data_6QMI # _entry.id 6QMI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6QMI pdb_00006qmi 10.2210/pdb6qmi/pdb WWPDB D_1292100447 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-26 2 'Structure model' 1 1 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2020-02-26 _pdbx_database_PDB_obs_spr.pdb_id 6QMI _pdbx_database_PDB_obs_spr.replace_pdb_id 6G7S _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6QMI _pdbx_database_status.recvd_initial_deposition_date 2019-02-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Blaszczyk, M.' 1 ? 'Blundell, T.L.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Fragment linking applied to the discovery of Mycobacterium tuberculosis phosphopantetheine adenylyltransferase inhibitors' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blaszczyk, M.' 1 ? primary 'El Bakali, J.' 2 ? primary 'Boland, J.A.' 3 ? primary 'Spry, C.' 4 ? primary 'Dias, M.' 5 ? primary 'Blundell, T.L.' 6 ? primary 'Abel, C.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphopantetheine adenylyltransferase' 17792.385 1 2.7.7.3 ? ? ? 2 non-polymer syn '5-methyl-1-phenyl-pyrazole-4-carboxylic acid' 202.209 1 ? ? ? ? 3 water nat water 18.015 78 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dephospho-CoA pyrophosphorylase,Pantetheine-phosphate adenylyltransferase,PPAT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVR SCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNT ERT ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVR SCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNT ERT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-methyl-1-phenyl-pyrazole-4-carboxylic acid' 9FH 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 THR n 1 5 GLY n 1 6 ALA n 1 7 VAL n 1 8 CYS n 1 9 PRO n 1 10 GLY n 1 11 SER n 1 12 PHE n 1 13 ASP n 1 14 PRO n 1 15 VAL n 1 16 THR n 1 17 LEU n 1 18 GLY n 1 19 HIS n 1 20 VAL n 1 21 ASP n 1 22 ILE n 1 23 PHE n 1 24 GLU n 1 25 ARG n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 GLN n 1 30 PHE n 1 31 ASP n 1 32 GLU n 1 33 VAL n 1 34 VAL n 1 35 VAL n 1 36 ALA n 1 37 ILE n 1 38 LEU n 1 39 VAL n 1 40 ASN n 1 41 PRO n 1 42 ALA n 1 43 LYS n 1 44 THR n 1 45 GLY n 1 46 MET n 1 47 PHE n 1 48 ASP n 1 49 LEU n 1 50 ASP n 1 51 GLU n 1 52 ARG n 1 53 ILE n 1 54 ALA n 1 55 MET n 1 56 VAL n 1 57 LYS n 1 58 GLU n 1 59 SER n 1 60 THR n 1 61 THR n 1 62 HIS n 1 63 LEU n 1 64 PRO n 1 65 ASN n 1 66 LEU n 1 67 ARG n 1 68 VAL n 1 69 GLN n 1 70 VAL n 1 71 GLY n 1 72 HIS n 1 73 GLY n 1 74 LEU n 1 75 VAL n 1 76 VAL n 1 77 ASP n 1 78 PHE n 1 79 VAL n 1 80 ARG n 1 81 SER n 1 82 CYS n 1 83 GLY n 1 84 MET n 1 85 THR n 1 86 ALA n 1 87 ILE n 1 88 VAL n 1 89 LYS n 1 90 GLY n 1 91 LEU n 1 92 ARG n 1 93 THR n 1 94 GLY n 1 95 THR n 1 96 ASP n 1 97 PHE n 1 98 GLU n 1 99 TYR n 1 100 GLU n 1 101 LEU n 1 102 GLN n 1 103 MET n 1 104 ALA n 1 105 GLN n 1 106 MET n 1 107 ASN n 1 108 LYS n 1 109 HIS n 1 110 ILE n 1 111 ALA n 1 112 GLY n 1 113 VAL n 1 114 ASP n 1 115 THR n 1 116 PHE n 1 117 PHE n 1 118 VAL n 1 119 ALA n 1 120 THR n 1 121 ALA n 1 122 PRO n 1 123 ARG n 1 124 TYR n 1 125 SER n 1 126 PHE n 1 127 VAL n 1 128 SER n 1 129 SER n 1 130 SER n 1 131 LEU n 1 132 ALA n 1 133 LYS n 1 134 GLU n 1 135 VAL n 1 136 ALA n 1 137 MET n 1 138 LEU n 1 139 GLY n 1 140 GLY n 1 141 ASP n 1 142 VAL n 1 143 SER n 1 144 GLU n 1 145 LEU n 1 146 LEU n 1 147 PRO n 1 148 GLU n 1 149 PRO n 1 150 VAL n 1 151 ASN n 1 152 ARG n 1 153 ARG n 1 154 LEU n 1 155 ARG n 1 156 ASP n 1 157 ARG n 1 158 LEU n 1 159 ASN n 1 160 THR n 1 161 GLU n 1 162 ARG n 1 163 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 163 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'coaD, kdtB, Rv2965c, MTCY349.22, u0002e' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25618 / H37Rv' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9FH non-polymer . '5-methyl-1-phenyl-pyrazole-4-carboxylic acid' ? 