data_6QQB # _entry.id 6QQB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6QQB WWPDB D_1292100072 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6QQB _pdbx_database_status.recvd_initial_deposition_date 2019-02-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gotthard, G.' 1 0000-0003-2830-0286 'Aumonier, S.' 2 0000-0002-1568-2150 'Royant, A.' 3 0000-0002-1919-8649 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Iucrj _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2052-2525 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 665 _citation.page_last 680 _citation.title 'Specific radiation damage is a lesser concern at room temperature.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S205225251900616X _citation.pdbx_database_id_PubMed 31316810 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gotthard, G.' 1 ? primary 'Aumonier, S.' 2 ? primary 'De Sanctis, D.' 3 ? primary 'Leonard, G.' 4 ? primary 'von Stetten, D.' 5 ? primary 'Royant, A.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6QQB _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.040 _cell.length_a_esd ? _cell.length_b 62.670 _cell.length_b_esd ? _cell.length_c 71.560 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6QQB _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Green fluorescent protein' 26789.236 1 ? ? ? ? 2 water nat water 18.015 80 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL(CRF)VQCFARYPDH MKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQ KNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELY K ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMK QHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 LYS n 1 5 GLY n 1 6 GLU n 1 7 GLU n 1 8 LEU n 1 9 PHE n 1 10 THR n 1 11 GLY n 1 12 VAL n 1 13 VAL n 1 14 PRO n 1 15 ILE n 1 16 LEU n 1 17 VAL n 1 18 GLU n 1 19 LEU n 1 20 ASP n 1 21 GLY n 1 22 ASP n 1 23 VAL n 1 24 ASN n 1 25 GLY n 1 26 HIS n 1 27 LYS n 1 28 PHE n 1 29 SER n 1 30 VAL n 1 31 SER n 1 32 GLY n 1 33 GLU n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 ASP n 1 38 ALA n 1 39 THR n 1 40 TYR n 1 41 GLY n 1 42 LYS n 1 43 LEU n 1 44 THR n 1 45 LEU n 1 46 LYS n 1 47 PHE n 1 48 ILE n 1 49 CYS n 1 50 THR n 1 51 THR n 1 52 GLY n 1 53 LYS n 1 54 LEU n 1 55 PRO n 1 56 VAL n 1 57 PRO n 1 58 TRP n 1 59 PRO n 1 60 THR n 1 61 LEU n 1 62 VAL n 1 63 THR n 1 64 THR n 1 65 LEU n 1 66 CRF n 1 67 VAL n 1 68 GLN n 1 69 CYS n 1 70 PHE n 1 71 ALA n 1 72 ARG n 1 73 TYR n 1 74 PRO n 1 75 ASP n 1 76 HIS n 1 77 MET n 1 78 LYS n 1 79 GLN n 1 80 HIS n 1 81 ASP n 1 82 PHE n 1 83 PHE n 1 84 LYS n 1 85 SER n 1 86 ALA n 1 87 MET n 1 88 PRO n 1 89 GLU n 1 90 GLY n 1 91 TYR n 1 92 VAL n 1 93 GLN n 1 94 GLU n 1 95 ARG n 1 96 THR n 1 97 ILE n 1 98 PHE n 1 99 PHE n 1 100 LYS n 1 101 ASP n 1 102 ASP n 1 103 GLY n 1 104 ASN n 1 105 TYR n 1 106 LYS n 1 107 THR n 1 108 ARG n 1 109 ALA n 1 110 GLU n 1 111 VAL n 1 112 LYS n 1 113 PHE n 1 114 GLU n 1 115 GLY n 1 116 ASP n 1 117 THR n 1 118 LEU n 1 119 VAL n 1 120 ASN n 1 121 ARG n 1 122 