data_6RPV # _entry.id 6RPV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RPV pdb_00006rpv 10.2210/pdb6rpv/pdb WWPDB D_1292102374 ? ? BMRB 34399 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Extremely stable monomeric variant of human cystatin C with single amino acid substitution' _pdbx_database_related.db_id 34399 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6RPV _pdbx_database_status.recvd_initial_deposition_date 2019-05-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhukov, I.' 1 0000-0002-9912-1018 'Rodziewicz-Motowidlo, S.' 2 0000-0001-7800-1060 'Maszota-Zieleniak, M.' 3 0000-0002-1206-5624 'Jurczak, P.' 4 0000-0001-7962-3953 'Kozak, M.' 5 0000-0003-3312-6518 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-464X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 287 _citation.language ? _citation.page_first 361 _citation.page_last 376 _citation.title ;NMR and crystallographic structural studies of the extremely stable monomeric variant of human cystatin C with single amino acid substitution. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.15010 _citation.pdbx_database_id_PubMed 31330077 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Maszota-Zieleniak, M.' 1 ? primary 'Jurczak, P.' 2 ? primary 'Orlikowska, M.' 3 ? primary 'Zhukov, I.' 4 ? primary 'Borek, D.' 5 ? primary 'Otwinowski, Z.' 6 ? primary 'Skowron, P.' 7 ? primary 'Pietralik, Z.' 8 ? primary 'Kozak, M.' 9 ? primary 'Szymanska, A.' 10 ? primary 'Rodziewicz-Motowidlo, S.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Cystatin-C _entity.formula_weight 13323.062 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cystatin-3,Gamma-trace,Neuroendocrine basic polypeptide,Post-gamma-globulin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIGAGVNYFLDVELGRTTCTKTQPNL DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA ; _entity_poly.pdbx_seq_one_letter_code_can ;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIGAGVNYFLDVELGRTTCTKTQPNL DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 PRO n 1 4 GLY n 1 5 LYS n 1 6 PRO n 1 7 PRO n 1 8 ARG n 1 9 LEU n 1 10 VAL n 1 11 GLY n 1 12 GLY n 1 13 PRO n 1 14 MET n 1 15 ASP n 1 16 ALA n 1 17 SER n 1 18 VAL n 1 19 GLU n 1 20 GLU n 1 21 GLU n 1 22 GLY n 1 23 VAL n 1 24 ARG n 1 25 ARG n 1 26 ALA n 1 27 LEU n 1 28 ASP n 1 29 PHE n 1 30 ALA n 1 31 VAL n 1 32 GLY n 1 33 GLU n 1 34 TYR n 1 35 ASN n 1 36 LYS n 1 37 ALA n 1 38 SER n 1 39 ASN n 1 40 ASP n 1 41 MET n 1 42 TYR n 1 43 HIS n 1 44 SER n 1 45 ARG n 1 46 ALA n 1 47 LEU n 1 48 GLN n 1 49 VAL n 1 50 VAL n 1 51 ARG n 1 52 ALA n 1 53 ARG n 1 54 LYS n 1 55 GLN n 1 56 ILE n 1 57 GLY n 1 58 ALA n 1 59 GLY n 1 60 VAL n 1 61 ASN n 1 62 TYR n 1 63 PHE n 1 64 LEU n 1 65 ASP n 1 66 VAL n 1 67 GLU n 1 68 LEU n 1 69 GLY n 1 70 ARG n 1 71 THR n 1 72 THR n 1 73 CYS n 1 74 THR n 1 75 LYS n 1 76 THR n 1 77 GLN n 1 78 PRO n 1 79 ASN n 1 80 LEU n 1 81 ASP n 1 82 ASN n 1 83 CYS n 1 84 PRO n 1 85 PHE n 1 86 HIS n 1 87 ASP n 1 88 GLN n 1 89 PRO n 1 90 HIS n 1 91 LEU n 1 92 LYS n 1 93 ARG n 1 94 LYS n 1 95 ALA n 1 96 PHE n 1 97 CYS n 1 98 SER n 1 99 PHE n 1 100 GLN n 1 101 ILE n 1 102 TYR n 1 103 ALA n 1 104 VAL n 1 105 PRO n 1 106 TRP n 1 107 GLN n 1 108 GLY n 1 109 THR n 1 110 MET n 1 111 THR n 1 112 LEU n 1 113 SER n 1 114 LYS n 1 115 SER n 1 116 THR n 1 117 CYS n 1 118 GLN n 1 119 ASP n 1 120 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 120 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CST3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYTC_HUMAN _struct_ref.pdbx_db_accession P01034 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNL DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA ; _struct_ref.pdbx_align_begin 27 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6RPV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01034 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 120 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6RPV _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 57 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01034 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 83 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 57 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '2D 1H-13C HSQC' 1 isotropic 3 1 2 '3D HNCO' 1 isotropic 4 1 2 '3D HNCA' 