'C11 H10 N2 O2' 202.209 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 THR 4 2 2 THR THR A . n A 1 5 GLY 5 3 3 GLY GLY A . n A 1 6 ALA 6 4 4 ALA ALA A . n A 1 7 VAL 7 5 5 VAL VAL A . n A 1 8 CYS 8 6 6 CYS CYS A . n A 1 9 PRO 9 7 7 PRO PRO A . n A 1 10 GLY 10 8 8 GLY GLY A . n A 1 11 SER 11 9 9 SER SER A . n A 1 12 PHE 12 10 10 PHE PHE A . n A 1 13 ASP 13 11 11 ASP ASP A . n A 1 14 PRO 14 12 12 PRO PRO A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 THR 16 14 14 THR THR A . n A 1 17 LEU 17 15 15 LEU LEU A . n A 1 18 GLY 18 16 16 GLY GLY A . n A 1 19 HIS 19 17 17 HIS HIS A . n A 1 20 VAL 20 18 18 VAL VAL A . n A 1 21 ASP 21 19 19 ASP ASP A . n A 1 22 ILE 22 20 20 ILE ILE A . n A 1 23 PHE 23 21 21 PHE PHE A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 ALA 26 24 24 ALA ALA A . n A 1 27 ALA 27 25 25 ALA ALA A . n A 1 28 ALA 28 26 26 ALA ALA A . n A 1 29 GLN 29 27 27 GLN GLN A . n A 1 30 PHE 30 28 28 PHE PHE A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 GLU 32 30 30 GLU GLU A . n A 1 33 VAL 33 31 31 VAL VAL A . n A 1 34 VAL 34 32 32 VAL VAL A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 ALA 36 34 34 ALA ALA A . n A 1 37 ILE 37 35 35 ILE ILE A . n A 1 38 LEU 38 36 36 LEU LEU A . n A 1 39 VAL 39 37 37 VAL VAL A . n A 1 40 ASN 40 38 ? ? ? A . n A 1 41 PRO 41 39 ? ? ? A . n A 1 42 ALA 42 40 ? ? ? A . n A 1 43 LYS 43 41 ? ? ? A . n A 1 44 THR 44 42 ? ? ? A . n A 1 45 GLY 45 43 43 GLY GLY A . n A 1 46 MET 46 44 44 MET MET A . n A 1 47 PHE 47 45 45 PHE PHE A . n A 1 48 ASP 48 46 46 ASP ASP A . n A 1 49 LEU 49 47 47 LEU LEU A . n A 1 50 ASP 50 48 48 ASP ASP A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 ARG 52 50 50 ARG ARG A . n A 1 53 ILE 53 51 51 ILE ILE A . n A 1 54 ALA 54 52 52 ALA ALA A . n A 1 55 MET 55 53 53 MET MET A . n A 1 56 VAL 56 54 54 VAL VAL A . n A 1 57 LYS 57 55 55 LYS LYS A . n A 1 58 GLU 58 56 56 GLU GLU A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 THR 60 58 58 THR THR A . n A 1 61 THR 61 59 59 THR THR A . n A 1 62 HIS 62 60 60 HIS HIS A . n A 1 63 LEU 63 61 61 LEU LEU A . n A 1 64 PRO 64 62 62 PRO PRO A . n A 1 65 ASN 65 63 63 ASN ASN A . n A 1 66 LEU 66 64 64 LEU LEU A . n A 1 67 ARG 67 65 65 ARG ARG A . n A 1 68 VAL 68 66 66 VAL VAL A . n A 1 69 GLN 69 67 67 GLN GLN A . n A 1 70 VAL 70 68 68 VAL VAL A . n A 1 71 GLY 71 69 69 GLY GLY A . n A 1 72 HIS 72 70 70 HIS HIS A . n A 1 73 GLY 73 71 71 GLY GLY A . n A 1 74 LEU 74 72 72 LEU LEU A . n A 1 75 VAL 75 73 73 VAL VAL A . n A 1 76 VAL 76 74 74 VAL VAL A . n A 1 77 ASP 77 75 75 ASP ASP A . n A 1 78 PHE 78 76 76 PHE PHE A . n A 1 79 VAL 79 77 77 VAL VAL A . n A 1 80 ARG 80 78 78 ARG ARG A . n A 1 81 SER 81 79 79 SER SER A . n A 1 82 CYS 82 80 80 CYS CYS A . n A 1 83 GLY 83 81 81 GLY GLY A . n A 1 84 MET 84 82 82 MET MET A . n A 1 85 THR 85 83 83 THR THR A . n A 1 86 ALA 86 84 84 ALA ALA A . n A 1 87 ILE 87 85 85 ILE ILE A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 LYS 89 87 87 LYS LYS A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 LEU 91 89 89 LEU LEU A . n A 1 92 ARG 92 90 ? ? ? A . n A 1 93 THR 93 91 ? ? ? A . n A 1 94 GLY 94 92 ? ? ? A . n A 1 95 THR 95 93 ? ? ? A . n A 1 96 ASP 96 94 ? ? ? A . n A 1 97 PHE 97 95 ? ? ? A . n A 1 98 GLU 98 96 96 GLU GLU A . n A 1 99 TYR 99 97 97 TYR TYR A . n A 1 100 GLU 100 98 98 GLU GLU A . n A 1 101 LEU 101 99 99 LEU LEU A . n A 1 102 GLN 102 100 100 GLN GLN A . n A 1 103 MET 103 101 101 MET MET A . n A 1 104 ALA 104 102 102 ALA ALA A . n A 1 105 GLN 105 103 103 GLN GLN A . n A 1 106 MET 106 104 104 MET MET A . n A 1 107 ASN 107 105 105 ASN ASN A . n A 1 108 LYS 108 106 106 LYS LYS A . n A 1 109 HIS 109 107 107 HIS HIS A . n A 1 110 ILE 110 108 108 ILE ILE A . n A 1 111 ALA 111 109 109 ALA ALA A . n A 1 112 GLY 112 110 110 GLY GLY A . n A 1 113 VAL 113 111 111 VAL VAL A . n A 1 114 ASP 114 112 112 ASP ASP A . n A 1 115 THR 115 113 113 THR THR A . n A 1 116 PHE 116 114 114 PHE PHE A . n A 1 117 PHE 117 115 115 PHE PHE A . n A 1 118 VAL 118 116 116 VAL VAL A . n A 1 119 ALA 119 117 117 ALA ALA A . n A 1 120 THR 120 118 118 THR THR A . n A 1 121 ALA 121 119 119 ALA ALA A . n A 1 122 PRO 122 120 120 PRO PRO A . n A 1 123 ARG 123 121 121 ARG ARG A . n A 1 124 TYR 124 122 122 TYR TYR A . n A 1 125 SER 125 123 123 SER SER A . n A 1 126 PHE 126 124 124 PHE PHE A . n A 1 127 VAL 127 125 125 VAL VAL A . n A 1 128 SER 128 126 126 SER SER A . n A 1 129 SER 129 127 127 SER SER A . n A 1 130 SER 130 128 128 SER SER A . n A 1 131 LEU 131 129 129 LEU LEU A . n A 1 132 ALA 132 130 130 ALA ALA A . n A 1 133 LYS 133 131 131 LYS LYS A . n A 1 134 GLU 134 132 132 GLU GLU A . n A 1 135 VAL 135 133 133 VAL VAL A . n A 1 136 ALA 136 134 134 ALA ALA A . n A 1 137 MET 137 135 135 