ILE n 1 123 GLU n 1 124 LEU n 1 125 LYS n 1 126 GLY n 1 127 ILE n 1 128 ASP n 1 129 PHE n 1 130 LYS n 1 131 GLU n 1 132 ASP n 1 133 GLY n 1 134 ASN n 1 135 ILE n 1 136 LEU n 1 137 GLY n 1 138 HIS n 1 139 LYS n 1 140 LEU n 1 141 GLU n 1 142 TYR n 1 143 ASN n 1 144 ALA n 1 145 ILE n 1 146 SER n 1 147 ASP n 1 148 ASN n 1 149 VAL n 1 150 TYR n 1 151 ILE n 1 152 THR n 1 153 ALA n 1 154 ASP n 1 155 LYS n 1 156 GLN n 1 157 LYS n 1 158 ASN n 1 159 GLY n 1 160 ILE n 1 161 LYS n 1 162 ALA n 1 163 ASN n 1 164 PHE n 1 165 LYS n 1 166 ILE n 1 167 ARG n 1 168 HIS n 1 169 ASN n 1 170 ILE n 1 171 GLU n 1 172 ASP n 1 173 GLY n 1 174 SER n 1 175 VAL n 1 176 GLN n 1 177 LEU n 1 178 ALA n 1 179 ASP n 1 180 HIS n 1 181 TYR n 1 182 GLN n 1 183 GLN n 1 184 ASN n 1 185 THR n 1 186 PRO n 1 187 ILE n 1 188 GLY n 1 189 ASP n 1 190 GLY n 1 191 PRO n 1 192 VAL n 1 193 LEU n 1 194 LEU n 1 195 PRO n 1 196 ASP n 1 197 ASN n 1 198 HIS n 1 199 TYR n 1 200 LEU n 1 201 SER n 1 202 THR n 1 203 GLN n 1 204 SER n 1 205 ALA n 1 206 LEU n 1 207 SER n 1 208 LYS n 1 209 ASP n 1 210 PRO n 1 211 ASN n 1 212 GLU n 1 213 LYS n 1 214 ARG n 1 215 ASP n 1 216 HIS n 1 217 MET n 1 218 VAL n 1 219 LEU n 1 220 LEU n 1 221 GLU n 1 222 PHE n 1 223 VAL n 1 224 THR n 1 225 ALA n 1 226 ALA n 1 227 GLY n 1 228 ILE n 1 229 THR n 1 230 LEU n 1 231 GLY n 1 232 MET n 1 233 ASP n 1 234 GLU n 1 235 LEU n 1 236 TYR n 1 237 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 237 _entity_src_gen.gene_src_common_name Jellyfish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GFP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFP_AEQVI _struct_ref.pdbx_db_accession P42212 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6QQB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 237 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6QQB VAL A 2 ? UNP P42212 ? ? insertion 1 1 1 6QQB LEU A 65 ? UNP P42212 PHE 64 conflict 64 2 1 6QQB CRF A 66 ? UNP P42212 SER 65 chromophore 66 3 1 6QQB CRF A 66 ? UNP P42212 TYR 66 chromophore 66 4 1 6QQB CRF A 66 ? UNP P42212 GLY 67 chromophore 66 5 1 6QQB ALA A 71 ? UNP P42212 SER 72 conflict 72 6 1 6QQB ALA A 144 ? UNP P42212 TYR 145 conflict 145 7 1 6QQB ILE A 145 ? UNP P42212 ASN 146 conflict 146 8 1 6QQB ASP A 147 ? UNP P42212 HIS 148 conflict 148 9 1 6QQB THR A 152 ? UNP P42212 MET 153 conflict 153 10 1 6QQB ALA A 162 ? UNP P42212 VAL 163 conflict 163 11 1 6QQB LEU A 230 ? UNP P42212 HIS 231 conflict 231 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CRF 'L-peptide linking' n '[(4Z)-2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(1H-indol-3-ylmethylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl]acetic acid' ? 