1 isotropic 5 1 2 '3D HN(CO)CA' 1 isotropic 7 1 2 '3D CBCA(CO)NH' 1 isotropic 6 1 2 '3D HBHA(CO)NH' 1 isotropic 8 1 2 '3D HCCH-TOCSY' 1 isotropic 9 1 2 '3D 1H-13C NOESY aliphatic' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-99% 15N] hCC V57G, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '0.5 mM [U-99% 13C; U-99% 15N] hCC V57G, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C15N_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DDR2 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6RPV _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # _pdbx_nmr_ensemble.entry_id 6RPV _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6RPV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'data analysis' Sparky ? Goddard 3 'peak picking' Sparky ? Goddard 4 'chemical shift assignment' CS-ROSETTA ? 'Shen, Vernon, Baker and Bax' 5 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 refinement Xplor-NIH ? 'Schwieters, Kuszewski, Tjandra and Clore' 7 refinement YASARA ? 'Krieger E.' # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 6RPV ? ? 'SOLUTION NMR' ? ? ? ? ? ? 6RPV ? ? 'SOLUTION SCATTERING' ? # _struct.entry_id 6RPV _struct.title 'Extremely stable monomeric variant of human cystatin C with single amino acid substitution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RPV _struct_keywords.text 'protein structure, human cystatin C, hCC V57G mutation, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 20 ? ASN A 35 ? GLU A 20 ASN A 35 1 ? 16 HELX_P HELX_P2 AA2 ASP A 81 ? LEU A 91 ? ASP A 81 LEU A 91 1 ? 11 HELX_P HELX_P3 AA3 PRO A 105 ? GLY A 108 ? PRO A 105 GLY A 108 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 73 SG ? ? ? 1_555 A CYS 83 SG ? ? A CYS 73 A CYS 83 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 97 A CYS 117 1_555 ? ? ? ? ? ? ? 2.027 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 12 ? ASP A 15 ? GLY A 12 ASP A 15 AA1 2 SER A 44 ? ILE A 56 ? SER A 44 ILE A 56 AA1 3 VAL A 60 ? ARG A 70 ? VAL A 60 ARG A 70 AA1 4 ALA A 95 ? VAL A 104 ? ALA A 95 VAL A 104 AA1 5 THR A 109 ? THR A 116 ? THR A 109 THR A 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 14 ? N MET A 14 O LYS A 54 ? O LYS A 54 AA1 2 3 N ARG A 53 ? N ARG A 53 O PHE A 63 ? O PHE A 63 AA1 3 4 N VAL A 60 ? N VAL A 60 O ALA A 103 ? O ALA A 103 AA1 4 5 N TYR A 102 ? N TYR A 102 O THR A 111 ? O THR A 111 # _atom_sites.entry_id 6RPV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 TRP 106 106 106 TRP TRP A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 ALA 120 120 120 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7590 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-07-31 2 'Structure model' 1 1 2019-08-21 3 'Structure model' 1 2 2020-01-29 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' pdbx_nmr_software 3 3 'Structure model' citation 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_software.name' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation.year' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' 8 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'hCC V57G' 0.5 ? mM '[U-99% 15N]' 2 'hCC V57G' 0.5 ? mM '[U-99% 13C; U-99% 15N]' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 4 CB A GLU 20 ? ? CG A GLU 20 ? ? 1.400 1.517 -0.117 0.019 N 2 10 CB A GLU 20 ? ? CG A GLU 20 ? ? 1.401 1.517 -0.116 0.019 N 3 13 CB A VAL 31 ? ? CG2 A VAL 31 ? ? 1.397 1.524 -0.127 0.021 N 4 14 CB A GLU 20 ? ? CG A GLU 20 ? ? 1.402 1.517 -0.115 0.019 N 5 14 CB A VAL 31 ? ? CG2 A VAL 31 ? ? 1.392 1.524 -0.132 0.021 N 6 15 CB A VAL 31 ? ? CG2 A VAL 31 ? ? 1.393 1.524 -0.131 0.021 N 7 17 CB A GLU 20 ? ? CG A GLU 20 ? ? 1.365 1.517 -0.152 0.019 N 8 18 CB A GLU 20 ? ? CG A GLU 20 ? ? 1.394 1.517 -0.123 0.019 N 9 20 CB A VAL 31 ? ? CG2 A VAL 31 ? ? 