MET MET A . n A 1 138 LEU 138 136 136 LEU LEU A . n A 1 139 GLY 139 137 137 GLY GLY A . n A 1 140 GLY 140 138 138 GLY GLY A . n A 1 141 ASP 141 139 139 ASP ASP A . n A 1 142 VAL 142 140 140 VAL VAL A . n A 1 143 SER 143 141 141 SER SER A . n A 1 144 GLU 144 142 142 GLU GLU A . n A 1 145 LEU 145 143 143 LEU LEU A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 PRO 147 145 145 PRO PRO A . n A 1 148 GLU 148 146 146 GLU GLU A . n A 1 149 PRO 149 147 147 PRO PRO A . n A 1 150 VAL 150 148 148 VAL VAL A . n A 1 151 ASN 151 149 149 ASN ASN A . n A 1 152 ARG 152 150 150 ARG ARG A . n A 1 153 ARG 153 151 151 ARG ARG A . n A 1 154 LEU 154 152 152 LEU LEU A . n A 1 155 ARG 155 153 153 ARG ARG A . n A 1 156 ASP 156 154 154 ASP ASP A . n A 1 157 ARG 157 155 155 ARG ARG A . n A 1 158 LEU 158 156 156 LEU LEU A . n A 1 159 ASN 159 157 157 ASN ASN A . n A 1 160 THR 160 158 ? ? ? A . n A 1 161 GLU 161 159 ? ? ? A . n A 1 162 ARG 162 160 ? ? ? A . n A 1 163 THR 163 161 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 9FH 1 201 1 9FH LIG A . C 3 HOH 1 301 50 HOH HOH A . C 3 HOH 2 302 65 HOH HOH A . C 3 HOH 3 303 82 HOH HOH A . C 3 HOH 4 304 27 HOH HOH A . C 3 HOH 5 305 26 HOH HOH A . C 3 HOH 6 306 42 HOH HOH A . C 3 HOH 7 307 75 HOH HOH A . C 3 HOH 8 308 37 HOH HOH A . C 3 HOH 9 309 28 HOH HOH A . C 3 HOH 10 310 17 HOH HOH A . C 3 HOH 11 311 15 HOH HOH A . C 3 HOH 12 312 6 HOH HOH A . C 3 HOH 13 313 23 HOH HOH A . C 3 HOH 14 314 52 HOH HOH A . C 3 HOH 15 315 56 HOH HOH A . C 3 HOH 16 316 41 HOH HOH A . C 3 HOH 17 317 80 HOH HOH A . C 3 HOH 18 318 8 HOH HOH A . C 3 HOH 19 319 13 HOH HOH A . C 3 HOH 20 320 66 HOH HOH A . C 3 HOH 21 321 1 HOH HOH A . C 3 HOH 22 322 83 HOH HOH A . C 3 HOH 23 323 9 HOH HOH A . C 3 HOH 24 324 4 HOH HOH A . C 3 HOH 25 325 18 HOH HOH A . C 3 HOH 26 326 25 HOH HOH A . C 3 HOH 27 327 12 HOH HOH A . C 3 HOH 28 328 2 HOH HOH A . C 3 HOH 29 329 40 HOH HOH A . C 3 HOH 30 330 73 HOH HOH A . C 3 HOH 31 331 7 HOH HOH A . C 3 HOH 32 332 20 HOH HOH A . C 3 HOH 33 333 68 HOH HOH A . C 3 HOH 34 334 51 HOH HOH A . C 3 HOH 35 335 11 HOH HOH A . C 3 HOH 36 336 16 HOH HOH A . C 3 HOH 37 337 32 HOH HOH A . C 3 HOH 38 338 33 HOH HOH A . C 3 HOH 39 339 36 HOH HOH A . C 3 HOH 40 340 74 HOH HOH A . C 3 HOH 41 341 14 HOH HOH A . C 3 HOH 42 342 35 HOH HOH A . C 3 HOH 43 343 38 HOH HOH A . C 3 HOH 44 344 30 HOH HOH A . C 3 HOH 45 345 24 HOH HOH A . C 3 HOH 46 346 34 HOH HOH A . C 3 HOH 47 347 59 HOH HOH A . C 3 HOH 48 348 55 HOH HOH A . C 3 HOH 49 349 84 HOH HOH A . C 3 HOH 50 350 79 HOH HOH A . C 3 HOH 51 351 29 HOH HOH A . C 3 HOH 52 352 62 HOH HOH A . C 3 HOH 53 353 3 HOH HOH A . C 3 HOH 54 354 69 HOH HOH A . C 3 HOH 55 355 19 HOH HOH A . C 3 HOH 56 356 10 HOH HOH A . C 3 HOH 57 357 45 HOH HOH A . C 3 HOH 58 358 43 HOH HOH A . C 3 HOH 59 359 71 HOH HOH A . C 3 HOH 60 360 39 HOH HOH A . C 3 HOH 61 361 47 HOH HOH A . C 3 HOH 62 362 58 HOH HOH A . C 3 HOH 63 363 22 HOH HOH A . C 3 HOH 64 364 76 HOH HOH A . C 3 HOH 65 365 63 HOH HOH A . C 3 HOH 66 366 54 HOH HOH A . C 3 HOH 67 367 85 HOH HOH A . C 3 HOH 68 368 53 HOH HOH A . C 3 HOH 69 369 5 HOH HOH A . C 3 HOH 70 370 44 HOH HOH A . C 3 HOH 71 371 57 HOH HOH A . C 3 HOH 72 372 72 HOH HOH A . C 3 HOH 73 373 61 HOH HOH A . C 3 HOH 74 374 21 HOH HOH A . C 3 HOH 75 375 48 HOH HOH A . C 3 HOH 76 376 86 HOH HOH A . C 3 HOH 77 377 49 HOH HOH A . C 3 HOH 78 378 81 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6QMI _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.994 _cell.length_a_esd ? _cell.length_b 97.994 _cell.length_b_esd ? _cell.length_c 113.956 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QMI _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QMI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.96 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.43 _exptl_crystal.description cubes _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MPD, CoHexamine Chloride, Cacodylate/Tris' _exptl_crystal_grow.pdbx_pH_range 6.5-8.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-03-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 34.420 _reflns.entry_id 6QMI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.781 _reflns.d_resolution_low 34.032 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20290 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.300 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.031 _reflns.pdbx_netI_over_av_sigmaI 13.600 _reflns.pdbx_netI_over_sigmaI 33.