'C17 H18 N4 O4' 342.349 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6QQB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '15% PEG 8000, 0.1M MGCL2, 0.1 M HEPES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(311)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6QQB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.45 _reflns.d_resolution_low 47.15 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9048 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.90 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.51 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.08 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 670 _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.749 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -3.19 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -3.39 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 6.58 _refine.B_iso_max ? _refine.B_iso_mean 55.258 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.915 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6QQB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.45 _refine.ls_d_res_low 47.15 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8612 _refine.ls_number_reflns_R_free 436 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18192 _refine.ls_R_factor_R_free 0.26592 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17739 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.971 _refine.pdbx_overall_ESU_R_Free 0.323 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.682 _refine.overall_SU_ML 0.311 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1805 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 1885 _refine_hist.d_res_high 2.45 _refine_hist.d_res_low 47.15 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.019 2033 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1868 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.570 1.990 2797 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.757 3.001 4359 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.213 5.000 277 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.018 25.625 96 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.599 15.000 353 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.424 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.076 0.200 317 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2301 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 394 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 33.715 4.854 983 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 32.841 4.869 982 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 28.960 7.230 1238 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 29.802 7.241 1239 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 91.384 5.808 1050 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 91.341 5.813 1051 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 57.712 8.073 1538 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 55.250 54.451 2100 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 55.359 54.411 2092 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.450 _refine_ls_shell.d_res_low 2.513 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 22 _refine_ls_shell.number_reflns_R_work 643 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.401 