1.393 1.524 -0.131 0.021 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.84 119.30 -12.46 1.50 Y 2 1 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.12 128.40 12.72 2.10 Y 3 2 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.54 119.30 -12.76 1.50 Y 4 2 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.12 128.40 12.72 2.10 Y 5 3 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.32 119.30 -12.98 1.50 Y 6 3 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.50 128.40 13.10 2.10 Y 7 4 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 123.33 120.30 3.03 0.50 N 8 4 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.82 119.30 -12.48 1.50 Y 9 4 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.12 128.40 12.72 2.10 Y 10 5 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.53 119.30 -12.77 1.50 Y 11 5 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.26 128.40 12.86 2.10 Y 12 6 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.66 119.30 -12.64 1.50 Y 13 6 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.02 128.40 12.62 2.10 Y 14 7 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.69 119.30 -12.61 1.50 Y 15 7 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.09 128.40 12.69 2.10 Y 16 8 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.83 119.30 -12.47 1.50 Y 17 9 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.42 119.30 -12.88 1.50 Y 18 9 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.25 128.40 12.85 2.10 Y 19 10 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.51 119.30 -12.79 1.50 Y 20 10 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.11 128.40 12.71 2.10 Y 21 11 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.31 120.30 3.01 0.50 N 22 11 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.54 119.30 -12.76 1.50 Y 23 11 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.49 128.40 13.09 2.10 Y 24 12 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.59 119.30 -12.71 1.50 Y 25 12 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.14 128.40 12.74 2.10 Y 26 13 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.49 119.30 -12.81 1.50 Y 27 13 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.28 128.40 12.88 2.10 Y 28 14 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 123.49 120.30 3.19 0.50 N 29 14 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.71 119.30 -12.59 1.50 Y 30 14 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.01 128.40 12.61 2.10 Y 31 15 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.52 119.30 -12.78 1.50 Y 32 15 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.39 128.40 12.99 2.10 Y 33 16 CA A CYS 97 ? ? CB A CYS 97 ? ? SG A CYS 97 ? ? 120.81 114.20 6.61 1.10 N 34 16 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.57 119.30 -12.73 1.50 Y 35 16 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.18 128.40 12.78 2.10 Y 36 17 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.46 119.30 -12.84 1.50 Y 37 17 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.25 128.40 12.85 2.10 Y 38 18 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.67 119.30 -12.63 1.50 Y 39 18 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.04 128.40 12.64 2.10 Y 40 19 NE A ARG 53 ? ? CZ A ARG 53 ? ? NH1 A ARG 53 ? ? 124.24 120.30 3.94 0.50 N 41 19 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.76 119.30 -12.54 1.50 Y 42 19 C A VAL 104 ? ? N A PRO 105 ? ? CD A PRO 105 ? ? 141.13 128.40 12.73 2.10 Y 43 20 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 123.74 120.30 3.44 0.50 N 44 20 C A VAL 104 ? ? N A PRO 105 ? ? CA A PRO 105 ? ? 106.87 119.30 -12.43 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 10 ? ? -136.75 -71.37 2 1 LEU A 91 ? ? -68.63 90.69 3 2 ASN A 39 ? ? -93.70 55.45 4 3 SER A 2 ? ? 38.60 69.51 5 3 ASN A 79 ? ? -95.74 33.84 6 4 VAL A 10 ? ? 69.03 -37.74 7 4 ASN A 39 ? ? -93.64 57.34 8 4 LEU A 91 ? ? -64.74 92.85 9 7 LYS A 5 ? ? -152.85 58.75 10 7 ASN A 79 ? ? -140.55 40.55 11 7 LEU A 91 ? ? -69.82 98.48 12 8 LEU A 9 ? ? -101.56 63.60 13 8 ASN A 39 ? ? -97.98 52.53 14 8 ALA A 46 ? ? -56.41 102.21 15 9 ASN A 39 ? ? -98.64 53.67 16 9 LEU A 91 ? ? -62.17 91.41 17 10 ASN A 39 ? ? -91.99 54.87 18 10 LEU A 91 ? ? -67.32 90.86 19 11 ASN A 39 ? ? -92.05 53.72 20 13 ASN A 39 ? ? -90.03 56.72 21 14 ASN A 39 ? ? -95.55 51.96 22 14 PRO A 78 ? ? -76.60 28.38 23 15 LEU A 9 ? ? -101.04 60.82 24 15 ASN A 39 ? ? -101.32 51.42 25 18 SER A 2 ? ? 37.25 63.36 26 19 ASN A 39 ? ? -90.11 54.97 27 20 ASN A 39 ? ? -99.87 55.43 # _pdbx_audit_support.funding_organization 'Polish National Science Centre' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number UMO/2011/03/N/ST4/01293 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support SAXS _pdbx_struct_assembly_auth_evidence.details ? #