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.036 _reflns.pdbx_Rpim_I_all 0.012 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.781 1.880 ? 1.100 ? ? ? ? 2919 100.000 ? ? ? ? 0.734 ? ? ? ? ? ? ? ? 8.400 0.734 ? ? ? 0.840 0.290 ? 1 1 ? ? 1.880 1.990 ? 1.900 ? ? ? ? 2780 100.000 ? ? ? ? 0.399 ? ? ? ? ? ? ? ? 8.300 0.399 ? ? ? 0.455 0.157 ? 2 1 ? ? 1.990 2.130 ? 3.900 ? ? ? ? 2629 100.000 ? ? ? ? 0.196 ? ? ? ? ? ? ? ? 8.300 0.196 ? ? ? 0.224 0.077 ? 3 1 ? ? 2.130 2.300 ? 7.400 ? ? ? ? 2427 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 8.300 0.104 ? ? ? 0.119 0.041 ? 4 1 ? ? 2.300 2.520 ? 11.500 ? ? ? ? 2257 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 8.400 0.066 ? ? ? 0.075 0.026 ? 5 1 ? ? 2.520 2.820 ? 18.300 ? ? ? ? 2033 100.000 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 8.400 0.040 ? ? ? 0.047 0.016 ? 6 1 ? ? 2.820 3.250 ? 26.200 ? ? ? ? 1824 99.900 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 8.300 0.026 ? ? ? 0.030 0.010 ? 7 1 ? ? 3.250 3.980 ? 29.300 ? ? ? ? 1532 99.900 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 8.200 0.020 ? ? ? 0.023 0.008 ? 8 1 ? ? 3.980 5.630 ? 32.200 ? ? ? ? 1199 99.500 ? ? ? ? 0.017 ? ? ? ? ? ? ? ? 8.000 0.017 ? ? ? 0.021 0.007 ? 9 1 ? ? 5.630 34.032 ? 23.600 ? ? ? ? 690 99.200 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 7.600 0.020 ? ? ? 0.025 0.009 ? 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 87.870 _refine.B_iso_mean 41.1592 _refine.B_iso_min 20.630 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6QMI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7810 _refine.ls_d_res_low 34.0320 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20289 _refine.ls_number_reflns_R_free 1040 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8500 _refine.ls_percent_reflns_R_free 5.1300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2473 _refine.ls_R_factor_R_free 0.2824 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2455 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1TFU _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.3400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7810 _refine_hist.d_res_low 34.0320 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 78 _refine_hist.number_atoms_total 1210 _refine_hist.pdbx_number_residues_total 146 _refine_hist.pdbx_B_iso_mean_ligand 39.66 _refine_hist.pdbx_B_iso_mean_solvent 44.68 _refine_hist.pdbx_number_atoms_protein 1117 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1157 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.098 ? 1566 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 182 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 204 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.536 ? 423 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7812 1.8751 2851 . 161 2690 100.0000 . . . 0.4151 0.0000 0.3386 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.8751 1.9926 2872 . 150 2722 100.0000 . . . 0.4022 0.0000 0.3208 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.9926 2.1464 2893 . 145 2748 100.0000 . . . 0.3487 0.0000 0.2990 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.1464 2.3624 2879 . 153 2726 100.0000 . . . 0.3314 0.0000 0.2815 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.3624 2.7041 2893 . 161 2732 100.0000 . . . 0.3241 0.0000 0.2751 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.7041 3.4064 2922 . 139 2783 100.0000 . . . 0.2741 0.0000 0.2437 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.4064 34.0384 2979 . 131 2848 99.0000 . . . 0.2233 0.0000 0.2126 . . . . . . 7 . . . # _struct.entry_id 6QMI _struct.title ;Phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis in complex with 3-(1H-indol-1-yl)propanoic acid at 1.7A resolution. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QMI _struct_keywords.text 'CoaD, PPAT, Transferase, Complex' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COAD_MYCTU _struct_ref.pdbx_db_accession P9WPA5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSC GMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTER T ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QMI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 163 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WPA5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QMI GLY A 1 ? UNP P9WPA5 ? ? 