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.344 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6QQB _struct.title 'Room temperature structure of the fluorescent protein Cerulean recorded after an accumulated dose of 147 kGy' _struct.pdbx_descriptor 'Green fluorescent protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6QQB _struct_keywords.text 'Fluorescent protein, tryptophan-based chromophore, Cerulean, hydrogen atoms, room temperature' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 4 ? THR A 10 ? LYS A 3 THR A 9 5 ? 7 HELX_P HELX_P2 AA2 PRO A 57 ? LEU A 61 ? PRO A 56 LEU A 60 5 ? 5 HELX_P HELX_P3 AA3 VAL A 67 ? ALA A 71 ? VAL A 68 ALA A 72 5 ? 5 HELX_P HELX_P4 AA4 PRO A 74 ? HIS A 80 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P5 AA5 ASP A 81 ? ALA A 86 ? ASP A 82 ALA A 87 1 ? 6 HELX_P HELX_P6 AA6 LYS A 155 ? ASN A 158 ? LYS A 156 ASN A 159 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A LEU 65 C ? ? ? 1_555 A CRF 66 N1 ? ? A LEU 64 A CRF 66 1_555 ? ? ? ? ? ? ? 1.318 ? covale2 covale both ? A CRF 66 C3 ? ? ? 1_555 A VAL 67 N ? ? A CRF 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.339 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 87 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 88 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.74 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 12 ? VAL A 23 ? VAL A 11 VAL A 22 AA1 2 HIS A 26 ? ASP A 37 ? HIS A 25 ASP A 36 AA1 3 LYS A 42 ? CYS A 49 ? LYS A 41 CYS A 48 AA1 4 HIS A 216 ? ALA A 226 ? HIS A 217 ALA A 227 AA1 5 HIS A 198 ? SER A 207 ? HIS A 199 SER A 208 AA1 6 ILE A 145 ? ASP A 154 ? ILE A 146 ASP A 155 AA1 7 GLY A 159 ? ASN A 169 ? GLY A 160 ASN A 170 AA1 8 VAL A 175 ? PRO A 186 ? VAL A 176 PRO A 187 AA1 9 TYR A 91 ? PHE A 99 ? TYR A 92 PHE A 100 AA1 10 ASN A 104 ? GLU A 114 ? ASN A 105 GLU A 115 AA1 11 THR A 117 ? ILE A 127 ? THR A 118 ILE A 128 AA1 12 VAL A 12 ? VAL A 23 ? VAL A 11 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 15 ? N ILE A 14 O GLY A 34 ? O GLY A 33 AA1 2 3 N ASP A 37 ? N ASP A 36 O LYS A 42 ? O LYS A 41 AA1 3 4 N PHE A 47 ? N PHE A 46 O MET A 217 ? O MET A 218 AA1 4 5 O PHE A 222 ? O PHE A 223 N GLN A 203 ? N GLN A 204 AA1 5 6 O HIS A 198 ? O HIS A 199 N ILE A 151 ? N ILE A 152 AA1 6 7 N ASP A 154 ? N ASP A 155 O GLY A 159 ? O GLY A 160 AA1 7 8 N PHE A 164 ? N PHE A 165 O HIS A 180 ? O HIS A 181 AA1 8 9 O THR A 185 ? O THR A 186 N VAL A 92 ? N VAL A 93 AA1 9 10 N ILE A 97 ? N ILE A 98 O TYR A 105 ? O TYR A 106 AA1 10 11 N LYS A 112 ? N LYS A 113 O VAL A 119 ? O VAL A 120 AA1 11 12 O ILE A 122 ? O ILE A 123 N ASP A 20 ? N ASP A 19 # _atom_sites.entry_id 6QQB _atom_sites.fract_transf_matrix[1][1] 0.019216 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015957 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013974 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 GLY 5 4 4 GLY GLY A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 THR 10 9 9 THR THR A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 