refined -24.2194 13.5153 24.1221 0.1742 0.7271 0.4189 -0.0021 0.0244 -0.0206 0.1093 1.7302 4.2310 0.4341 0.4679 1.7148 -0.1061 0.1902 -0.2019 -0.1757 -0.8200 -0.4342 -0.0179 -0.0703 0.2948 'X-RAY DIFFRACTION' 15 ? refined -17.6324 8.0174 18.8233 0.5302 0.3074 0.4300 0.1110 -0.0411 -0.0803 6.8752 1.6230 2.1083 -1.9143 0.8675 -1.7173 0.4971 -0.3839 0.2732 1.1135 -1.6089 0.2346 -0.3845 1.1221 0.2310 'X-RAY DIFFRACTION' 16 ? refined -18.8263 16.8167 23.5316 0.1440 0.3896 0.2056 -0.2207 -0.0199 0.0242 2.7310 2.0450 4.5380 -2.1675 1.8830 -0.4799 0.0779 -0.3573 0.0160 -0.7194 0.0801 -0.0434 0.3891 -0.2520 -0.2539 'X-RAY DIFFRACTION' 17 ? refined -28.5226 6.5497 -11.9716 0.1300 0.1188 0.1790 -0.0771 0.0471 0.0324 3.1861 8.4388 3.2222 1.1018 2.1575 1.5690 -0.4050 0.0711 0.1506 -0.0123 -0.3401 0.4571 0.5583 0.7874 -0.1738 'X-RAY DIFFRACTION' 18 ? refined -40.1898 9.3092 -0.9395 -0.0305 0.3879 0.1785 -0.0552 0.2089 -0.1720 6.2093 1.0594 3.7752 -1.6476 2.0149 -1.8258 -0.0413 -0.3566 -1.0770 -0.0010 0.4814 -0.1202 -0.2092 0.0481 -0.4081 'X-RAY DIFFRACTION' 19 ? refined -38.5900 3.4427 -1.1043 0.1812 0.5208 0.2625 -0.0077 0.0173 -0.0399 5.9355 3.0391 0.9547 2.3807 1.1135 0.0368 0.2366 -0.1139 0.0292 -0.4013 -0.7962 -0.4182 0.0579 0.0327 -0.1302 'X-RAY DIFFRACTION' 20 ? refined -25.2946 7.7518 -0.8554 0.0749 0.2778 0.2352 -0.0331 -0.0786 -0.1784 3.5188 2.8983 2.7446 3.1388 0.6111 0.0258 0.2460 0.1862 -0.4534 -0.1628 -0.4727 -0.7233 0.2048 0.3258 0.6180 'X-RAY DIFFRACTION' 21 ? refined -31.4764 6.2287 -7.2711 -0.0012 0.3853 0.0088 -0.1498 -0.1758 -0.2615 2.3640 5.3968 2.7756 3.2109 2.1583 3.4468 -0.0850 0.1055 0.6149 0.3187 -0.0539 -0.0967 0.1402 0.0859 -0.3934 'X-RAY DIFFRACTION' 22 ? refined -21.5824 18.7942 -1.6263 0.3260 0.6334 0.5218 -0.0458 -0.1185 -0.1902 6.2790 2.5285 6.5514 -0.8001 4.3457 0.0291 -0.8538 0.1470 0.5377 -0.0010 1.1723 -0.8403 0.2457 -1.3340 1.3084 'X-RAY DIFFRACTION' 23 ? refined -30.3119 20.8823 -9.3431 0.3020 0.1782 0.4639 -0.0507 -0.0077 -0.1329 4.1303 4.3131 5.1055 -2.8816 -1.8310 -1.6815 -0.4949 0.3513 0.1588 0.5495 0.6823 0.3579 0.2583 -0.8138 0.1432 'X-RAY DIFFRACTION' 24 ? refined -15.3328 3.6549 -20.2837 0.2071 0.2414 0.2393 -0.0242 -0.0070 0.0954 5.9190 3.2673 6.3880 0.5713 -3.8308 -0.9775 -0.4330 -0.5040 0.3190 -0.3662 -0.7839 -0.1489 -0.2828 0.2034 0.7630 'X-RAY DIFFRACTION' 25 ? refined -12.4121 10.8997 -19.1835 0.4920 0.8070 0.4047 -0.1874 -0.0619 0.0611 0.3917 0.6324 7.3699 -0.4751 1.6872 -2.0096 -0.0765 -0.6625 0.6599 0.5604 0.5885 -0.4165 0.3044 -0.9701 2.0146 'X-RAY DIFFRACTION' 26 ? refined -17.0872 5.7287 -11.3210 0.2812 0.3920 0.1540 -0.0192 -0.0270 -0.0665 4.7993 4.4392 6.2970 -0.4644 -1.7260 0.0362 0.4961 -0.2709 -0.3863 -0.8008 0.5529 -0.2808 0.5438 -0.3532 0.4814 'X-RAY DIFFRACTION' 27 ? refined -22.5158 15.5614 -23.0244 0.6191 0.3650 0.6063 0.2960 0.0229 0.1734 0.6722 0.9126 1.4562 -0.3683 0.5022 -1.1528 0.1696 -0.3002 0.6684 0.4274 0.4191 -0.5848 -0.2283 -0.3620 0.0877 'X-RAY DIFFRACTION' 28 ? refined -19.6111 4.5186 -15.3300 0.1712 0.1833 0.2320 0.0984 0.0769 0.0680 4.6369 8.2076 2.5933 -2.3988 -0.3395 2.0725 -0.3146 0.0225 -0.2569 -0.7000 -0.7663 1.0634 0.5389 0.3204 0.0660 'X-RAY DIFFRACTION' 29 ? refined -15.6339 39.4736 19.4070 0.2056 0.3292 0.2879 0.0282 -0.0470 0.0260 1.0368 4.1752 3.7099 -0.5298 0.7515 2.1128 0.1747 -0.1670 -0.1295 0.0194 -0.1372 -0.2208 -0.2746 -0.0439 0.3022 'X-RAY DIFFRACTION' 30 ? refined -27.8527 40.0230 31.3550 0.0882 0.4911 0.2413 0.0077 -0.0403 -0.0545 2.8549 4.2397 4.1878 0.7727 -0.3334 -0.9996 -0.2077 0.0641 0.2016 0.6991 -0.1068 0.2292 -0.0669 0.1083 0.4290 'X-RAY DIFFRACTION' 31 ? refined -16.3697 40.8643 28.8271 0.1445 0.4438 0.2433 0.0312 0.0154 0.1489 3.3219 3.3138 2.4128 2.7524 1.7690 1.8861 -0.3013 0.2438 0.0435 -0.0399 -0.0324 0.0519 0.1193 -0.0702 0.5246 'X-RAY DIFFRACTION' 32 ? refined -16.4042 54.2979 26.3363 0.2957 0.2555 0.4467 -0.1169 -0.0803 0.0151 1.0663 4.1308 7.7135 -1.8400 -0.4068 -0.9211 -0.4447 0.0400 0.3926 0.1195 0.3865 -0.4856 0.1056 -1.2697 1.1155 'X-RAY DIFFRACTION' 33 ? refined -3.2590 37.8932 12.4917 0.1220 0.5284 0.2939 -0.0099 -0.0480 -0.0106 2.8185 1.2854 3.9605 -0.4789 -1.0221 0.3988 0.1144 0.2290 -0.1044 0.0226 -0.4214 -0.3786 -0.0604 0.6588 1.0324 'X-RAY DIFFRACTION' 34 ? refined -0.4989 46.7680 11.3313 0.2341 0.4420 0.5258 -0.1617 -0.0889 0.0976 1.9688 1.9957 1.6750 0.1985 -1.7992 -0.4429 -0.0334 0.1839 -0.1721 -0.5174 0.0339 0.5776 -0.1700 -0.3853 0.5601 'X-RAY DIFFRACTION' 35 ? refined -7.4147 44.1295 17.0592 0.2097 0.4639 0.2287 0.0533 0.0597 -0.0186 6.9331 5.5101 6.8583 -2.0266 3.5135 -3.0327 -0.0954 0.4650 -0.1726 -0.6632 0.8671 0.1179 -0.4023 0.1941 -0.0654 'X-RAY DIFFRACTION' 36 ? refined -7.8731 39.0884 17.4250 0.1109 0.4719 0.0767 -0.1218 0.1298 -0.0578 8.7515 6.2912 4.6232 0.5295 -0.1013 -0.6112 -0.1883 -0.0067 -0.0602 -0.6245 -0.8845 -0.2549 0.1170 0.4471 -0.6433 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 C 37 C 47 ;chain 'C' and (resid 37 through 47 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 C 48 C 67 ;chain 'C' and (resid 48 through 67 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 C 68 C 90 ;chain 'C' and (resid 68 through 90 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 C 91 C 108 ;chain 'C' and (resid 91 through 108 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 C 109 C 129 ;chain 'C' and (resid 109 through 129 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 C 130 C 161 ;chain 'C' and (resid 130 through 161 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 C 162 C 169 ;chain 'C' and (resid 162 through 169 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 C 170 C 176 ;chain 'C' and (resid 170 through 176 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 43 A 57 ;chain 'A' and (resid 43 through 57 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 A 58 A 