'expression tag' -1 1 1 6QMI SER A 2 ? UNP P9WPA5 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11730 ? 1 MORE -85 ? 1 'SSA (A^2)' 35950 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 -x,-x+y,-z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 16 ? PHE A 30 ? THR A 14 PHE A 28 1 ? 15 HELX_P HELX_P2 AA2 ASP A 48 ? THR A 60 ? ASP A 46 THR A 58 1 ? 13 HELX_P HELX_P3 AA3 LEU A 74 ? CYS A 82 ? LEU A 72 CYS A 80 1 ? 9 HELX_P HELX_P4 AA4 TYR A 99 ? GLY A 112 ? TYR A 97 GLY A 110 1 ? 14 HELX_P HELX_P5 AA5 ALA A 121 ? SER A 125 ? ALA A 119 SER A 123 5 ? 5 HELX_P HELX_P6 AA6 SER A 128 ? LEU A 138 ? SER A 126 LEU A 136 1 ? 11 HELX_P HELX_P7 AA7 VAL A 142 ? LEU A 146 ? VAL A 140 LEU A 144 5 ? 5 HELX_P HELX_P8 AA8 PRO A 147 ? ASN A 159 ? PRO A 145 ASN A 157 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 13 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 11 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 14 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 12 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.21 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 66 ? GLY A 71 ? LEU A 64 GLY A 69 AA1 2 GLU A 32 ? LEU A 38 ? GLU A 30 LEU A 36 AA1 3 GLY A 5 ? GLY A 10 ? GLY A 3 GLY A 8 AA1 4 ALA A 86 ? LEU A 91 ? ALA A 84 LEU A 89 AA1 5 THR A 115 ? ALA A 119 ? THR A 113 ALA A 117 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 67 ? O ARG A 65 N VAL A 35 ? N VAL A 33 AA1 2 3 O LEU A 38 ? O LEU A 36 N GLY A 10 ? N GLY A 8 AA1 3 4 N VAL A 7 ? N VAL A 5 O VAL A 88 ? O VAL A 86 AA1 4 5 N ILE A 87 ? N ILE A 85 O PHE A 116 ? O PHE A 114 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 9FH _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'binding site for residue 9FH A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 THR A 16 ? THR A 14 . ? 1_555 ? 2 AC1 12 GLY A 18 ? GLY A 16 . ? 1_555 ? 3 AC1 12 HIS A 19 ? HIS A 17 . ? 1_555 ? 4 AC1 12 ILE A 22 ? ILE A 20 . ? 1_555 ? 5 AC1 12 THR A 120 ? THR A 118 . ? 1_555 ? 6 AC1 12 TYR A 124 ? TYR A 122 . ? 1_555 ? 7 AC1 12 VAL A 127 ? VAL A 125 . ? 1_555 ? 8 AC1 12 SER A 128 ? SER A 126 . ? 1_555 ? 9 AC1 12 SER A 129 ? SER A 127 . ? 1_555 ? 10 AC1 12 HOH C . ? HOH A 310 . ? 1_555 ? 11 AC1 12 HOH C . ? HOH A 326 . ? 1_555 ? 12 AC1 12 HOH C . ? HOH A 350 . ? 1_555 ? # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 332 ? C HOH . 2 1 A HOH 361 ? C HOH . 3 1 A HOH 370 ? C HOH . 4 1 A HOH 378 ? C HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A ASN 38 ? A ASN 40 4 1 Y 1 A PRO 39 ? A PRO 41 5 1 Y 1 A ALA 40 ? A ALA 42 6 1 Y 1 A LYS 41 ? A LYS 43 7 1 Y 1 A THR 42 ? A THR 44 8 1 Y 1 A ARG 90 ? A ARG 92 9 1 Y 1 A THR 91 ? A THR 93 10 1 Y 1 A GLY 92 ? A GLY 94 11 1 Y 1 A THR 93 ? A THR 95 12 1 Y 1 A ASP 94 ? A ASP 96 13 1 Y 1 A PHE 95 ? A PHE 97 14 1 Y 1 A THR 158 ? A THR 160 15 1 Y 1 A GLU 159 ? A GLU 161 16 1 Y 1 A ARG 160 ? A ARG 162 17 1 Y 1 A THR 161 ? A THR 163 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 9FH C10 C Y N 1 9FH C15 C N N 2 9FH C01 C Y N 3 9FH C02 C Y N 4 9FH C03 C Y N 5 9FH C04 C Y N 6 9FH C05 C Y N 7 9FH C06 C Y N 8 9FH N07 N Y N 9 9FH C08 C Y N 10 9FH C09 C Y N 11 9FH N11 N Y N 12 9FH C12 C N N 13 9FH O13 O N N 14 9FH O14 O N N 15 9FH H1 H N N 16 9FH H2 H N N 17 9FH H3 H N N 18 9FH H4 H N N 19 9FH H5 H N N 20 9FH H6 H N N 21 9FH H7 H N N 22 9FH H8 H N N 23 9FH H9 H N N 24 9FH H10 H N N 25 ALA N N N N 26 ALA CA C N S 27 ALA C C N N 28 ALA O O N N 29 ALA CB C N N 30 ALA OXT O N N 31 ALA H H N N 32 ALA H2 H N N 33 ALA HA H N N 34 ALA HB1 H N N 35 ALA HB2 H N N 36 ALA HB3 H N N 37 ALA HXT H N N 38 ARG N N N N 39 ARG CA C N S 40 ARG C C N N 41 ARG O O N N 42 ARG CB C N N 43 ARG CG C N N 44 ARG CD C N N 45 ARG NE N N N 46 ARG CZ C N N 47 ARG NH1 N N N 48 ARG NH2 N N N 49 ARG OXT O N N 50 ARG H H N N 51 ARG H2 H N N 52 ARG HA H N N 53 ARG HB2 H N N 54 ARG HB3 H N N 55 ARG HG2 H N N 56 ARG HG3 H N N 57 ARG HD2 H N N 58 ARG HD3 H N N 59 ARG HE H N N 60 ARG HH11 H N N 61 ARG HH12 H N N 62 ARG HH21 H N N 63 ARG HH22 H N N 64 ARG HXT H N N 65 ASN N N N N 66 ASN CA C N S 67 ASN C C N N 68 ASN O O N N 69 ASN CB C N N 70 ASN