VAL 13 12 12 VAL VAL A . n A 1 14 PRO 14 13 13 PRO PRO A . n A 1 15 ILE 15 14 14 ILE ILE A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 ASP 20 19 19 ASP ASP A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 ASN 24 23 23 ASN ASN A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 ASP 37 36 36 ASP ASP A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 THR 39 38 38 THR THR A . n A 1 40 TYR 40 39 39 TYR TYR A . n A 1 41 GLY 41 40 40 GLY GLY A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 THR 44 43 43 THR THR A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 LYS 46 45 45 LYS LYS A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 CYS 49 48 48 CYS CYS A . n A 1 50 THR 50 49 49 THR THR A . n A 1 51 THR 51 50 50 THR THR A . n A 1 52 GLY 52 51 51 GLY GLY A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 PRO 55 54 54 PRO PRO A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 PRO 57 56 56 PRO PRO A . n A 1 58 TRP 58 57 57 TRP TRP A . n A 1 59 PRO 59 58 58 PRO PRO A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 THR 63 62 62 THR THR A . n A 1 64 THR 64 63 63 THR THR A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 CRF 66 66 66 CRF CRC A . n A 1 67 VAL 67 68 68 VAL VAL A . n A 1 68 GLN 68 69 69 GLN GLN A . n A 1 69 CYS 69 70 70 CYS CYS A . n A 1 70 PHE 70 71 71 PHE PHE A . n A 1 71 ALA 71 72 72 ALA ALA A . n A 1 72 ARG 72 73 73 ARG ARG A . n A 1 73 TYR 73 74 74 TYR TYR A . n A 1 74 PRO 74 75 75 PRO PRO A . n A 1 75 ASP 75 76 76 ASP ASP A . n A 1 76 HIS 76 77 77 HIS HIS A . n A 1 77 MET 77 78 78 MET MET A . n A 1 78 LYS 78 79 79 LYS LYS A . n A 1 79 GLN 79 80 80 GLN GLN A . n A 1 80 HIS 80 81 81 HIS HIS A . n A 1 81 ASP 81 82 82 ASP ASP A . n A 1 82 PHE 82 83 83 PHE PHE A . n A 1 83 PHE 83 84 84 PHE PHE A . n A 1 84 LYS 84 85 85 LYS LYS A . n A 1 85 SER 85 86 86 SER SER A . n A 1 86 ALA 86 87 87 ALA ALA A . n A 1 87 MET 87 88 88 MET MET A . n A 1 88 PRO 88 89 89 PRO PRO A . n A 1 89 GLU 89 90 90 GLU GLU A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 TYR 91 92 92 TYR TYR A . n A 1 92 VAL 92 93 93 VAL VAL A . n A 1 93 GLN 93 94 94 GLN GLN A . n A 1 94 GLU 94 95 95 GLU GLU A . n A 1 95 ARG 95 96 96 ARG ARG A . n A 1 96 THR 96 97 97 THR THR A . n A 1 97 ILE 97 98 98 ILE ILE A . n A 1 98 PHE 98 99 99 PHE PHE A . n A 1 99 PHE 99 100 100 PHE PHE A . n A 1 100 LYS 100 101 101 LYS LYS A . n A 1 101 ASP 101 102 102 ASP ASP A . n A 1 102 ASP 102 103 103 ASP ASP A . n A 1 103 GLY 103 104 104 GLY GLY A . n A 1 104 ASN 104 105 105 ASN ASN A . n A 1 105 TYR 105 106 106 TYR TYR A . n A 1 106 LYS 106 107 107 LYS LYS A . n A 1 107 THR 107 108 108 THR THR A . n A 1 108 ARG 108 109 109 ARG ARG A . n A 1 109 ALA 109 110 110 ALA ALA A . n A 1 110 GLU 110 111 111 GLU GLU A . n A 1 111 VAL 111 112 112 VAL VAL A . n A 1 112 LYS 112 113 113 LYS LYS A . n A 1 113 PHE 113 114 114 PHE PHE A . n A 1 114 GLU 114 115 115 GLU GLU A . n A 1 115 GLY 115 116 116 GLY GLY A . n A 1 116 ASP 116 117 117 ASP ASP A . n A 1 117 THR 