76 ;chain 'A' and (resid 58 through 76 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 A 77 A 90 ;chain 'A' and (resid 77 through 90 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 12 12 A 91 A 101 ;chain 'A' and (resid 91 through 101 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 13 13 A 102 A 139 ;chain 'A' and (resid 102 through 139 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 14 14 A 140 A 157 ;chain 'A' and (resid 140 through 157 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 15 15 A 158 A 169 ;chain 'A' and (resid 158 through 169 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 16 16 A 170 A 176 ;chain 'A' and (resid 170 through 176 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 17 17 B 44 B 57 ;chain 'B' and (resid 44 through 57 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 18 18 B 58 B 67 ;chain 'B' and (resid 58 through 67 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 19 19 B 68 B 76 ;chain 'B' and (resid 68 through 76 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 20 20 B 77 B 90 ;chain 'B' and (resid 77 through 90 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 21 21 B 91 B 101 ;chain 'B' and (resid 91 through 101 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 22 22 B 102 B 108 ;chain 'B' and (resid 102 through 108 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 23 23 B 109 B 121 ;chain 'B' and (resid 109 through 121 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 24 24 B 122 B 139 ;chain 'B' and (resid 122 through 139 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 25 25 B 140 B 151 ;chain 'B' and (resid 140 through 151 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 26 26 B 152 B 161 ;chain 'B' and (resid 152 through 161 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 27 27 B 162 B 169 ;chain 'B' and (resid 162 through 169 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 28 28 B 170 B 176 ;chain 'B' and (resid 170 through 176 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 29 29 D 43 D 57 ;chain 'D' and (resid 43 through 57 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 30 30 D 58 D 76 ;chain 'D' and (resid 58 through 76 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 31 31 D 77 D 101 ;chain 'D' and (resid 77 through 101 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 32 32 D 102 D 121 ;chain 'D' and (resid 102 through 121 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 33 33 D 122 D 139 ;chain 'D' and (resid 122 through 139 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 34 34 D 140 D 149 ;chain 'D' and (resid 140 through 149 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 35 35 D 150 D 169 ;chain 'D' and (resid 150 through 169 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 36 36 D 170 D 176 ;chain 'D' and (resid 170 through 176 ) ; ? ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C MET 22 ? A MET 1 2 1 Y 1 C HIS 23 ? A HIS 2 3 1 Y 1 C HIS 24 ? A HIS 3 4 1 Y 1 C HIS 25 ? A HIS 4 5 1 Y 1 C HIS 26 ? A HIS 5 6 1 Y 1 C HIS 27 ? A HIS 6 7 1 Y 1 C HIS 28 ? A HIS 7 8 1 Y 1 C SER 29 ? A SER 8 9 1 Y 1 C SER 30 ? A SER 9 10 1 Y 1 C GLY 31 ? A GLY 10 11 1 Y 1 C VAL 32 ? A VAL 11 12 1 Y 1 C ASP 33 ? A ASP 12 13 1 Y 1 C LEU 34 ? A LEU 13 14 1 Y 1 C GLY 35 ? A GLY 14 15 1 Y 1 C THR 36 ? A THR 15 16 1 Y 1 C GLU 147 ? A GLU 126 17 1 Y 1 C GLU 148 ? A GLU 127 18 1 Y 1 A MET 22 ? B MET 1 19 1 Y 1 A HIS 23 ? B HIS 2 20 1 Y 1 A HIS 24 ? B HIS 3 21 1 Y 1 A HIS 25 ? B HIS 4 22 1 Y 1 A HIS 26 ? B HIS 5 23 1 Y 1 A HIS 27 ? B HIS 6 24 1 Y 1 A HIS 28 ? B HIS 7 25 1 Y 1 A SER 29 ? B SER 8 26 1 Y 1 A SER 30 ? B SER 9 27 1 Y 1 A GLY 31 ? B GLY 10 28 1 Y 1 A VAL 32 ? B VAL 11 29 1 Y 1 A ASP 33 ? B ASP 12 30 1 Y 1 A LEU 34 ? B LEU 13 31 1 Y 1 A GLY 35 ? B GLY 14 32 1 Y 1 A THR 36 ? B THR 15 33 1 Y 1 A GLU 37 ? B GLU 16 34 1 Y 1 A ASN 38 ? B ASN 17 35 1 Y 1 A LEU 39 ? B LEU 18 36 1 Y 1 A TYR 40 ? B TYR 19 37 1 Y 1 A PHE 41 ? B PHE 20 38 1 Y 1 A GLN 42 ? B GLN 21 39 1 Y 1 A CYS 143 ? B CYS 122 40 1 Y 1 A SER 144 ? B SER 123 41 1 Y 1 A GLU 148 ? B GLU 127 42 1 Y 1 B MET 22 ? C MET 1 43 1 Y 1 B HIS 23 ? C HIS 2 44 1 Y 1 B HIS 24 ? C HIS 3 45 1 Y 1 B HIS 25 ? C HIS 4 46 1 Y 1 B HIS 26 ? C HIS 5 47 1 Y 1 B HIS 27 ? C HIS 6 48 1 Y 1 B HIS 28 ? C HIS 7 49 1 Y 1 B SER 29 ? C SER 8 50 1 Y 1 B SER 30 ? C SER 9 51 1 Y 1 B GLY 31 ? C GLY 10 52 1 Y 1 B VAL 32 ? C VAL 11 53 1 Y 1 B ASP 33 ? C ASP 12 54 1 Y 1 B LEU 34 ? C LEU 13 55 1 Y 1 B GLY 35 ? C GLY 14 56 1 Y 1 B THR 36 ? C THR 15 57 1 Y 1 B GLU 37 ? C GLU 16 58 1 Y 1 B ASN 38 ? C ASN 17 59 1 Y 1 B LEU 39 ? C LEU 18 60 1 Y 1 B TYR 40 ? C TYR 19 61 1 Y 1 B PHE 41 ? C PHE 20 62 1 Y 1 B GLN 42 ? C GLN 21 63 1 Y 1 B SER 43 ? C SER 22 64 1 Y 1 B SER 146 ? C SER 125 65 1 Y 1 B GLU 147 ? C GLU 126 66 1 Y 1 D MET 22 ? D MET 1 67 1 Y 1 D HIS 23 ? D HIS 2 68 1 Y 1 D HIS 24 ? D HIS 3 69 1 Y 1 D HIS 25 ? D HIS 4 70 1 Y 1 D HIS 26 ? D HIS 5 71 1 Y 1 D HIS 27 ? D HIS 6 72 1 Y 1 D HIS 28 ? D HIS 7 73 1 Y 1 D SER 29 ? D SER 8 74 1 Y 1 D SER 30 ? D SER 9 75 1 Y 1 D GLY 31 ? D GLY 10 76 1 Y 1 D VAL 32 ? D VAL 11 77 1 Y 1 D ASP 33 ? D ASP 12 78 1 Y 1 D LEU 34 ? D LEU 13 79 1 Y 1 D GLY 35 ? D GLY 14 80 1 Y 1 D THR 36 ? D THR 15 81 1 Y 1 D GLU 37 ? D GLU 16 82 1 Y 1 D ASN 38 ? D ASN 17 83 1 Y 1 D LEU 39 ? D LEU 18 84 1 Y 1 D TYR 40 ? D TYR 19 85 1 Y 1 D PHE 41 ? D PHE 20 86 1 Y 1 D GLN 42 ? D GLN 21 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CO CO CO N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3RMU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6QH4 _atom_sites.fract_transf_matrix[1][1] 0.018810 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000005 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014928 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012966 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CO N O S # loop_