CG C N N 71 ASN OD1 O N N 72 ASN ND2 N N N 73 ASN OXT O N N 74 ASN H H N N 75 ASN H2 H N N 76 ASN HA H N N 77 ASN HB2 H N N 78 ASN HB3 H N N 79 ASN HD21 H N N 80 ASN HD22 H N N 81 ASN HXT H N N 82 ASP N N N N 83 ASP CA C N S 84 ASP C C N N 85 ASP O O N N 86 ASP CB C N N 87 ASP CG C N N 88 ASP OD1 O N N 89 ASP OD2 O N N 90 ASP OXT O N N 91 ASP H H N N 92 ASP H2 H N N 93 ASP HA H N N 94 ASP HB2 H N N 95 ASP HB3 H N N 96 ASP HD2 H N N 97 ASP HXT H N N 98 CYS N N N N 99 CYS CA C N R 100 CYS C C N N 101 CYS O O N N 102 CYS CB C N N 103 CYS SG S N N 104 CYS OXT O N N 105 CYS H H N N 106 CYS H2 H N N 107 CYS HA H N N 108 CYS HB2 H N N 109 CYS HB3 H N N 110 CYS HG H N N 111 CYS HXT H N N 112 GLN N N N N 113 GLN CA C N S 114 GLN C C N N 115 GLN O O N N 116 GLN CB C N N 117 GLN CG C N N 118 GLN CD C N N 119 GLN OE1 O N N 120 GLN NE2 N N N 121 GLN OXT O N N 122 GLN H H N N 123 GLN H2 H N N 124 GLN HA H N N 125 GLN HB2 H N N 126 GLN HB3 H N N 127 GLN HG2 H N N 128 GLN HG3 H N N 129 GLN HE21 H N N 130 GLN HE22 H N N 131 GLN HXT H N N 132 GLU N N N N 133 GLU CA C N S 134 GLU C C N N 135 GLU O O N N 136 GLU CB C N N 137 GLU CG C N N 138 GLU CD C N N 139 GLU OE1 O N N 140 GLU OE2 O N N 141 GLU OXT O N N 142 GLU H H N N 143 GLU H2 H N N 144 GLU HA H N N 145 GLU HB2 H N N 146 GLU HB3 H N N 147 GLU HG2 H N N 148 GLU HG3 H N N 149 GLU HE2 H N N 150 GLU HXT H N N 151 GLY N N N N 152 GLY CA C N N 153 GLY C C N N 154 GLY O O N N 155 GLY OXT O N N 156 GLY H H N N 157 GLY H2 H N N 158 GLY HA2 H N N 159 GLY HA3 H N N 160 GLY HXT H N N 161 HIS N N N N 162 HIS CA C N S 163 HIS C C N N 164 HIS O O N N 165 HIS CB C N N 166 HIS CG C Y N 167 HIS ND1 N Y N 168 HIS CD2 C Y N 169 HIS CE1 C Y N 170 HIS NE2 N Y N 171 HIS OXT O N N 172 HIS H H N N 173 HIS H2 H N N 174 HIS HA H N N 175 HIS HB2 H N N 176 HIS HB3 H N N 177 HIS HD1 H N N 178 HIS HD2 H N N 179 HIS HE1 H N N 180 HIS HE2 H N N 181 HIS HXT H N N 182 HOH O O N N 183 HOH H1 H N N 184 HOH H2 H N N 185 ILE N N N N 186 ILE CA C N S 187 ILE C C N N 188 ILE O O N N 189 ILE CB C N S 190 ILE CG1 C N N 191 ILE CG2 C N N 192 ILE CD1 C N N 193 ILE OXT O N N 194 ILE H H N N 195 ILE H2 H N N 196 ILE HA H N N 197 ILE HB H N N 198 ILE HG12 H N N 199 ILE HG13 H N N 200 ILE HG21 H N N 201 ILE HG22 H N N 202 ILE HG23 H N N 203 ILE HD11 H N N 204 ILE HD12 H N N 205 ILE HD13 H N N 206 ILE HXT H N N 207 LEU N N N N 208 LEU CA C N S 209 LEU C C N N 210 LEU O O N N 211 LEU CB C N N 212 LEU CG C N N 213 LEU CD1 C N N 214 LEU CD2 C N N 215 LEU OXT O N N 216 LEU H H N N 217 LEU H2 H N N 218 LEU HA H N N 219 LEU HB2 H N N 220 LEU HB3 H N N 221 LEU HG H N N 222 LEU HD11 H N N 223 LEU HD12 H N N 224 LEU HD13 H N N 225 LEU HD21 H N N 226 LEU HD22 H N N 227 LEU HD23 H N N 228 LEU HXT H N N 229 LYS N N N N 230 LYS CA C N S 231 LYS C C N N 232 LYS O O N N 233 LYS CB C N N 234 LYS CG C N N 235 LYS CD C N N 236 LYS CE C N N 237 LYS NZ N N N 238 LYS OXT O N N 239 LYS H H N N 240 LYS H2 H N N 241 LYS HA H N N 242 LYS HB2 H N N 243 LYS HB3 H N N 244 LYS HG2 H N N 245 LYS HG3 H N N 246 LYS HD2 H N N 247 LYS HD3 H N N 248 LYS HE2 H N N 249 LYS HE3 H N N 250 LYS HZ1 H N N 251 LYS HZ2 H N N 252 LYS HZ3 H N N 253 LYS HXT H N N 254 MET N N N N 255 MET CA C N S 256 MET C C N N 257 MET O O N N 258 MET CB C N N 259 MET CG C N N 260 MET SD S N N 261 MET CE C N N 262 MET OXT O N N 263 MET H H N N 264 MET H2 H N N 265 MET HA H N N 266 MET HB2 H N N 267 MET HB3 H N N 268 MET HG2 H N N 269 MET HG3 H N N 270 MET HE1 H N N 271 MET HE2 H N N 272 MET HE3 H N N 273 MET HXT H N N 274 PHE N N N N 275 PHE CA C N S 276 PHE C C N N 277 PHE O O N N 278 PHE CB C N N 279 PHE CG C Y N 280 PHE CD1 C Y N 281 PHE CD2 C Y N 282 PHE CE1 C Y N 283 PHE CE2 C Y N 284 PHE CZ C Y N 285 PHE OXT O N N 286 PHE H H N N 287 PHE H2 H N N 288 PHE HA H N N 289 PHE HB2 H N N 290 PHE HB3 H N N 291 PHE HD1 H N N 292 PHE HD2 H N N 293 PHE HE1 H N N 294 PHE HE2 H N N 295 PHE HZ H N N 296 PHE HXT H N N 297 PRO N N N N 298 PRO CA C N S 299 PRO C C N N 300 PRO O O N N 301 PRO CB C N N 302 PRO CG C N N 303 PRO CD C N N 304 PRO OXT O N N 305 PRO H H N N 306 PRO HA H N N 307 PRO HB2 H N N 308 PRO HB3 H N N 309 PRO HG2 H N N 310 PRO HG3 H N N 311 PRO HD2 H N N 312 PRO HD3 H N N 313 PRO HXT H N N 314 SER N N N N 315 SER CA C N S 316 SER C C N N 317 SER O O N N 318 SER CB C N N 319 SER OG