117 118 118 THR THR A . n A 1 118 LEU 118 119 119 LEU LEU A . n A 1 119 VAL 119 120 120 VAL VAL A . n A 1 120 ASN 120 121 121 ASN ASN A . n A 1 121 ARG 121 122 122 ARG ARG A . n A 1 122 ILE 122 123 123 ILE ILE A . n A 1 123 GLU 123 124 124 GLU GLU A . n A 1 124 LEU 124 125 125 LEU LEU A . n A 1 125 LYS 125 126 126 LYS LYS A . n A 1 126 GLY 126 127 127 GLY GLY A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 ASP 128 129 129 ASP ASP A . n A 1 129 PHE 129 130 130 PHE PHE A . n A 1 130 LYS 130 131 131 LYS LYS A . n A 1 131 GLU 131 132 132 GLU GLU A . n A 1 132 ASP 132 133 133 ASP ASP A . n A 1 133 GLY 133 134 134 GLY GLY A . n A 1 134 ASN 134 135 135 ASN ASN A . n A 1 135 ILE 135 136 136 ILE ILE A . n A 1 136 LEU 136 137 137 LEU LEU A . n A 1 137 GLY 137 138 138 GLY GLY A . n A 1 138 HIS 138 139 139 HIS HIS A . n A 1 139 LYS 139 140 140 LYS LYS A . n A 1 140 LEU 140 141 141 LEU LEU A . n A 1 141 GLU 141 142 142 GLU GLU A . n A 1 142 TYR 142 143 143 TYR TYR A . n A 1 143 ASN 143 144 144 ASN ASN A . n A 1 144 ALA 144 145 145 ALA ALA A . n A 1 145 ILE 145 146 146 ILE ILE A . n A 1 146 SER 146 147 147 SER SER A . n A 1 147 ASP 147 148 148 ASP ASP A . n A 1 148 ASN 148 149 149 ASN ASN A . n A 1 149 VAL 149 150 150 VAL VAL A . n A 1 150 TYR 150 151 151 TYR TYR A . n A 1 151 ILE 151 152 152 ILE ILE A . n A 1 152 THR 152 153 153 THR THR A . n A 1 153 ALA 153 154 154 ALA ALA A . n A 1 154 ASP 154 155 155 ASP ASP A . n A 1 155 LYS 155 156 156 LYS LYS A . n A 1 156 GLN 156 157 157 GLN GLN A . n A 1 157 LYS 157 158 158 LYS LYS A . n A 1 158 ASN 158 159 159 ASN ASN A . n A 1 159 GLY 159 160 160 GLY GLY A . n A 1 160 ILE 160 161 161 ILE ILE A . n A 1 161 LYS 161 162 162 LYS LYS A . n A 1 162 ALA 162 163 163 ALA ALA A . n A 1 163 ASN 163 164 164 ASN ASN A . n A 1 164 PHE 164 165 165 PHE PHE A . n A 1 165 LYS 165 166 166 LYS LYS A . n A 1 166 ILE 166 167 167 ILE ILE A . n A 1 167 ARG 167 168 168 ARG ARG A . n A 1 168 HIS 168 169 169 HIS HIS A . n A 1 169 ASN 169 170 170 ASN ASN A . n A 1 170 ILE 170 171 171 ILE ILE A . n A 1 171 GLU 171 172 172 GLU GLU A . n A 1 172 ASP 172 173 173 ASP ASP A . n A 1 173 GLY 173 174 174 GLY GLY A . n A 1 174 SER 174 175 175 SER SER A . n A 1 175 VAL 175 176 176 VAL VAL A . n A 1 176 GLN 176 177 177 GLN GLN A . n A 1 177 LEU 177 178 178 LEU LEU A . n A 1 178 ALA 178 179 179 ALA ALA A . n A 1 179 ASP 179 180 180 ASP ASP A . n A 1 180 HIS 180 181 181 HIS HIS A . n A 1 181 TYR 181 182 182 TYR TYR A . n A 1 182 GLN 182 183 183 GLN GLN A . n A 1 183 GLN 183 184 184 GLN GLN A . n A 1 184 ASN 184 185 185 ASN ASN A . n A 1 185 THR 185 186 186 THR THR A . n A 1 186 PRO 186 187 187 PRO PRO A . n A 1 187 ILE 187 188 188 ILE ILE A . n A 1 188 GLY 188 189 189 GLY GLY A . n A 1 189 ASP 189 190 190 ASP ASP A . n A 1 190 GLY 190 191 191 GLY GLY A . n A 1 191 PRO 191 192 192 PRO PRO A . n A 1 192 VAL 192 193 193 VAL VAL A . n A 1 193 LEU 193 194 194 LEU LEU A . n A 1 194 LEU 194 195 195 LEU LEU A . n A 1 195 PRO 195 196 196 PRO PRO A . n A 1 196 ASP 196 