O N N 320 SER OXT O N N 321 SER H H N N 322 SER H2 H N N 323 SER HA H N N 324 SER HB2 H N N 325 SER HB3 H N N 326 SER HG H N N 327 SER HXT H N N 328 THR N N N N 329 THR CA C N S 330 THR C C N N 331 THR O O N N 332 THR CB C N R 333 THR OG1 O N N 334 THR CG2 C N N 335 THR OXT O N N 336 THR H H N N 337 THR H2 H N N 338 THR HA H N N 339 THR HB H N N 340 THR HG1 H N N 341 THR HG21 H N N 342 THR HG22 H N N 343 THR HG23 H N N 344 THR HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 9FH C15 C08 sing N N 1 9FH O14 C12 doub N N 2 9FH C03 C04 doub Y N 3 9FH C03 C02 sing Y N 4 9FH C04 C05 sing Y N 5 9FH C02 C01 doub Y N 6 9FH C08 C09 doub Y N 7 9FH C08 N07 sing Y N 8 9FH C12 C09 sing N N 9 9FH C12 O13 sing N N 10 9FH C05 N07 sing N N 11 9FH C05 C06 doub Y N 12 9FH C09 C10 sing Y N 13 9FH C01 C06 sing Y N 14 9FH N07 N11 sing Y N 15 9FH N11 C10 doub Y N 16 9FH C10 H1 sing N N 17 9FH C15 H2 sing N N 18 9FH C15 H3 sing N N 19 9FH C15 H4 sing N N 20 9FH C01 H5 sing N N 21 9FH C02 H6 sing N N 22 9FH C03 H7 sing N N 23 9FH C04 H8 sing N N 24 9FH C06 H9 sing N N 25 9FH O13 H10 sing N N 26 ALA N CA sing N N 27 ALA N H sing N N 28 ALA N H2 sing N N 29 ALA CA C sing N N 30 ALA CA CB sing N N 31 ALA CA HA sing N N 32 ALA C O doub N N 33 ALA C OXT sing N N 34 ALA CB HB1 sing N N 35 ALA CB HB2 sing N N 36 ALA CB HB3 sing N N 37 ALA OXT HXT sing N N 38 ARG N CA sing N N 39 ARG N H sing N N 40 ARG N H2 sing N N 41 ARG CA C sing N N 42 ARG CA CB sing N N 43 ARG CA HA sing N N 44 ARG C O doub N N 45 ARG C OXT sing N N 46 ARG CB CG sing N N 47 ARG CB HB2 sing N N 48 ARG CB HB3 sing N N 49 ARG CG CD sing N N 50 ARG CG HG2 sing N N 51 ARG CG HG3 sing N N 52 ARG CD NE sing N N 53 ARG CD HD2 sing N N 54 ARG CD HD3 sing N N 55 ARG NE CZ sing N N 56 ARG NE HE sing N N 57 ARG CZ NH1 sing N N 58 ARG CZ NH2 doub N N 59 ARG NH1 HH11 sing N N 60 ARG NH1 HH12 sing N N 61 ARG NH2 HH21 sing N N 62 ARG NH2 HH22 sing N N 63 ARG OXT HXT sing N N 64 ASN N CA sing N N 65 ASN N H sing N N 66 ASN N H2 sing N N 67 ASN CA C sing N N 68 ASN CA CB sing N N 69 ASN CA HA sing N N 70 ASN C O doub N N 71 ASN C OXT sing N N 72 ASN CB CG sing N N 73 ASN CB HB2 sing N N 74 ASN CB HB3 sing N N 75 ASN CG OD1 doub N N 76 ASN CG ND2 sing N N 77 ASN ND2 HD21 sing N N 78 ASN ND2 HD22 sing N N 79 ASN OXT HXT sing N N 80 ASP N CA sing N N 81 ASP N H sing N N 82 ASP N H2 sing N N 83 ASP CA C sing N N 84 ASP CA CB sing N N 85 ASP CA HA sing N N 86 ASP C O doub N N 87 ASP C OXT sing N N 88 ASP CB CG sing N N 89 ASP CB HB2 sing N N 90 ASP CB HB3 sing N N 91 ASP CG OD1 doub N N 92 ASP CG OD2 sing N N 93 ASP OD2 HD2 sing N N 94 ASP OXT HXT sing N N 95 CYS N CA sing N N 96 CYS N H sing N N 97 CYS N H2 sing N N 98 CYS CA C sing N N 99 CYS CA CB sing N N 100 CYS CA HA sing N N 101 CYS C O doub N N 102 CYS C OXT sing N N 103 CYS CB SG sing N N 104 CYS CB HB2 sing N N 105 CYS CB HB3 sing N N 106 CYS SG HG sing N N 107 CYS OXT HXT sing N N 108 GLN N CA sing N N 109 GLN N H sing N N 110 GLN N H2 sing N N 111 GLN CA C sing N N 112 GLN CA CB sing N N 113 GLN CA HA sing N N 114 GLN C O doub N N 115 GLN C OXT sing N N 116 GLN CB CG sing N N 117 GLN CB HB2 sing N N 118 GLN CB HB3 sing N N 119 GLN CG CD sing N N 120 GLN CG HG2 sing N N 121 GLN CG HG3 sing N N 122 GLN CD OE1 doub N N 123 GLN CD NE2 sing N N 124 GLN NE2 HE21 sing N N 125 GLN NE2 HE22 sing N N 126 GLN OXT HXT sing N N 127 GLU N CA sing N N 128 GLU N H sing N N 129 GLU N H2 sing N N 130 GLU CA C sing N N 131 GLU CA CB sing N N 132 GLU CA HA sing N N 133 GLU C O doub N N 134 GLU C OXT sing N N 135 GLU CB CG sing N N 136 GLU CB HB2 sing N N 137 GLU CB HB3 sing N N 138 GLU CG CD sing N N 139 GLU CG HG2 sing N N 140 GLU CG HG3 sing N N 141 GLU CD OE1 doub N N 142 GLU CD OE2 sing N N 143 GLU OE2 HE2 sing N N 144 GLU OXT HXT sing N N 145 GLY N CA sing N N 146 GLY N H sing N N 147 GLY N H2 sing N N 148 GLY CA C sing N N 149 GLY CA HA2 sing N N 150 GLY CA HA3 sing N N 151 GLY C O doub N N 152 GLY C OXT sing N N 153 GLY OXT HXT sing N N 154 HIS N CA sing N N 155 HIS N H sing N N 156 HIS N H2 sing N N 157 HIS CA C sing N N 158 HIS CA CB sing N N 159 HIS CA HA sing N N 160 HIS C O doub N N 161 HIS C OXT sing N N 162 HIS CB CG sing N N 163 HIS CB HB2 sing N N 164 HIS CB HB3 sing N N 165 HIS CG ND1 sing Y N 166 HIS CG CD2 doub Y N 167 HIS ND1 CE1 doub Y N 168 HIS ND1 HD1 sing N N 169 HIS CD2 NE2 sing Y N 170 HIS CD2 HD2 sing N N 171 HIS CE1 NE2 sing Y N 172 HIS CE1 HE1 sing N N 173 HIS NE2 HE2 sing N N 174 HIS OXT HXT sing N N 175 HOH O H1 sing N N 176 HOH O H2 sing N N 177 ILE N CA sing N N 178 ILE N H sing N N 179 ILE N H2 sing N N 180 ILE CA C sing N N 181 ILE CA CB sing N N 182 ILE CA HA sing N N 183 ILE C O doub N N 184 ILE C OXT sing N N 185 ILE CB CG1 sing N N 186 ILE CB CG2 sing N N 187 ILE CB HB sing N N 188 ILE CG1 CD1 sing N N 189 ILE CG1 HG12 sing N N 190 ILE CG1 HG13 sing N N 191 ILE CG2 HG21 sing N N 192 ILE CG2 HG22 sing N N 193 ILE CG2 HG23 sing N N 194 ILE CD1 HD11 sing N N 195 ILE CD1 HD12 sing N N 196 ILE CD1 HD13 sing N N 197 ILE OXT HXT sing N N 198 LEU N CA sing N N 199 LEU N H sing N N 200 LEU N H2 sing N N 201 LEU CA C sing N N 202 LEU CA CB sing N N 203 LEU CA HA sing N N 204 LEU C O doub N N 205 LEU C OXT sing N N 206 LEU CB CG sing N N 207 LEU CB HB2 sing N N 208 LEU CB HB3 sing N N 209 LEU CG CD1 sing N N 210 LEU CG CD2 sing N N 211 LEU CG HG sing N N 212 LEU CD1 HD11 sing N N 213 LEU CD1 HD12 sing N N 214 LEU CD1 HD13 sing N N 215 LEU CD2 HD21 sing N N 216 LEU CD2 HD22 sing N N 217 LEU CD2 HD23 sing N N 218 LEU OXT HXT sing N N 219 LYS N CA sing N N 220 LYS N H sing N N 221 LYS N H2 sing N N 222 LYS CA C sing N N 223 LYS CA CB sing N N 224 LYS CA HA sing N N 225 LYS C O doub N N 226 LYS C OXT sing N N 227 LYS CB CG sing N N 228 LYS CB HB2 sing N N 229 LYS CB HB3 sing N N 230 LYS CG CD sing N N 231 LYS CG HG2 sing N N 232 LYS CG HG3 sing N N 233 LYS CD CE sing N N 234 LYS CD HD2 sing N N 235 LYS CD HD3 sing N N 236 LYS CE NZ sing N N 237 LYS CE HE2 sing N N 238 LYS CE HE3 sing N N 239 LYS NZ HZ1 sing N N 240 LYS NZ HZ2 sing N N 241 LYS NZ HZ3 sing N N 242 LYS OXT HXT sing N N 243 MET N CA sing N N 244 MET N H sing N N 245 MET N H2 sing N N 246 MET CA C sing N N 247 MET CA CB sing N N 248 MET CA HA sing N N 249 MET C O doub N N 250 MET C OXT sing N N 251 MET CB CG sing N N 252 MET CB HB2 sing N N 253 MET CB HB3 sing N N 254 MET CG SD sing N N 255 MET CG HG2 sing N N 256 MET CG HG3 sing N N 257 MET SD CE sing N N 258 MET CE HE1 sing N N 259 MET CE HE2 sing N N 260 MET CE HE3 sing N N 261 MET OXT HXT sing N N 262 PHE N CA sing N N 263 PHE N H sing N N 264 PHE N H2 sing N N 265 PHE CA C sing N N 266 PHE CA CB sing N N 267 PHE CA HA sing N N 268 PHE C O doub N N 269 PHE C OXT sing N N 270 PHE CB CG sing N N 271 PHE CB HB2 sing N N 272 PHE CB HB3 sing N N 273 PHE CG CD1 doub Y N 274 PHE CG CD2 sing Y N 275 PHE CD1 CE1 sing Y N 276 PHE CD1 HD1 sing N N 277 PHE CD2 CE2 doub Y N 278 PHE CD2 HD2 sing N N 279 PHE CE1 CZ doub Y N 280 PHE CE1 HE1 sing N N 281 PHE CE2 CZ sing Y N 282 PHE CE2 HE2 sing N N 283 PHE CZ HZ sing N N 284 PHE OXT HXT sing N N 285 PRO N CA sing N N 286 PRO N CD sing N N 287 PRO N H sing N N 288 PRO CA C sing N N 289 PRO CA CB sing N N 290 PRO CA HA sing N N 291 PRO C O doub N N 292 PRO C OXT sing N N 293 PRO CB CG sing N N 294 PRO CB HB2 sing N N 295 PRO CB HB3 sing N N 296 PRO CG CD sing N N 297 PRO CG HG2 sing N N 298 PRO CG HG3 sing N N 299 PRO CD HD2 sing N N 300 PRO CD HD3 sing N N 301 PRO OXT HXT sing N N 302 SER N CA sing N N 303 SER N H sing N N 304 SER N H2 sing N N 305 SER CA C sing N N 306 SER CA CB sing N N 307 SER CA HA sing N N 308 SER C O doub N N 309 SER C OXT sing N N 310 SER CB OG sing N N 311 SER CB HB2 sing N N 312 SER CB HB3 sing N N 313 SER OG HG sing N N 314 SER OXT HXT sing N N 315 THR N CA sing N N 316 THR N H sing N N 317 THR N H2 sing N N 318 THR CA C sing N N 319 THR CA CB sing N N 320 THR CA HA sing N N 321 THR C O doub N N 322 THR C OXT sing N N 323 THR CB OG1 sing N N 324 THR CB CG2 sing N N 325 THR CB HB sing N N 326 THR OG1 HG1 sing N N 327 THR CG2 HG21 sing N N 328 THR CG2 HG22 sing N N 329 THR CG2 HG23 sing N N 330 THR OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Bill & Melinda Gates Foundation' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1TFU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6QMI _atom_sites.fract_transf_matrix[1][1] 0.010205 _atom_sites.fract_transf_matrix[1][2] 0.005892 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011783 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008775 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_