197 197 ASP ASP A . n A 1 197 ASN 197 198 198 ASN ASN A . n A 1 198 HIS 198 199 199 HIS HIS A . n A 1 199 TYR 199 200 200 TYR TYR A . n A 1 200 LEU 200 201 201 LEU LEU A . n A 1 201 SER 201 202 202 SER SER A . n A 1 202 THR 202 203 203 THR THR A . n A 1 203 GLN 203 204 204 GLN GLN A . n A 1 204 SER 204 205 205 SER SER A . n A 1 205 ALA 205 206 206 ALA ALA A . n A 1 206 LEU 206 207 207 LEU LEU A . n A 1 207 SER 207 208 208 SER SER A . n A 1 208 LYS 208 209 209 LYS LYS A . n A 1 209 ASP 209 210 210 ASP ASP A . n A 1 210 PRO 210 211 211 PRO PRO A . n A 1 211 ASN 211 212 212 ASN ASN A . n A 1 212 GLU 212 213 213 GLU GLU A . n A 1 213 LYS 213 214 214 LYS LYS A . n A 1 214 ARG 214 215 215 ARG ARG A . n A 1 215 ASP 215 216 216 ASP ASP A . n A 1 216 HIS 216 217 217 HIS HIS A . n A 1 217 MET 217 218 218 MET MET A . n A 1 218 VAL 218 219 219 VAL VAL A . n A 1 219 LEU 219 220 220 LEU LEU A . n A 1 220 LEU 220 221 221 LEU LEU A . n A 1 221 GLU 221 222 222 GLU GLU A . n A 1 222 PHE 222 223 223 PHE PHE A . n A 1 223 VAL 223 224 224 VAL VAL A . n A 1 224 THR 224 225 225 THR THR A . n A 1 225 ALA 225 226 226 ALA ALA A . n A 1 226 ALA 226 227 227 ALA ALA A . n A 1 227 GLY 227 228 228 GLY GLY A . n A 1 228 ILE 228 229 229 ILE ILE A . n A 1 229 THR 229 230 230 THR THR A . n A 1 230 LEU 230 231 231 LEU LEU A . n A 1 231 GLY 231 232 ? ? ? A . n A 1 232 MET 232 233 ? ? ? A . n A 1 233 ASP 233 234 ? ? ? A . n A 1 234 GLU 234 235 ? ? ? A . n A 1 235 LEU 235 236 ? ? ? A . n A 1 236 TYR 236 237 ? ? ? A . n A 1 237 LYS 237 238 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 46 HOH HOH A . B 2 HOH 2 302 66 HOH HOH A . B 2 HOH 3 303 29 HOH HOH A . B 2 HOH 4 304 51 HOH HOH A . B 2 HOH 5 305 65 HOH HOH A . B 2 HOH 6 306 30 HOH HOH A . B 2 HOH 7 307 22 HOH HOH A . B 2 HOH 8 308 3 HOH HOH A . B 2 HOH 9 309 38 HOH HOH A . B 2 HOH 10 310 32 HOH HOH A . B 2 HOH 11 311 76 HOH HOH A . B 2 HOH 12 312 10 HOH HOH A . B 2 HOH 13 313 50 HOH HOH A . B 2 HOH 14 314 12 HOH HOH A . B 2 HOH 15 315 35 HOH HOH A . B 2 HOH 16 316 23 HOH HOH A . B 2 HOH 17 317 21 HOH HOH A . B 2 HOH 18 318 56 HOH HOH A . B 2 HOH 19 319 36 HOH HOH A . B 2 HOH 20 320 37 HOH HOH A . B 2 HOH 21 321 6 HOH HOH A . B 2 HOH 22 322 62 HOH HOH A . B 2 HOH 23 323 58 HOH HOH A . B 2 HOH 24 324 48 HOH HOH A . B 2 HOH 25 325 63 HOH HOH A . B 2 HOH 26 326 19 HOH HOH A . B 2 HOH 27 327 73 HOH HOH A . B 2 HOH 28 328 44 HOH HOH A . B 2 HOH 29 329 31 HOH HOH A . B 2 HOH 30 330 49 HOH HOH A . B 2 HOH 31 331 74 HOH HOH A . B 2 HOH 32 332 26 HOH HOH A . B 2 HOH 33 333 4 HOH HOH A . B 2 HOH 34 334 64 HOH HOH A . B 2 HOH 35 335 24 HOH HOH A . B 2 HOH 36 336 5 HOH HOH A . B 2 HOH 37 337 59 HOH HOH A . B 2 HOH 38 338 78 HOH HOH A . B 2 HOH 39 339 18 HOH HOH A . B 2 HOH 40 340 39 HOH HOH A . B 2 HOH 41 341 33 HOH HOH A . B 2 HOH 42 342 55 HOH HOH A . B 2 HOH 43 343 25 HOH HOH A . B 2 HOH 44 344 72 HOH HOH A . B 2 HOH 45 345 71 HOH HOH A . B 2 HOH 46 346 2 HOH HOH A . B 2 HOH 47 347 45 HOH HOH A . B 2 HOH 48 348 27 HOH HOH A . B 2 HOH 49 349 61 HOH HOH A . B 2 HOH 50 350 14 HOH HOH A . B 2 HOH 51 351 34 HOH HOH A . B 2 HOH 52 352 57 HOH HOH A . B 2 HOH 53 353 47 HOH HOH A . B 2 HOH 54 354 20 HOH HOH A . B 2 HOH 55 355 52 HOH HOH A . B 2 HOH 56 356 68 HOH HOH A . B 2 HOH 57 357 42 HOH HOH A . B 2 HOH 58 358 1 HOH HOH A . B 2 HOH 59 359 54 HOH HOH A . B 2 HOH 60 360 15 HOH HOH A . B 2 HOH 61 361 41 HOH HOH A . B 2 HOH 62 362 53 HOH HOH A . B 2 HOH 63 363 8 HOH HOH A . B 2 HOH 64 364 28 HOH HOH A . B 2 HOH 65 365 9 HOH HOH A . B 2 HOH 66 366 17 HOH HOH A . B 2 HOH 67 367 79 HOH HOH A . B 2 HOH 68 368 69 HOH HOH A . B 2 HOH 69 369 77 HOH HOH A . B 2 HOH 70 370 40 HOH HOH A . B 2 HOH 71 371 70 HOH HOH A . B 2 HOH 72 372 75 HOH HOH A . B 2 HOH 73 373 43 HOH HOH A . B 2 HOH 74 374 67 HOH HOH A . B 2 HOH 75 375 11 HOH HOH A . B 2 HOH 76 376 7 HOH HOH A . B 2 HOH 77 377 60 HOH HOH A . B 2 HOH 78 378 13 HOH HOH A . B 2 HOH 79 379 16 HOH HOH A . B 2 HOH 80 380 80 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CRF _pdbx_struct_mod_residue.label_seq_id 66 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CRF _pdbx_struct_mod_residue.auth_seq_id 66 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details chromophore # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 720 ? 1 MORE -3 ? 1 'SSA (A^2)' 10680 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-06-19 2 'Structure model' 1 1 2019-07-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0218 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 210 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 302 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 136 ? ? -74.69 -72.08 2 1 ILE A 136 ? ? -75.07 -71.72 3 1 ALA A 145 ? A -43.87 160.21 4 1 ASP A 148 ? ? 177.78 -176.87 5 1 ASP A 148 ? ? -172.88 -176.87 6 1 ASP A 155 ? ? -110.96 76.30 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 3 ? CG ? A LYS 4 CG 2 1 Y 1 A LYS 3 ? CD ? A LYS 4 CD 3 1 Y 1 A LYS 3 ? CE ? A LYS 4 CE 4 1 Y 1 A LYS 3 ? NZ ? A LYS 4 NZ 5 1 Y 1 A GLU 6 ? CD ? A GLU 7 CD 6 1 Y 1 A GLU 6 ? OE1 ? A GLU 7 OE1 7 1 Y 1 A GLU 6 ? OE2 ? A GLU 7 OE2 8 1 Y 1 A LYS 156 ? CG ? A LYS 155 CG 9 1 Y 1 A LYS 156 ? CD ? A LYS 155 CD 10 1 Y 1 A LYS 156 ? CE ? A LYS 155 CE 11 1 Y 1 A LYS 156 ? NZ ? A LYS 155 NZ 12 1 Y 1 A GLN 157 ? CG ? A GLN 156 CG 13 1 Y 1 A GLN 157 ? CD ? A GLN 156 CD 14 1 Y 1 A GLN 157 ? OE1 ? A GLN 156 OE1 15 1 Y 1 A GLN 157 ? NE2 ? A GLN 156 NE2 16 1 Y 1 A LYS 158 ? CG ? A LYS 157 CG 17 1 Y 1 A LYS 158 ? CD ? A LYS 157 CD 18 1 Y 1 A LYS 158 ? CE ? A LYS 157 CE 19 1 Y 1 A LYS 158 ? NZ ? A LYS 157 NZ 20 1 Y 1 A GLN 184 ? CG ? A GLN 183 CG 21 1 Y 1 A GLN 184 ? CD ? A GLN 183 CD 22 1 Y 1 A GLN 184 ? OE1 ? A GLN 183 OE1 23 1 Y 1 A GLN 184 ? NE2 ? A GLN 183 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 232 ? A GLY 231 2 1 Y 1 A MET 233 ? A MET 232 3 1 Y 1 A ASP 234 ? A ASP 233 4 1 Y 1 A GLU 235 ? A GLU 234 5 1 Y 1 A LEU 236 ? A LEU 235 6 1 Y 1 A TYR 237 ? A TYR 236 7 1 Y 1 A LYS 238 ? A LYS 237 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #