data_6RYL # _entry.id 6RYL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6RYL pdb_00006ryl 10.2210/pdb6ryl/pdb WWPDB D_1292102847 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-04-29 2 'Structure model' 1 1 2020-05-20 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 3 'Structure model' '_database_2.pdbx_DOI' 8 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6RYL _pdbx_database_status.recvd_initial_deposition_date 2019-06-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '6RY3 contains the same protein' _pdbx_database_related.db_id 6RY3 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sloan, J.J.' 1 ? 'Wild, K.' 2 ? 'Sinning, I.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 2223 _citation.page_last 2223 _citation.title 'Structural basis for the complex DNA binding behavior of the plant stem cell regulator WUSCHEL.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-020-16024-y _citation.pdbx_database_id_PubMed 32376862 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sloan, J.' 1 ? primary 'Hakenjos, J.P.' 2 ? primary 'Gebert, M.' 3 0000-0003-4169-4152 primary 'Ermakova, O.' 4 ? primary 'Gumiero, A.' 5 ? primary 'Stier, G.' 6 ? primary 'Wild, K.' 7 ? primary 'Sinning, I.' 8 0000-0001-9127-4477 primary 'Lohmann, J.U.' 9 0000-0003-3667-187X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein WUSCHEL' 8949.188 5 ? ? ? ? 2 polymer syn ;DNA (5'-D(P*CP*AP*CP*AP*AP*CP*CP*CP*AP*TP*TP*AP*AP*CP*AP*C)-3') ; 4780.148 2 ? ? ? ? 3 polymer syn ;DNA (5'-D(P*GP*TP*GP*TP*TP*AP*AP*TP*GP*GP*GP*TP*TP*GP*TP*G)-3') ; 5015.247 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AtWUS,Plant growth activator 6' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GAMGQTSTRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYWFQNHKARERQKKRFNGGS GAMGQTSTRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYWFQNHKARERQKKRFNGGS A,B,C,D,E ? 2 polydeoxyribonucleotide no no '(DC)(DA)(DC)(DA)(DA)(DC)(DC)(DC)(DA)(DT)(DT)(DA)(DA)(DC)(DA)(DC)' CACAACCCATTAACAC F,H ? 3 polydeoxyribonucleotide no no '(DG)(DT)(DG)(DT)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DT)(DT)(DG)(DT)(DG)' GTGTTAATGGGTTGTG G,I ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 GLN n 1 6 THR n 1 7 SER n 1 8 THR n 1 9 ARG n 1 10 TRP n 1 11 THR n 1 12 PRO n 1 13 THR n 1 14 THR n 1 15 GLU n 1 16 GLN n 1 17 ILE n 1 18 LYS n 1 19 ILE n 1 20 LEU n 1 21 LYS n 1 22 GLU n 1 23 LEU n 1 24 TYR n 1 25 TYR n 1 26 ASN n 1 27 ASN n 1 28 ALA n 1 29 ILE n 1 30 ARG n 1 31 SER n 1 32 PRO n 1 33 THR n 1 34 ALA n 1 35 ASP n 1 36 GLN n 1 37 ILE n 1 38 GLN n 1 39 LYS n 1 40 ILE n 1 41 THR n 1 42 ALA n 1 43 ARG n 1 44 LEU n 1 45 ARG n 1 46 GLN n 1 47 PHE n 1 48 GLY n 1 49 LYS n 1 50 ILE n 1 51 GLU n 1 52 GLY n 1 53 LYS n 1 54 ASN n 1 55 VAL n 1 56 PHE n 1 57 TYR n 1 58 TRP n 1 59 PHE n 1 60 GLN n 1 61 ASN n 1 62 HIS n 1 63 LYS n 1 64 ALA n 1 65 ARG n 1 66 GLU n 1 67 ARG n 1 68 GLN n 1 69 LYS n 1 70 LYS n 1 71 ARG n 1 72 PHE n 1 73 ASN n 1 74 GLY n 1 75 GLY n 1 76 SER n 2 1 DC n 2 2 DA n 2 3 DC n 2 4 DA n 2 5 DA n 2 6 DC n 2 7 DC n 2 8 DC n 2 9 DA n 2 10 DT n 2 11 DT n 2 12 DA n 2 13 DA n 2 14 DC n 2 15 DA n 2 16 DC n 3 1 DG n 3 2 DT n 3 3 DG n 3 4 DT n 3 5 DT n 3 6 DA n 3 7 DA n 3 8 DT n 3 9 DG n 3 10 DG n 3 11 DG n 3 12 DT n 3 13 DT n 3 14 DG n 3 15 DT n 3 16 DG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 76 _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'WUS, PGA6, At2g17950, T27K22.18' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 2 1 sample 1 16 'Arabidopsis thaliana' ? 3702 ? 3 1 sample ? ? 'Arabidopsis thaliana' ? 3702 ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 30 ? ? ? A . n A 1 2 ALA 2 31 ? ? ? A . n A 1 3 MET 3 32 ? ? ? A . n A 1 4 GLY 4 33 ? ? ? A . n A 1 5 GLN 5 34 ? ? ? A . n A 1 6 THR 6 35 ? ? ? A . n A 1 7 SER 7 36 ? ? ? A . n A 1 8 THR 8 37 ? ? ? A . n A 1 9 ARG 9 38 ? ? ? A . n A 1 10 TRP 10 39 39 TRP TRP A . n A 1 11 THR 11 40 40 THR THR A . n A 1 12 PRO 12 41 41 PRO PRO A . n A 1 13 THR 13 42 42 THR THR A . n A 1 14 THR 14 43 43 THR THR A . n A 1 15 GLU 15 44 44 GLU GLU A . n A 1 16 GLN 16 45 45 GLN GLN A . n A 1 17 ILE 17 46 46 ILE ILE A . n A 1 18 LYS 18 47 47 LYS LYS A . n A 1 19 ILE 19 48 48 ILE ILE A . n A 1 20 LEU 20 49 49 LEU LEU A . n A 1 21 LYS 21 50 50 LYS LYS A . n A 1 22 GLU 22 51 51 GLU GLU A . n A 1 23 LEU 23 52 52 LEU LEU A . n A 1 24 TYR 24 53 53 TYR TYR A . n A 1 25 TYR 25 54 54 TYR TYR A . n A 1 26 ASN 26 55 55 ASN ASN A . n A 1 27 ASN 27 56 56 ASN ASN A . n A 1 28 ALA 28 57 57 ALA ALA A . n A 1 29 ILE 29 58 58 ILE ILE A . n A 1 30 ARG 30 59 59 ARG ARG A . n A 1 31 SER 31 60 60 SER SER A . n A 1 32 PRO 32 61 61 PRO PRO A . n A 1 33 THR 33 62 62 THR THR A . n A 1 34 ALA 34 63 63 ALA ALA A . n A 1 35 ASP 35 64 64 ASP ASP A . n A 1 36 GLN 36 65 65 GLN GLN A . n A 1 37 ILE 37 66 66 ILE ILE A . n A 1 38 GLN 38 67 67 GLN GLN A . n A 1 39 LYS 39 68 68 LYS LYS A . n A 1 40 ILE 40 69 69 ILE ILE A . n A 1 41 THR 41 70 70 THR THR A . n A 1 42 ALA 42 71 71 ALA ALA A . n A 1 43 ARG 43 72 72 ARG ARG A . n A 1 44 LEU 44 73 73 LEU LEU A . n A 1 45 ARG 45 74 74 ARG ARG A . n A 1 46 GLN 46 75 75 GLN GLN A . n A 1 47 PHE 47 76 76 PHE PHE A . n A 1 48 GLY 48 77 77 GLY GLY A . n A 1 49 LYS 49 78 78 LYS LYS A . n A 1 50 ILE 50 79 79 ILE ILE A . n A 1 51 GLU 51 80 80 GLU GLU A . n A 1 52 GLY 52 81 81 GLY GLY A . n A 1 53 LYS 53 82 82 LYS LYS A . n A 1 54 ASN 54 83 83 ASN ASN A . n A 1 55 VAL 55 84 84 VAL VAL A . n A 1 56 PHE 56 85 85 PHE PHE A . n A 1 57 TYR 57 86 86 TYR TYR A . n A 1 58 TRP 58 87 87 TRP TRP A . n A 1 59 PHE 59 88 88 PHE PHE A . n A 1 60 GLN 60 89 89 GLN GLN A . n A 1 61 ASN 61 90 90 ASN ASN A . n A 1 62 HIS 62 91 91 HIS HIS A . n A 1 63 LYS 63 92 92 LYS LYS A . n A 1 64 ALA 64 93 93 ALA ALA A . n A 1 65 ARG 65 94 94 ARG ARG A . n A 1 66 GLU 66 95 95 GLU GLU A . n A 1 67 ARG 67 96 96 ARG ARG A . n A 1 68 GLN 68 97 97 GLN GLN A . n A 1 69 LYS 69 98 98 LYS LYS A . n A 1 70 LYS 70 99 99 LYS LYS A . n A 1 71 ARG 71 100 ? ? ? A . n A 1 72 PHE 72 101 ? ? ? A . n A 1 73 ASN 73 102 ? ? ? A . n A 1 74 GLY 74 103 ? ? ? A . n A 1 75 GLY 75 104 ? ? ? A . n A 1 76 SER 76 105 ? ? ? A . n B 1 1 GLY 1 30 ? ? ? B . n B 1 2 ALA 2 31 ? ? ? B . n B 1 3 MET 3 32 ? ? ? B . n B 1 4 GLY 4 33 ? ? ? B . n B 1 5 GLN 5 34 ? ? ? B . n B 1 6 THR 6 35 ? ? ? B . n B 1 7 SER 7 36 ? ? ? B . n B 1 8 THR 8 37 37 THR THR B . n B 1 9 ARG 9 38 38 ARG ARG B . n B 1 10 TRP 10 39 39 TRP TRP B . n B 1 11 THR 11 40 40 THR THR B . n B 1 12 PRO 12 41 41 PRO PRO B . n B 1 13 THR 13 42 42 THR THR B . n B 1 14 THR 14 43 43 THR THR B . n B 1 15 GLU 15 44 44 GLU GLU B . n B 1 16 GLN 16 45 45 GLN GLN B . n B 1 17 ILE 17 46 46 ILE ILE B . n B 1 18 LYS 18 47 47 LYS LYS B . n B 1 19 ILE 19 48 48 ILE ILE B . n B 1 20 LEU 20 49 49 LEU LEU B . n B 1 21 LYS 21 50 50 LYS LYS B . n B 1 22 GLU 22 51 51 GLU GLU B . n B 1 23 LEU 23 52 52 LEU LEU B . n B 1 24 TYR 24 53 53 TYR TYR B . n B 1 25 TYR 25 54 54 TYR TYR B . n B 1 26 ASN 26 55 55 ASN ASN B . n B 1 27 ASN 27 56 56 ASN ASN B . n B 1 28 ALA 28 57 57 ALA ALA B . n B 1 29 ILE 29 58 58 ILE ILE B . n B 1 30 ARG 30 59 59 ARG ARG B . n B 1 31 SER 31 60 60 SER SER B . n B 1 32 PRO 32 61 61 PRO PRO B . n B 1 33 THR 33 62 62 THR THR B . n B 1 34 ALA 34 63 63 ALA ALA B . n B 1 35 ASP 35 64 64 ASP ASP B . n B 1 36 GLN 36 65 65 GLN GLN B . n B 1 37 ILE 37 66 66 ILE ILE B . n B 1 38 GLN 38 67 67 GLN GLN B . n B 1 39 LYS 39 68 68 LYS LYS B . n B 1 40 ILE 40 69 69 ILE ILE B . n B 1 41 THR 41 70 70 THR THR B . n B 1 42 ALA 42 71 71 ALA ALA B . n B 1 43 ARG 43 72 72 ARG ARG B . n B 1 44 LEU 44 73 73 LEU LEU B . n B 1 45 ARG 45 74 74 ARG ARG B . n B 1 46 GLN 46 75 75 GLN GLN B . n B 1 47 PHE 47 76 76 PHE PHE B . n B 1 48 GLY 48 77 77 GLY GLY B . n B 1 49 LYS 49 78 78 LYS LYS B . n B 1 50 ILE 50 79 79 ILE ILE B . n B 1 51 GLU 51 80 80 GLU GLU B . n B 1 52 GLY 52 81 81 GLY GLY B . n B 1 53 LYS 53 82 82 LYS LYS B . n B 1 54 ASN 54 83 83 ASN ASN B . n B 1 55 VAL 55 84 84 VAL VAL B . n B 1 56 PHE 56 85 85 PHE PHE B . n B 1 57 TYR 57 86 86 TYR TYR B . n B 1 58 TRP 58 87 87 TRP TRP B . n B 1 59 PHE 59 88 88 PHE PHE B . n B 1 60 GLN 60 89 89 GLN GLN B . n B 1 61 ASN 61 90 90 ASN ASN B . n B 1 62 HIS 62 91 91 HIS HIS B . n B 1 63 LYS 63 92 92 LYS LYS B . n B 1 64 ALA 64 93 93 ALA ALA B . n B 1 65 ARG 65 94 94 ARG ARG B . n B 1 66 GLU 66 95 95 GLU GLU B . n B 1 67 ARG 67 96 96 ARG ARG B . n B 1 68 GLN 68 97 97 GLN GLN B . n B 1 69 LYS 69 98 98 LYS LYS B . n B 1 70 LYS 70 99 99 LYS LYS B . n B 1 71 ARG 71 100 100 ARG ARG B . n B 1 72 PHE 72 101 ? ? ? B . n B 1 73 ASN 73 102 ? ? ? B . n B 1 74 GLY 74 103 ? ? ? B . n B 1 75 GLY 75 104 ? ? ? B . n B 1 76 SER 76 105 ? ? ? B . n C 1 1 GLY 1 30 ? ? ? C . n C 1 2 ALA 2 31 ? ? ? C . n C 1 3 MET 3 32 ? ? ? C . n C 1 4 GLY 4 33 ? ? ? C . n C 1 5 GLN 5 34 ? ? ? C . n C 1 6 THR 6 35 ? ? ? C . n C 1 7 SER 7 36 ? ? ? C . n C 1 8 THR 8 37 37 THR THR C . n C 1 9 ARG 9 38 38 ARG ARG C . n C 1 10 TRP 10 39 39 TRP TRP C . n C 1 11 THR 11 40 40 THR THR C . n C 1 12 PRO 12 41 41 PRO PRO C . n C 1 13 THR 13 42 42 THR THR C . n C 1 14 THR 14 43 43 THR THR C . n C 1 15 GLU 15 44 44 GLU GLU C . n C 1 16 GLN 16 45 45 GLN GLN C . n C 1 17 ILE 17 46 46 ILE ILE C . n C 1 18 LYS 18 47 47 LYS LYS C . n C 1 19 ILE 19 48 48 ILE ILE C . n C 1 20 LEU 20 49 49 LEU LEU C . n C 1 21 LYS 21 50 50 LYS LYS C . n C 1 22 GLU 22 51 51 GLU GLU C . n C 1 23 LEU 23 52 52 LEU LEU C . n C 1 24 TYR 24 53 53 TYR TYR C . n C 1 25 TYR 25 54 54 TYR TYR C . n C 1 26 ASN 26 55 55 ASN ASN C . n C 1 27 ASN 27 56 56 ASN ASN C . n C 1 28 ALA 28 57 57 ALA ALA C . n C 1 29 ILE 29 58 58 ILE ILE C . n C 1 30 ARG 30 59 59 ARG ARG C . n C 1 31 SER 31 60 60 SER SER C . n C 1 32 PRO 32 61 61 PRO PRO C . n C 1 33 THR 33 62 62 THR THR C . n C 1 34 ALA 34 63 63 ALA ALA C . n C 1 35 ASP 35 64 64 ASP ASP C . n C 1 36 GLN 36 65 65 GLN GLN C . n C 1 37 ILE 37 66 66 ILE ILE C . n C 1 38 GLN 38 67 67 GLN GLN C . n C 1 39 LYS 39 68 68 LYS LYS C . n C 1 40 ILE 40 69 69 ILE ILE C . n C 1 41 THR 41 70 70 THR THR C . n C 1 42 ALA 42 71 71 ALA ALA C . n C 1 43 ARG 43 72 72 ARG ARG C . n C 1 44 LEU 44 73 73 LEU LEU C . n C 1 45 ARG 45 74 74 ARG ARG C . n C 1 46 GLN 46 75 75 GLN GLN C . n C 1 47 PHE 47 76 76 PHE PHE C . n C 1 48 GLY 48 77 77 GLY GLY C . n C 1 49 LYS 49 78 78 LYS LYS C . n C 1 50 ILE 50 79 79 ILE ILE C . n C 1 51 GLU 51 80 80 GLU GLU C . n C 1 52 GLY 52 81 81 GLY GLY C . n C 1 53 LYS 53 82 82 LYS LYS C . n C 1 54 ASN 54 83 83 ASN ASN C . n C 1 55 VAL 55 84 84 VAL VAL C . n C 1 56 PHE 56 85 85 PHE PHE C . n C 1 57 TYR 57 86 86 TYR TYR C . n C 1 58 TRP 58 87 87 TRP TRP C . n C 1 59 PHE 59 88 88 PHE PHE C . n C 1 60 GLN 60 89 89 GLN GLN C . n C 1 61 ASN 61 90 90 ASN ASN C . n C 1 62 HIS 62 91 91 HIS HIS C . n C 1 63 LYS 63 92 92 LYS LYS C . n C 1 64 ALA 64 93 93 ALA ALA C . n C 1 65 ARG 65 94 94 ARG ARG C . n C 1 66 GLU 66 95 95 GLU GLU C . n C 1 67 ARG 67 96 96 ARG ARG C . n C 1 68 GLN 68 97 97 GLN GLN C . n C 1 69 LYS 69 98 98 LYS LYS C . n C 1 70 LYS 70 99 99 LYS LYS C . n C 1 71 ARG 71 100 100 ARG ARG C . n C 1 72 PHE 72 101 ? ? ? C . n C 1 73 ASN 73 102 ? ? ? C . n C 1 74 GLY 74 103 ? ? ? C . n C 1 75 GLY 75 104 ? ? ? C . n C 1 76 SER 76 105 ? ? ? C . n D 1 1 GLY 1 30 ? ? ? D . n D 1 2 ALA 2 31 ? ? ? D . n D 1 3 MET 3 32 ? ? ? D . n D 1 4 GLY 4 33 ? ? ? D . n D 1 5 GLN 5 34 ? ? ? D . n D 1 6 THR 6 35 ? ? ? D . n D 1 7 SER 7 36 ? ? ? D . n D 1 8 THR 8 37 37 THR THR D . n D 1 9 ARG 9 38 38 ARG ARG D . n D 1 10 TRP 10 39 39 TRP TRP D . n D 1 11 THR 11 40 40 THR THR D . n D 1 12 PRO 12 41 41 PRO PRO D . n D 1 13 THR 13 42 42 THR THR D . n D 1 14 THR 14 43 43 THR THR D . n D 1 15 GLU 15 44 44 GLU GLU D . n D 1 16 GLN 16 45 45 GLN GLN D . n D 1 17 ILE 17 46 46 ILE ILE D . n D 1 18 LYS 18 47 47 LYS LYS D . n D 1 19 ILE 19 48 48 ILE ILE D . n D 1 20 LEU 20 49 49 LEU LEU D . n D 1 21 LYS 21 50 50 LYS LYS D . n D 1 22 GLU 22 51 51 GLU GLU D . n D 1 23 LEU 23 52 52 LEU LEU D . n D 1 24 TYR 24 53 53 TYR TYR D . n D 1 25 TYR 25 54 54 TYR TYR D . n D 1 26 ASN 26 55 55 ASN ASN D . n D 1 27 ASN 27 56 56 ASN ASN D . n D 1 28 ALA 28 57 57 ALA ALA D . n D 1 29 ILE 29 58 58 ILE ILE D . n D 1 30 ARG 30 59 59 ARG ARG D . n D 1 31 SER 31 60 60 SER SER D . n D 1 32 PRO 32 61 61 PRO PRO D . n D 1 33 THR 33 62 62 THR THR D . n D 1 34 ALA 34 63 63 ALA ALA D . n D 1 35 ASP 35 64 64 ASP ASP D . n D 1 36 GLN 36 65 65 GLN GLN D . n D 1 37 ILE 37 66 66 ILE ILE D . n D 1 38 GLN 38 67 67 GLN GLN D . n D 1 39 LYS 39 68 68 LYS LYS D . n D 1 40 ILE 40 69 69 ILE ILE D . n D 1 41 THR 41 70 70 THR THR D . n D 1 42 ALA 42 71 71 ALA ALA D . n D 1 43 ARG 43 72 72 ARG ARG D . n D 1 44 LEU 44 73 73 LEU LEU D . n D 1 45 ARG 45 74 74 ARG ARG D . n D 1 46 GLN 46 75 75 GLN GLN D . n D 1 47 PHE 47 76 76 PHE PHE D . n D 1 48 GLY 48 77 77 GLY GLY D . n D 1 49 LYS 49 78 78 LYS LYS D . n D 1 50 ILE 50 79 79 ILE ILE D . n D 1 51 GLU 51 80 80 GLU GLU D . n D 1 52 GLY 52 81 81 GLY GLY D . n D 1 53 LYS 53 82 82 LYS LYS D . n D 1 54 ASN 54 83 83 ASN ASN D . n D 1 55 VAL 55 84 84 VAL VAL D . n D 1 56 PHE 56 85 85 PHE PHE D . n D 1 57 TYR 57 86 86 TYR TYR D . n D 1 58 TRP 58 87 87 TRP TRP D . n D 1 59 PHE 59 88 88 PHE PHE D . n D 1 60 GLN 60 89 89 GLN GLN D . n D 1 61 ASN 61 90 90 ASN ASN D . n D 1 62 HIS 62 91 91 HIS HIS D . n D 1 63 LYS 63 92 92 LYS LYS D . n D 1 64 ALA 64 93 93 ALA ALA D . n D 1 65 ARG 65 94 94 ARG ARG D . n D 1 66 GLU 66 95 95 GLU GLU D . n D 1 67 ARG 67 96 96 ARG ARG D . n D 1 68 GLN 68 97 97 GLN GLN D . n D 1 69 LYS 69 98 98 LYS LYS D . n D 1 70 LYS 70 99 99 LYS LYS D . n D 1 71 ARG 71 100 ? ? ? D . n D 1 72 PHE 72 101 ? ? ? D . n D 1 73 ASN 73 102 ? ? ? D . n D 1 74 GLY 74 103 ? ? ? D . n D 1 75 GLY 75 104 ? ? ? D . n D 1 76 SER 76 105 ? ? ? D . n E 1 1 GLY 1 30 ? ? ? E . n E 1 2 ALA 2 31 ? ? ? E . n E 1 3 MET 3 32 ? ? ? E . n E 1 4 GLY 4 33 ? ? ? E . n E 1 5 GLN 5 34 ? ? ? E . n E 1 6 THR 6 35 ? ? ? E . n E 1 7 SER 7 36 ? ? ? E . n E 1 8 THR 8 37 37 THR THR E . n E 1 9 ARG 9 38 38 ARG ARG E . n E 1 10 TRP 10 39 39 TRP TRP E . n E 1 11 THR 11 40 40 THR THR E . n E 1 12 PRO 12 41 41 PRO PRO E . n E 1 13 THR 13 42 42 THR THR E . n E 1 14 THR 14 43 43 THR THR E . n E 1 15 GLU 15 44 44 GLU GLU E . n E 1 16 GLN 16 45 45 GLN GLN E . n E 1 17 ILE 17 46 46 ILE ILE E . n E 1 18 LYS 18 47 47 LYS LYS E . n E 1 19 ILE 19 48 48 ILE ILE E . n E 1 20 LEU 20 49 49 LEU LEU E . n E 1 21 LYS 21 50 50 LYS LYS E . n E 1 22 GLU 22 51 51 GLU GLU E . n E 1 23 LEU 23 52 52 LEU LEU E . n E 1 24 TYR 24 53 53 TYR TYR E . n E 1 25 TYR 25 54 54 TYR TYR E . n E 1 26 ASN 26 55 55 ASN ASN E . n E 1 27 ASN 27 56 56 ASN ASN E . n E 1 28 ALA 28 57 57 ALA ALA E . n E 1 29 ILE 29 58 58 ILE ILE E . n E 1 30 ARG 30 59 59 ARG ARG E . n E 1 31 SER 31 60 60 SER SER E . n E 1 32 PRO 32 61 61 PRO PRO E . n E 1 33 THR 33 62 62 THR THR E . n E 1 34 ALA 34 63 63 ALA ALA E . n E 1 35 ASP 35 64 64 ASP ASP E . n E 1 36 GLN 36 65 65 GLN GLN E . n E 1 37 ILE 37 66 66 ILE ILE E . n E 1 38 GLN 38 67 67 GLN GLN E . n E 1 39 LYS 39 68 68 LYS LYS E . n E 1 40 ILE 40 69 69 ILE ILE E . n E 1 41 THR 41 70 70 THR THR E . n E 1 42 ALA 42 71 71 ALA ALA E . n E 1 43 ARG 43 72 72 ARG ARG E . n E 1 44 LEU 44 73 73 LEU LEU E . n E 1 45 ARG 45 74 74 ARG ARG E . n E 1 46 GLN 46 75 75 GLN GLN E . n E 1 47 PHE 47 76 76 PHE PHE E . n E 1 48 GLY 48 77 77 GLY GLY E . n E 1 49 LYS 49 78 78 LYS LYS E . n E 1 50 ILE 50 79 79 ILE ILE E . n E 1 51 GLU 51 80 80 GLU GLU E . n E 1 52 GLY 52 81 81 GLY GLY E . n E 1 53 LYS 53 82 82 LYS LYS E . n E 1 54 ASN 54 83 83 ASN ASN E . n E 1 55 VAL 55 84 84 VAL VAL E . n E 1 56 PHE 56 85 85 PHE PHE E . n E 1 57 TYR 57 86 86 TYR TYR E . n E 1 58 TRP 58 87 87 TRP TRP E . n E 1 59 PHE 59 88 88 PHE PHE E . n E 1 60 GLN 60 89 89 GLN GLN E . n E 1 61 ASN 61 90 90 ASN ASN E . n E 1 62 HIS 62 91 91 HIS HIS E . n E 1 63 LYS 63 92 92 LYS LYS E . n E 1 64 ALA 64 93 93 ALA ALA E . n E 1 65 ARG 65 94 94 ARG ARG E . n E 1 66 GLU 66 95 95 GLU GLU E . n E 1 67 ARG 67 96 96 ARG ARG E . n E 1 68 GLN 68 97 97 GLN GLN E . n E 1 69 LYS 69 98 98 LYS LYS E . n E 1 70 LYS 70 99 99 LYS LYS E . n E 1 71 ARG 71 100 100 ARG ARG E . n E 1 72 PHE 72 101 ? ? ? E . n E 1 73 ASN 73 102 ? ? ? E . n E 1 74 GLY 74 103 ? ? ? E . n E 1 75 GLY 75 104 ? ? ? E . n E 1 76 SER 76 105 ? ? ? E . n F 2 1 DC 1 1 1 DC DC F . n F 2 2 DA 2 2 2 DA DA F . n F 2 3 DC 3 3 3 DC DC F . n F 2 4 DA 4 4 4 DA DA F . n F 2 5 DA 5 5 5 DA DA F . n F 2 6 DC 6 6 6 DC DC F . n F 2 7 DC 7 7 7 DC DC F . n F 2 8 DC 8 8 8 DC DC F . n F 2 9 DA 9 9 9 DA DA F . n F 2 10 DT 10 10 10 DT DT F . n F 2 11 DT 11 11 11 DT DT F . n F 2 12 DA 12 12 12 DA DA F . n F 2 13 DA 13 13 13 DA DA F . n F 2 14 DC 14 14 14 DC DC F . n F 2 15 DA 15 15 15 DA DA F . n F 2 16 DC 16 16 16 DC DC F . n G 3 1 DG 1 1 1 DG DG G . n G 3 2 DT 2 2 2 DT DT G . n G 3 3 DG 3 3 3 DG DG G . n G 3 4 DT 4 4 4 DT DT G . n G 3 5 DT 5 5 5 DT DT G . n G 3 6 DA 6 6 6 DA DA G . n G 3 7 DA 7 7 7 DA DA G . n G 3 8 DT 8 8 8 DT DT G . n G 3 9 DG 9 9 9 DG DG G . n G 3 10 DG 10 10 10 DG DG G . n G 3 11 DG 11 11 11 DG DG G . n G 3 12 DT 12 12 12 DT DT G . n G 3 13 DT 13 13 13 DT DT G . n G 3 14 DG 14 14 14 DG DG G . n G 3 15 DT 15 15 15 DT DT G . n G 3 16 DG 16 16 16 DG DG G . n H 2 1 DC 1 1 1 DC DC H . n H 2 2 DA 2 2 2 DA DA H . n H 2 3 DC 3 3 3 DC DC H . n H 2 4 DA 4 4 4 DA DA H . n H 2 5 DA 5 5 5 DA DA H . n H 2 6 DC 6 6 6 DC DC H . n H 2 7 DC 7 7 7 DC DC H . n H 2 8 DC 8 8 8 DC DC H . n H 2 9 DA 9 9 9 DA DA H . n H 2 10 DT 10 10 10 DT DT H . n H 2 11 DT 11 11 11 DT DT H . n H 2 12 DA 12 12 12 DA DA H . n H 2 13 DA 13 13 13 DA DA H . n H 2 14 DC 14 14 14 DC DC H . n H 2 15 DA 15 15 15 DA DA H . n H 2 16 DC 16 16 16 DC DC H . n I 3 1 DG 1 1 1 DG DG I . n I 3 2 DT 2 2 2 DT DT I . n I 3 3 DG 3 3 3 DG DG I . n I 3 4 DT 4 4 4 DT DT I . n I 3 5 DT 5 5 5 DT DT I . n I 3 6 DA 6 6 6 DA DA I . n I 3 7 DA 7 7 7 DA DA I . n I 3 8 DT 8 8 8 DT DT I . n I 3 9 DG 9 9 9 DG DG I . n I 3 10 DG 10 10 10 DG DG I . n I 3 11 DG 11 11 11 DG DG I . n I 3 12 DT 12 12 12 DT DT I . n I 3 13 DT 13 13 13 DT DT I . n I 3 14 DG 14 14 14 DG DG I . n I 3 15 DT 15 15 15 DT DT I . n I 3 16 DG 16 16 16 DG DG I . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 102.880 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6RYL _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.663 _cell.length_a_esd ? _cell.length_b 45.914 _cell.length_b_esd ? _cell.length_c 87.535 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 10 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6RYL _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6RYL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M CHES (pH 9.5), 20% PEG 8000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-09-18 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97242 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97242 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6RYL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.63 _reflns.d_resolution_low 45.92 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19403 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.38 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.03845 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.63 _reflns_shell.d_res_low 2.724 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1907 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.552 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 229.690 _refine.B_iso_mean 105.5645 _refine.B_iso_min 43.090 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6RYL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6300 _refine.ls_d_res_low 41.7520 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19330 _refine.ls_number_reflns_R_free 985 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4100 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2385 _refine.ls_R_factor_R_free 0.2636 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2372 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6RY3 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.2300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6300 _refine_hist.d_res_low 41.7520 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 4047 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 380 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2735 _refine_hist.pdbx_number_atoms_nucleic_acid 1312 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 4270 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.736 ? 6015 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 642 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 539 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 25.331 ? 2342 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? I 268 18.241 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? G 268 18.241 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 3 TORSIONAL ? A 967 18.241 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 4 TORSIONAL ? B 967 18.241 ? 2 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 5 TORSIONAL ? C 967 18.241 ? 2 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 6 TORSIONAL ? D 967 18.241 ? 2 'X-RAY DIFFRACTION' 5 ? ? ? ? ? 7 TORSIONAL ? E 967 18.241 ? 2 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 8 TORSIONAL ? F 314 18.241 ? 3 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 9 TORSIONAL ? H 314 18.241 ? 3 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6301 2.7687 2712 . 156 2556 99.0000 . . . 0.3924 0.0000 0.3636 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.7687 2.9421 2744 . 141 2603 100.0000 . . . 0.3792 0.0000 0.3359 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.9421 3.1692 2737 . 120 2617 100.0000 . . . 0.3497 0.0000 0.3095 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.1692 3.4880 2725 . 155 2570 98.0000 . . . 0.3029 0.0000 0.2577 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.4880 3.9924 2765 . 131 2634 100.0000 . . . 0.2703 0.0000 0.2415 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.9924 5.0286 2787 . 123 2664 100.0000 . . . 0.2313 0.0000 0.2170 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 5.0286 41.7577 2860 . 159 2701 99.0000 . . . 0.2303 0.0000 0.2070 . . . . . . 7 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 '(chain I and (resseq 2:13 or resseq 15:16))' 1 2 '(chain G and (resseq 2:13 or resseq 15:16))' 2 1 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; 2 2 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; 2 3 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; 2 4 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; 2 5 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; 3 1 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; 3 2 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? I 2 I 13 '(chain I and (resseq 2:13 or resseq 15:16))' ? ? ? ? ? ? ? ? ? ? 1 1 2 ? I 15 I 16 '(chain I and (resseq 2:13 or resseq 15:16))' ? ? ? ? ? ? ? ? ? ? 1 2 1 ? G 2 G 13 '(chain G and (resseq 2:13 or resseq 15:16))' ? ? ? ? ? ? ? ? ? ? 1 2 2 ? G 15 G 16 '(chain G and (resseq 2:13 or resseq 15:16))' ? ? ? ? ? ? ? ? ? ? 2 1 1 ? A 39 A 43 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 1 2 ? A 45 A 46 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 1 3 ? A 1 A 1 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 1 4 ? A 73 A 73 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 1 5 ? A 76 A 76 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 1 6 ? A 76 A 77 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 1 7 ? A 80 A 88 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 1 8 ? A 90 A 93 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 1 9 ? A 95 A 95 ;(chain A and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 1 ? B 39 B 43 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 2 ? B 45 B 46 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 3 ? B 48 B 66 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 4 ? B 69 B 71 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 5 ? B 73 B 73 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 6 ? B 76 B 77 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 7 ? B 80 B 88 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 8 ? B 90 B 93 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 2 9 ? B 95 B 95 ;(chain B and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 1 ? C 39 C 43 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 2 ? C 45 C 46 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 3 ? C 48 C 66 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 4 ? C 69 C 71 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 5 ? C 73 C 73 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 6 ? C 76 C 77 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 7 ? C 80 C 88 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 8 ? C 90 C 93 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 3 9 ? C 95 C 95 ;(chain C and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 1 ? D 39 D 43 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 2 ? D 45 D 46 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 3 ? D 48 D 66 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 4 ? D 69 D 71 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 5 ? D 73 D 73 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 6 ? D 76 D 77 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 7 ? D 80 D 88 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 8 ? D 90 D 93 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 4 9 ? D 95 D 95 ;(chain D and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 1 ? E 39 E 43 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 2 ? E 45 E 46 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 3 ? E 48 E 66 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 4 ? E 69 E 71 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 5 ? E 73 E 73 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 6 ? E 76 E 77 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 7 ? E 80 E 88 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 8 ? E 90 E 93 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 2 5 9 ? E 95 E 95 ;(chain E and (resseq 39:43 or resseq 45:46 or resseq 48:66 or resseq 69:71 or resseq 73 or resseq 76:77 or resseq 80:88 or resseq 90:93 or resseq 95)) ; ? ? ? ? ? ? ? ? ? ? 3 1 1 ? F 1 F 8 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 2 ? F 9 F 9 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 3 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 4 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 5 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 6 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 7 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 8 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 9 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 10 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 11 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 12 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 13 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 14 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 1 15 ? F 1 F 16 ;(chain F and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 1 ? H 1 H 8 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 2 ? H 9 H 9 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 3 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 4 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 5 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 6 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 7 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 8 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 9 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 10 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 11 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 12 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 13 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 14 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 15 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? 3 2 16 ? H 1 H 16 ;(chain H and (resseq 1:8 or (resid 9 and (name P or name OP1 or name OP2 or name O5 or name C5 or name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name N1 or name C2 or name N3 )) or resseq 10:16)) ; ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? 3 ? # _struct.entry_id 6RYL _struct.title 'WUS-HD bound to TAAT DNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6RYL _struct_keywords.text 'Homeodomain Transcription factor, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 2 ? G N N 3 ? H N N 2 ? I N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP WUS_ARATH Q9SB92 ? 1 QTSTRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYWFQNHKARERQKKRFNG 34 2 PDB 6RYL 6RYL ? 2 ? 1 3 PDB 6RYL 6RYL ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6RYL A 5 ? 74 ? Q9SB92 34 ? 103 ? 34 103 2 1 6RYL B 5 ? 74 ? Q9SB92 34 ? 103 ? 34 103 3 1 6RYL C 5 ? 74 ? Q9SB92 34 ? 103 ? 34 103 4 1 6RYL D 5 ? 74 ? Q9SB92 34 ? 103 ? 34 103 5 1 6RYL E 5 ? 74 ? Q9SB92 34 ? 103 ? 34 103 6 2 6RYL F 1 ? 16 ? 6RYL 1 ? 16 ? 1 16 7 3 6RYL G 1 ? 16 ? 6RYL 1 ? 16 ? 1 16 8 2 6RYL H 1 ? 16 ? 6RYL 1 ? 16 ? 1 16 9 3 6RYL I 1 ? 16 ? 6RYL 1 ? 16 ? 1 16 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6RYL GLY A 1 ? UNP Q9SB92 ? ? 'expression tag' 30 1 1 6RYL ALA A 2 ? UNP Q9SB92 ? ? 'expression tag' 31 2 1 6RYL MET A 3 ? UNP Q9SB92 ? ? 'expression tag' 32 3 1 6RYL GLY A 4 ? UNP Q9SB92 ? ? 'expression tag' 33 4 1 6RYL GLY A 75 ? UNP Q9SB92 ? ? 'expression tag' 104 5 1 6RYL SER A 76 ? UNP Q9SB92 ? ? 'expression tag' 105 6 2 6RYL GLY B 1 ? UNP Q9SB92 ? ? 'expression tag' 30 7 2 6RYL ALA B 2 ? UNP Q9SB92 ? ? 'expression tag' 31 8 2 6RYL MET B 3 ? UNP Q9SB92 ? ? 'expression tag' 32 9 2 6RYL GLY B 4 ? UNP Q9SB92 ? ? 'expression tag' 33 10 2 6RYL GLY B 75 ? UNP Q9SB92 ? ? 'expression tag' 104 11 2 6RYL SER B 76 ? UNP Q9SB92 ? ? 'expression tag' 105 12 3 6RYL GLY C 1 ? UNP Q9SB92 ? ? 'expression tag' 30 13 3 6RYL ALA C 2 ? UNP Q9SB92 ? ? 'expression tag' 31 14 3 6RYL MET C 3 ? UNP Q9SB92 ? ? 'expression tag' 32 15 3 6RYL GLY C 4 ? UNP Q9SB92 ? ? 'expression tag' 33 16 3 6RYL GLY C 75 ? UNP Q9SB92 ? ? 'expression tag' 104 17 3 6RYL SER C 76 ? UNP Q9SB92 ? ? 'expression tag' 105 18 4 6RYL GLY D 1 ? UNP Q9SB92 ? ? 'expression tag' 30 19 4 6RYL ALA D 2 ? UNP Q9SB92 ? ? 'expression tag' 31 20 4 6RYL MET D 3 ? UNP Q9SB92 ? ? 'expression tag' 32 21 4 6RYL GLY D 4 ? UNP Q9SB92 ? ? 'expression tag' 33 22 4 6RYL GLY D 75 ? UNP Q9SB92 ? ? 'expression tag' 104 23 4 6RYL SER D 76 ? UNP Q9SB92 ? ? 'expression tag' 105 24 5 6RYL GLY E 1 ? UNP Q9SB92 ? ? 'expression tag' 30 25 5 6RYL ALA E 2 ? UNP Q9SB92 ? ? 'expression tag' 31 26 5 6RYL MET E 3 ? UNP Q9SB92 ? ? 'expression tag' 32 27 5 6RYL GLY E 4 ? UNP Q9SB92 ? ? 'expression tag' 33 28 5 6RYL GLY E 75 ? UNP Q9SB92 ? ? 'expression tag' 104 29 5 6RYL SER E 76 ? UNP Q9SB92 ? ? 'expression tag' 105 30 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? pentameric 5 2 author_defined_assembly ? tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,F,G 2 1 D,E,H,I # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 13 ? ASN A 26 ? THR A 42 ASN A 55 1 ? 14 HELX_P HELX_P2 AA2 THR A 33 ? ARG A 45 ? THR A 62 ARG A 74 1 ? 13 HELX_P HELX_P3 AA3 GLU A 51 ? LYS A 69 ? GLU A 80 LYS A 98 1 ? 19 HELX_P HELX_P4 AA4 THR B 13 ? ASN B 26 ? THR B 42 ASN B 55 1 ? 14 HELX_P HELX_P5 AA5 THR B 33 ? ARG B 45 ? THR B 62 ARG B 74 1 ? 13 HELX_P HELX_P6 AA6 GLN B 46 ? GLY B 48 ? GLN B 75 GLY B 77 5 ? 3 HELX_P HELX_P7 AA7 GLU B 51 ? ARG B 71 ? GLU B 80 ARG B 100 1 ? 21 HELX_P HELX_P8 AA8 THR C 13 ? ASN C 26 ? THR C 42 ASN C 55 1 ? 14 HELX_P HELX_P9 AA9 THR C 33 ? GLN C 46 ? THR C 62 GLN C 75 1 ? 14 HELX_P HELX_P10 AB1 GLU C 51 ? ARG C 71 ? GLU C 80 ARG C 100 1 ? 21 HELX_P HELX_P11 AB2 THR D 13 ? ASN D 26 ? THR D 42 ASN D 55 1 ? 14 HELX_P HELX_P12 AB3 THR D 33 ? ARG D 45 ? THR D 62 ARG D 74 1 ? 13 HELX_P HELX_P13 AB4 GLN D 46 ? GLY D 48 ? GLN D 75 GLY D 77 5 ? 3 HELX_P HELX_P14 AB5 GLU D 51 ? LYS D 70 ? GLU D 80 LYS D 99 1 ? 20 HELX_P HELX_P15 AB6 THR E 13 ? ASN E 26 ? THR E 42 ASN E 55 1 ? 14 HELX_P HELX_P16 AB7 THR E 33 ? GLN E 46 ? THR E 62 GLN E 75 1 ? 14 HELX_P HELX_P17 AB8 GLU E 51 ? ARG E 71 ? GLU E 80 ARG E 100 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role hydrog1 hydrog ? ? F DC 1 N3 ? ? ? 1_555 G DG 16 N1 ? ? F DC 1 G DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? F DC 1 N4 ? ? ? 1_555 G DG 16 O6 ? ? F DC 1 G DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? F DC 1 O2 ? ? ? 1_555 G DG 16 N2 ? ? F DC 1 G DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? F DA 2 N1 ? ? ? 1_555 G DT 15 N3 ? ? F DA 2 G DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? F DA 2 N6 ? ? ? 1_555 G DT 15 O4 ? ? F DA 2 G DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? F DC 3 N4 ? ? ? 1_555 G DG 14 O6 ? ? F DC 3 G DG 14 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? ? hydrog7 hydrog ? ? F DA 4 N1 ? ? ? 1_555 G DT 13 N3 ? ? F DA 4 G DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? F DA 4 N6 ? ? ? 1_555 G DT 13 O4 ? ? F DA 4 G DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? F DA 5 N1 ? ? ? 1_555 G DT 12 N3 ? ? F DA 5 G DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? F DA 5 N6 ? ? ? 1_555 G DT 12 O4 ? ? F DA 5 G DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? F DC 6 N3 ? ? ? 1_555 G DG 11 N1 ? ? F DC 6 G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog12 hydrog ? ? F DC 6 N4 ? ? ? 1_555 G DG 11 O6 ? ? F DC 6 G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog13 hydrog ? ? F DC 6 O2 ? ? ? 1_555 G DG 11 N2 ? ? F DC 6 G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? F DC 7 N3 ? ? ? 1_555 G DG 10 N1 ? ? F DC 7 G DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? F DC 7 N4 ? ? ? 1_555 G DG 10 O6 ? ? F DC 7 G DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? F DC 7 O2 ? ? ? 1_555 G DG 10 N2 ? ? F DC 7 G DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? F DC 8 N3 ? ? ? 1_555 G DG 9 N1 ? ? F DC 8 G DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? F DC 8 N4 ? ? ? 1_555 G DG 9 O6 ? ? F DC 8 G DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? F DC 8 O2 ? ? ? 1_555 G DG 9 N2 ? ? F DC 8 G DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog20 hydrog ? ? F DA 9 N1 ? ? ? 1_555 G DT 8 N3 ? ? F DA 9 G DT 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog21 hydrog ? ? F DA 9 N6 ? ? ? 1_555 G DT 8 O4 ? ? F DA 9 G DT 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog22 hydrog ? ? F DT 10 N3 ? ? ? 1_555 G DA 7 N1 ? ? F DT 10 G DA 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog23 hydrog ? ? F DT 10 O4 ? ? ? 1_555 G DA 7 N6 ? ? F DT 10 G DA 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog24 hydrog ? ? F DT 11 N3 ? ? ? 1_555 G DA 6 N1 ? ? F DT 11 G DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? F DT 11 O4 ? ? ? 1_555 G DA 6 N6 ? ? F DT 11 G DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? F DA 12 N1 ? ? ? 1_555 G DT 5 N3 ? ? F DA 12 G DT 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? F DA 12 N6 ? ? ? 1_555 G DT 5 O4 ? ? F DA 12 G DT 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? F DA 13 N1 ? ? ? 1_555 G DT 4 N3 ? ? F DA 13 G DT 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? F DA 13 N6 ? ? ? 1_555 G DT 4 O4 ? ? F DA 13 G DT 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog30 hydrog ? ? F DC 14 N3 ? ? ? 1_555 G DG 3 N1 ? ? F DC 14 G DG 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog31 hydrog ? ? F DC 14 N4 ? ? ? 1_555 G DG 3 O6 ? ? F DC 14 G DG 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? F DC 14 O2 ? ? ? 1_555 G DG 3 N2 ? ? F DC 14 G DG 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog33 hydrog ? ? F DA 15 N1 ? ? ? 1_555 G DT 2 N3 ? ? F DA 15 G DT 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog34 hydrog ? ? F DA 15 N6 ? ? ? 1_555 G DT 2 O4 ? ? F DA 15 G DT 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog35 hydrog ? ? F DC 16 N3 ? ? ? 1_555 G DG 1 N1 ? ? F DC 16 G DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog36 hydrog ? ? F DC 16 N4 ? ? ? 1_555 G DG 1 O6 ? ? F DC 16 G DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog37 hydrog ? ? F DC 16 O2 ? ? ? 1_555 G DG 1 N2 ? ? F DC 16 G DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog38 hydrog ? ? H DC 1 N3 ? ? ? 1_555 I DG 16 N1 ? ? H DC 1 I DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog39 hydrog ? ? H DC 1 N4 ? ? ? 1_555 I DG 16 O6 ? ? H DC 1 I DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog40 hydrog ? ? H DC 1 O2 ? ? ? 1_555 I DG 16 N2 ? ? H DC 1 I DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog41 hydrog ? ? H DA 2 N1 ? ? ? 1_555 I DG 14 N1 ? ? H DA 2 I DG 14 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? ? hydrog42 hydrog ? ? H DA 2 N6 ? ? ? 1_555 I DG 14 O6 ? ? H DA 2 I DG 14 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? ? hydrog43 hydrog ? ? H DA 2 N1 ? ? ? 1_555 I DT 15 N3 ? ? H DA 2 I DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog44 hydrog ? ? H DA 2 N6 ? ? ? 1_555 I DT 15 O4 ? ? H DA 2 I DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog45 hydrog ? ? H DC 3 N3 ? ? ? 1_555 I DG 14 N1 ? ? H DC 3 I DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog46 hydrog ? ? H DC 3 N4 ? ? ? 1_555 I DG 14 O6 ? ? H DC 3 I DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog47 hydrog ? ? H DC 3 O2 ? ? ? 1_555 I DG 14 N2 ? ? H DC 3 I DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog48 hydrog ? ? H DA 4 N1 ? ? ? 1_555 I DT 13 N3 ? ? H DA 4 I DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog49 hydrog ? ? H DA 4 N6 ? ? ? 1_555 I DT 13 O4 ? ? H DA 4 I DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog50 hydrog ? ? H DA 5 N1 ? ? ? 1_555 I DT 12 N3 ? ? H DA 5 I DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog51 hydrog ? ? H DA 5 N6 ? ? ? 1_555 I DT 12 O4 ? ? H DA 5 I DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog52 hydrog ? ? H DC 6 N3 ? ? ? 1_555 I DG 11 N1 ? ? H DC 6 I DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog53 hydrog ? ? H DC 6 N4 ? ? ? 1_555 I DG 11 O6 ? ? H DC 6 I DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog54 hydrog ? ? H DC 6 O2 ? ? ? 1_555 I DG 11 N2 ? ? H DC 6 I DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog55 hydrog ? ? H DC 7 N3 ? ? ? 1_555 I DG 10 N1 ? ? H DC 7 I DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog56 hydrog ? ? H DC 7 N4 ? ? ? 1_555 I DG 10 O6 ? ? H DC 7 I DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog57 hydrog ? ? H DC 7 O2 ? ? ? 1_555 I DG 10 N2 ? ? H DC 7 I DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog58 hydrog ? ? H DC 8 N3 ? ? ? 1_555 I DG 9 N1 ? ? H DC 8 I DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog59 hydrog ? ? H DC 8 N4 ? ? ? 1_555 I DG 9 O6 ? ? H DC 8 I DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog60 hydrog ? ? H DC 8 O2 ? ? ? 1_555 I DG 9 N2 ? ? H DC 8 I DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog61 hydrog ? ? H DA 9 N1 ? ? ? 1_555 I DT 8 N3 ? ? H DA 9 I DT 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog62 hydrog ? ? H DA 9 N6 ? ? ? 1_555 I DT 8 O4 ? ? H DA 9 I DT 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog63 hydrog ? ? H DT 10 N3 ? ? ? 1_555 I DA 7 N1 ? ? H DT 10 I DA 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog64 hydrog ? ? H DT 10 O4 ? ? ? 1_555 I DA 7 N6 ? ? H DT 10 I DA 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog65 hydrog ? ? H DT 11 N3 ? ? ? 1_555 I DA 6 N1 ? ? H DT 11 I DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog66 hydrog ? ? H DT 11 O4 ? ? ? 1_555 I DA 6 N6 ? ? H DT 11 I DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog67 hydrog ? ? H DA 12 N1 ? ? ? 1_555 I DT 5 N3 ? ? H DA 12 I DT 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog68 hydrog ? ? H DA 12 N6 ? ? ? 1_555 I DT 5 O4 ? ? H DA 12 I DT 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog69 hydrog ? ? H DA 13 N1 ? ? ? 1_555 I DT 4 N3 ? ? H DA 13 I DT 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog70 hydrog ? ? H DA 13 N6 ? ? ? 1_555 I DT 4 O4 ? ? H DA 13 I DT 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog71 hydrog ? ? H DC 14 N3 ? ? ? 1_555 I DG 3 N1 ? ? H DC 14 I DG 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog72 hydrog ? ? H DC 14 N4 ? ? ? 1_555 I DG 3 O6 ? ? H DC 14 I DG 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog73 hydrog ? ? H DC 14 O2 ? ? ? 1_555 I DG 3 N2 ? ? H DC 14 I DG 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog74 hydrog ? ? H DA 15 N1 ? ? ? 1_555 I DT 2 N3 ? ? H DA 15 I DT 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog75 hydrog ? ? H DA 15 N6 ? ? ? 1_555 I DT 2 O4 ? ? H DA 15 I DT 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog76 hydrog ? ? H DC 16 N3 ? ? ? 1_555 I DG 1 N1 ? ? H DC 16 I DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog77 hydrog ? ? H DC 16 N4 ? ? ? 1_555 I DG 1 O6 ? ? H DC 16 I DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog78 hydrog ? ? H DC 16 O2 ? ? ? 1_555 I DG 1 N2 ? ? H DC 16 I DG 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? # _struct_conn_type.id hydrog _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG1 A THR 62 ? ? OD1 A ASP 64 ? ? 2.02 2 1 O C ILE 66 ? ? OG1 C THR 70 ? ? 2.02 3 1 O B ILE 66 ? ? OG1 B THR 70 ? ? 2.04 4 1 NZ D LYS 78 ? ? OE1 D GLU 80 ? ? 2.09 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "O4'" F DC 3 ? ? "C1'" F DC 3 ? ? N1 F DC 3 ? ? 110.80 108.30 2.50 0.30 N 2 1 "O4'" F DC 6 ? ? "C1'" F DC 6 ? ? N1 F DC 6 ? ? 110.63 108.30 2.33 0.30 N 3 1 "O4'" H DC 8 ? ? "C1'" H DC 8 ? ? N1 H DC 8 ? ? 110.57 108.30 2.27 0.30 N 4 1 "O4'" H DA 9 ? ? "C1'" H DA 9 ? ? N9 H DA 9 ? ? 110.31 108.30 2.01 0.30 N 5 1 "O4'" I DT 4 ? ? "C1'" I DT 4 ? ? N1 I DT 4 ? ? 110.52 108.30 2.22 0.30 N 6 1 "O4'" I DT 5 ? ? "C1'" I DT 5 ? ? N1 I DT 5 ? ? 111.03 108.30 2.73 0.30 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id D _pdbx_validate_torsion.auth_seq_id 59 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -121.65 _pdbx_validate_torsion.psi -54.36 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -34.3494 12.8845 -10.1882 0.7951 ? 0.3307 ? -0.1751 ? 1.6341 ? -0.1146 ? 1.2849 ? 3.5077 ? 0.8773 ? -0.8078 ? 3.7608 ? 0.4465 ? 2.2439 ? -0.1811 ? -0.1627 ? 1.7463 ? 0.1380 ? 0.2632 ? 1.3182 ? -0.8778 ? -1.8757 ? -0.2482 ? 2 'X-RAY DIFFRACTION' ? refined -33.5641 10.7004 0.1219 1.4124 ? 0.1890 ? -0.1784 ? 1.8011 ? 0.1439 ? 1.2345 ? 4.2167 ? 2.1385 ? -1.0497 ? 3.4353 ? -0.9613 ? 2.6288 ? -0.0464 ? -1.9756 ? -0.7142 ? 1.1395 ? 0.0873 ? -1.1557 ? 0.9024 ? -0.3892 ? 0.2411 ? 3 'X-RAY DIFFRACTION' ? refined -28.4168 6.4377 -14.9991 0.7499 ? 0.1433 ? -0.2166 ? 1.2059 ? -0.2186 ? 1.1601 ? 2.6339 ? 0.8428 ? 1.3797 ? 5.4354 ? -2.9926 ? 2.8872 ? -0.5645 ? 0.0752 ? -0.3837 ? -0.9279 ? 0.4632 ? -0.5736 ? 0.5680 ? -1.9497 ? -0.2368 ? 4 'X-RAY DIFFRACTION' ? refined -9.9401 -5.8415 4.1466 0.6095 ? -0.0756 ? 0.0323 ? 0.5710 ? -0.0171 ? 0.5806 ? 3.9560 ? -1.5920 ? -1.4069 ? 4.0402 ? 0.0944 ? 5.1090 ? -0.1633 ? -0.2124 ? -0.3838 ? -0.2492 ? -0.1827 ? 0.6774 ? 0.1383 ? -0.3636 ? 0.3663 ? 5 'X-RAY DIFFRACTION' ? refined -13.1401 -2.9502 1.2350 0.5362 ? 0.0654 ? 0.0205 ? 0.5272 ? 0.0190 ? 0.6242 ? 4.2414 ? -0.0289 ? 0.4779 ? 5.1941 ? -1.8845 ? 6.2618 ? 0.4132 ? -0.5615 ? -0.0948 ? 0.0388 ? -0.0226 ? 0.5780 ? -0.0295 ? -0.0985 ? -0.3348 ? 6 'X-RAY DIFFRACTION' ? refined -3.1315 11.7075 -25.1087 0.6724 ? 0.1416 ? -0.0141 ? 0.5350 ? 0.0920 ? 0.5056 ? 9.2342 ? -2.8603 ? -0.4149 ? 6.9862 ? 2.0129 ? 4.9818 ? -0.0731 ? 0.0864 ? -0.8939 ? -0.8269 ? -0.0048 ? 0.0605 ? -0.4312 ? 0.2413 ? 0.0149 ? 7 'X-RAY DIFFRACTION' ? refined -0.5911 22.1006 -24.0278 1.2602 ? 0.1470 ? 0.2131 ? 0.5548 ? -0.0527 ? 0.4874 ? 5.9963 ? 1.2265 ? 3.4217 ? 6.1435 ? -1.1949 ? 8.1520 ? -0.6597 ? -0.0522 ? 2.1851 ? -0.2760 ? 0.7491 ? 0.5600 ? 0.0700 ? 0.4414 ? -0.4821 ? 8 'X-RAY DIFFRACTION' ? refined -9.9534 20.9924 -22.7771 1.3604 ? 0.3558 ? -0.0211 ? 1.0644 ? 0.0009 ? 0.9701 ? 8.0571 ? 1.7053 ? 3.1560 ? 6.8558 ? 1.9208 ? 4.7645 ? 1.2913 ? 1.3762 ? 1.1285 ? 0.5104 ? 0.5988 ? -0.4747 ? -1.3682 ? -0.3283 ? -0.3082 ? 9 'X-RAY DIFFRACTION' ? refined 1.0290 6.5151 -17.7478 0.8387 ? 0.1793 ? 0.0909 ? 0.6537 ? 0.0352 ? 0.4506 ? 2.2646 ? -0.1443 ? 0.3159 ? 6.7153 ? -0.1446 ? 3.9873 ? -0.3292 ? 0.0417 ? -0.2186 ? -0.6608 ? 0.4663 ? 0.0637 ? 0.2960 ? 0.7092 ? 0.1179 ? 10 'X-RAY DIFFRACTION' ? refined -22.7936 9.7392 -51.3638 0.9177 ? 0.1371 ? -0.1689 ? 1.3864 ? 0.2478 ? 1.4327 ? 1.3436 ? -0.7042 ? -0.4487 ? 2.4283 ? 0.6905 ? 2.7842 ? -0.6921 ? -1.0050 ? -0.0727 ? -0.0535 ? 0.8773 ? 1.7619 ? -0.5617 ? -1.4116 ? -0.2830 ? 11 'X-RAY DIFFRACTION' ? refined -15.8712 6.5197 -59.9045 0.9838 ? -0.0724 ? -0.4522 ? 1.4578 ? 0.2310 ? 1.3003 ? 0.0110 ? 0.2685 ? -0.6702 ? 5.6382 ? -0.4747 ? 4.6900 ? 0.5581 ? -0.7921 ? -1.1133 ? -0.9916 ? -0.0279 ? 0.4102 ? 0.3327 ? 0.4155 ? -0.5280 ? 12 'X-RAY DIFFRACTION' ? refined -2.4016 -5.0352 -39.8363 0.5428 ? -0.0715 ? -0.0185 ? 0.5532 ? -0.0749 ? 0.6941 ? 3.4680 ? 0.3651 ? 0.1399 ? 5.1628 ? 1.7980 ? 2.1026 ? -0.4961 ? 0.2143 ? -0.3822 ? -0.3199 ? 0.5757 ? 0.2648 ? -0.0006 ? -0.0574 ? -0.1903 ? 13 'X-RAY DIFFRACTION' ? refined -8.9542 1.0535 -36.1264 0.5686 ? 0.1203 ? 0.1246 ? 0.6884 ? 0.0310 ? 0.7897 ? 6.7186 ? 1.3198 ? 0.2289 ? 5.2452 ? 0.9993 ? 7.4810 ? 0.2017 ? 0.1520 ? 0.4165 ? 0.0348 ? -0.1727 ? 0.9750 ? 0.0999 ? -0.6256 ? -0.1336 ? 14 'X-RAY DIFFRACTION' ? refined -2.5565 -6.6252 -49.9501 0.7180 ? 0.0122 ? -0.0513 ? 0.9389 ? -0.0838 ? 0.7143 ? 4.4519 ? -2.9004 ? -0.3937 ? 5.6985 ? -0.5555 ? 1.9038 ? -0.2595 ? -0.5169 ? -0.0123 ? -1.2269 ? 0.8289 ? -0.3987 ? 0.0318 ? 0.2675 ? -0.3909 ? 15 'X-RAY DIFFRACTION' ? refined -34.6525 -1.1591 -17.6521 1.2352 ? -0.0904 ? -0.5338 ? 1.7708 ? -0.1085 ? 1.6053 ? 6.6884 ? -0.2284 ? 5.2699 ? 6.3185 ? 0.1048 ? 6.1798 ? -1.1432 ? 1.5912 ? -0.0915 ? -1.6746 ? 0.4433 ? 1.3179 ? -1.3588 ? -0.1429 ? 0.9439 ? 16 'X-RAY DIFFRACTION' ? refined -9.9340 2.7662 -10.5527 0.7505 ? 0.2958 ? -0.0407 ? 0.6289 ? 0.0073 ? 0.7135 ? 4.1614 ? -0.6204 ? 0.9931 ? 4.8941 ? -1.5069 ? 3.2852 ? 0.0909 ? 0.3395 ? -0.5266 ? -0.5241 ? 0.1573 ? 0.2490 ? 0.2038 ? 0.0360 ? -0.0637 ? 17 'X-RAY DIFFRACTION' ? refined -7.3266 3.8655 -10.1531 0.7104 ? 0.1375 ? 0.0568 ? 0.6128 ? -0.0759 ? 0.5714 ? 4.9158 ? 2.0205 ? 1.7052 ? 4.7724 ? -0.4938 ? 4.3841 ? -0.3471 ? 0.1442 ? -0.0170 ? -0.4343 ? 0.2248 ? 0.3925 ? -0.6113 ? -0.1923 ? 0.2367 ? 18 'X-RAY DIFFRACTION' ? refined -31.4348 -7.8157 -17.7584 1.3349 ? -0.2094 ? -0.3370 ? 1.6350 ? -0.0727 ? 1.6716 ? 4.5150 ? -0.0893 ? 1.1523 ? 3.8883 ? 0.7271 ? 0.8275 ? -1.6865 ? 0.6959 ? -1.9252 ? -1.0431 ? 0.7936 ? 0.6410 ? 0.4325 ? -2.1146 ? 0.4718 ? 19 'X-RAY DIFFRACTION' ? refined -12.8465 -2.6781 -61.6432 1.0037 ? -0.2645 ? -0.2950 ? 1.5719 ? -0.0495 ? 1.2323 ? 6.6219 ? 0.4872 ? 1.3519 ? 3.2260 ? -0.8582 ? 3.6320 ? -0.3540 ? 0.7494 ? -0.0654 ? -1.4875 ? 0.6938 ? 1.2650 ? -0.1304 ? 0.2267 ? -0.2231 ? 20 'X-RAY DIFFRACTION' ? refined 8.6951 7.5203 -50.0697 0.6577 ? -0.2051 ? 0.0495 ? 0.9015 ? -0.0401 ? 0.6849 ? 8.0403 ? 1.5832 ? 0.5140 ? 5.8154 ? 2.1829 ? 2.2777 ? -0.7828 ? 1.2162 ? -0.1393 ? -0.8237 ? 1.1655 ? -0.3317 ? -0.8695 ? 0.9873 ? -0.6867 ? 21 'X-RAY DIFFRACTION' ? refined 14.5367 2.8494 -50.9189 0.7868 ? -0.1004 ? 0.0045 ? 0.6788 ? -0.0492 ? 0.7550 ? 5.3562 ? -2.1471 ? 2.9399 ? 6.4027 ? 0.4023 ? 4.8577 ? -0.9841 ? -0.3761 ? -0.0280 ? -2.1321 ? 0.0221 ? -0.2205 ? -0.2098 ? 0.0939 ? 0.5872 ? 22 'X-RAY DIFFRACTION' ? refined -10.8861 -2.0805 -60.5551 0.9851 ? -0.3008 ? -0.3157 ? 1.2392 ? 0.0894 ? 1.0600 ? 3.5865 ? 0.5389 ? -0.6619 ? -0.4500 ? 0.3913 ? 3.7524 ? -0.6890 ? 0.9229 ? -0.6974 ? -0.8005 ? 1.0106 ? 0.8736 ? -0.0886 ? -0.0845 ? -0.4355 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 39 ? ? A 62 ? ;chain 'A' and (resid 39 through 62 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 63 ? ? A 80 ? ;chain 'A' and (resid 63 through 80 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 81 ? ? A 99 ? ;chain 'A' and (resid 81 through 99 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? B 37 ? ? B 62 ? ;chain 'B' and (resid 37 through 62 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 63 ? ? B 100 ? ;chain 'B' and (resid 63 through 100 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? C 37 ? ? C 62 ? ;chain 'C' and (resid 37 through 62 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? C 63 ? ? C 74 ? ;chain 'C' and (resid 63 through 74 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? C 75 ? ? C 80 ? ;chain 'C' and (resid 75 through 80 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? C 81 ? ? C 100 ? ;chain 'C' and (resid 81 through 100 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? D 37 ? ? D 80 ? ;chain 'D' and (resid 37 through 80 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? D 81 ? ? D 99 ? ;chain 'D' and (resid 81 through 99 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? E 37 ? ? E 62 ? ;chain 'E' and (resid 37 through 62 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? E 63 ? ? E 80 ? ;chain 'E' and (resid 63 through 80 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? E 81 ? ? E 100 ? ;chain 'E' and (resid 81 through 100 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? F 1 ? ? F 5 ? ;chain 'F' and (resid 1 through 5 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? F 6 ? ? F 16 ? ;chain 'F' and (resid 6 through 16 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? G 1 ? ? G 10 ? ;chain 'G' and (resid 1 through 10 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? G 11 ? ? G 16 ? ;chain 'G' and (resid 11 through 16 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? H 1 ? ? H 10 ? ;chain 'H' and (resid 1 through 10 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? H 11 ? ? H 16 ? ;chain 'H' and (resid 11 through 16 ) ; 21 'X-RAY DIFFRACTION' 21 ? ? I 1 ? ? I 5 ? ;chain 'I' and (resid 1 through 5 ) ; 22 'X-RAY DIFFRACTION' 22 ? ? I 6 ? ? I 16 ? ;chain 'I' and (resid 6 through 16 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 30 ? A GLY 1 2 1 Y 1 A ALA 31 ? A ALA 2 3 1 Y 1 A MET 32 ? A MET 3 4 1 Y 1 A GLY 33 ? A GLY 4 5 1 Y 1 A GLN 34 ? A GLN 5 6 1 Y 1 A THR 35 ? A THR 6 7 1 Y 1 A SER 36 ? A SER 7 8 1 Y 1 A THR 37 ? A THR 8 9 1 Y 1 A ARG 38 ? A ARG 9 10 1 Y 1 A ARG 100 ? A ARG 71 11 1 Y 1 A PHE 101 ? A PHE 72 12 1 Y 1 A ASN 102 ? A ASN 73 13 1 Y 1 A GLY 103 ? A GLY 74 14 1 Y 1 A GLY 104 ? A GLY 75 15 1 Y 1 A SER 105 ? A SER 76 16 1 Y 1 B GLY 30 ? B GLY 1 17 1 Y 1 B ALA 31 ? B ALA 2 18 1 Y 1 B MET 32 ? B MET 3 19 1 Y 1 B GLY 33 ? B GLY 4 20 1 Y 1 B GLN 34 ? B GLN 5 21 1 Y 1 B THR 35 ? B THR 6 22 1 Y 1 B SER 36 ? B SER 7 23 1 Y 1 B PHE 101 ? B PHE 72 24 1 Y 1 B ASN 102 ? B ASN 73 25 1 Y 1 B GLY 103 ? B GLY 74 26 1 Y 1 B GLY 104 ? B GLY 75 27 1 Y 1 B SER 105 ? B SER 76 28 1 Y 1 C GLY 30 ? C GLY 1 29 1 Y 1 C ALA 31 ? C ALA 2 30 1 Y 1 C MET 32 ? C MET 3 31 1 Y 1 C GLY 33 ? C GLY 4 32 1 Y 1 C GLN 34 ? C GLN 5 33 1 Y 1 C THR 35 ? C THR 6 34 1 Y 1 C SER 36 ? C SER 7 35 1 Y 1 C PHE 101 ? C PHE 72 36 1 Y 1 C ASN 102 ? C ASN 73 37 1 Y 1 C GLY 103 ? C GLY 74 38 1 Y 1 C GLY 104 ? C GLY 75 39 1 Y 1 C SER 105 ? C SER 76 40 1 Y 1 D GLY 30 ? D GLY 1 41 1 Y 1 D ALA 31 ? D ALA 2 42 1 Y 1 D MET 32 ? D MET 3 43 1 Y 1 D GLY 33 ? D GLY 4 44 1 Y 1 D GLN 34 ? D GLN 5 45 1 Y 1 D THR 35 ? D THR 6 46 1 Y 1 D SER 36 ? D SER 7 47 1 Y 1 D ARG 100 ? D ARG 71 48 1 Y 1 D PHE 101 ? D PHE 72 49 1 Y 1 D ASN 102 ? D ASN 73 50 1 Y 1 D GLY 103 ? D GLY 74 51 1 Y 1 D GLY 104 ? D GLY 75 52 1 Y 1 D SER 105 ? D SER 76 53 1 Y 1 E GLY 30 ? E GLY 1 54 1 Y 1 E ALA 31 ? E ALA 2 55 1 Y 1 E MET 32 ? E MET 3 56 1 Y 1 E GLY 33 ? E GLY 4 57 1 Y 1 E GLN 34 ? E GLN 5 58 1 Y 1 E THR 35 ? E THR 6 59 1 Y 1 E SER 36 ? E SER 7 60 1 Y 1 E PHE 101 ? E PHE 72 61 1 Y 1 E ASN 102 ? E ASN 73 62 1 Y 1 E GLY 103 ? E GLY 74 63 1 Y 1 E GLY 104 ? E GLY 75 64 1 Y 1 E SER 105 ? E SER 76 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 DA OP3 O N N 74 DA P P N N 75 DA OP1 O N N 76 DA OP2 O N N 77 DA "O5'" O N N 78 DA "C5'" C N N 79 DA "C4'" C N R 80 DA "O4'" O N N 81 DA "C3'" C N S 82 DA "O3'" O N N 83 DA "C2'" C N N 84 DA "C1'" C N R 85 DA N9 N Y N 86 DA C8 C Y N 87 DA N7 N Y N 88 DA C5 C Y N 89 DA C6 C Y N 90 DA N6 N N N 91 DA N1 N Y N 92 DA C2 C Y N 93 DA N3 N Y N 94 DA C4 C Y N 95 DA HOP3 H N N 96 DA HOP2 H N N 97 DA "H5'" H N N 98 DA "H5''" H N N 99 DA "H4'" H N N 100 DA "H3'" H N N 101 DA "HO3'" H N N 102 DA "H2'" H N N 103 DA "H2''" H N N 104 DA "H1'" H N N 105 DA H8 H N N 106 DA H61 H N N 107 DA H62 H N N 108 DA H2 H N N 109 DC OP3 O N N 110 DC P P N N 111 DC OP1 O N N 112 DC OP2 O N N 113 DC "O5'" O N N 114 DC "C5'" C N N 115 DC "C4'" C N R 116 DC "O4'" O N N 117 DC "C3'" C N S 118 DC "O3'" O N N 119 DC "C2'" C N N 120 DC "C1'" C N R 121 DC N1 N N N 122 DC C2 C N N 123 DC O2 O N N 124 DC N3 N N N 125 DC C4 C N N 126 DC N4 N N N 127 DC C5 C N N 128 DC C6 C N N 129 DC HOP3 H N N 130 DC HOP2 H N N 131 DC "H5'" H N N 132 DC "H5''" H N N 133 DC "H4'" H N N 134 DC "H3'" H N N 135 DC "HO3'" H N N 136 DC "H2'" H N N 137 DC "H2''" H N N 138 DC "H1'" H N N 139 DC H41 H N N 140 DC H42 H N N 141 DC H5 H N N 142 DC H6 H N N 143 DG OP3 O N N 144 DG P P N N 145 DG OP1 O N N 146 DG OP2 O N N 147 DG "O5'" O N N 148 DG "C5'" C N N 149 DG "C4'" C N R 150 DG "O4'" O N N 151 DG "C3'" C N S 152 DG "O3'" O N N 153 DG "C2'" C N N 154 DG "C1'" C N R 155 DG N9 N Y N 156 DG C8 C Y N 157 DG N7 N Y N 158 DG C5 C Y N 159 DG C6 C N N 160 DG O6 O N N 161 DG N1 N N N 162 DG C2 C N N 163 DG N2 N N N 164 DG N3 N N N 165 DG C4 C Y N 166 DG HOP3 H N N 167 DG HOP2 H N N 168 DG "H5'" H N N 169 DG "H5''" H N N 170 DG "H4'" H N N 171 DG "H3'" H N N 172 DG "HO3'" H N N 173 DG "H2'" H N N 174 DG "H2''" H N N 175 DG "H1'" H N N 176 DG H8 H N N 177 DG H1 H N N 178 DG H21 H N N 179 DG H22 H N N 180 DT OP3 O N N 181 DT P P N N 182 DT OP1 O N N 183 DT OP2 O N N 184 DT "O5'" O N N 185 DT "C5'" C N N 186 DT "C4'" C N R 187 DT "O4'" O N N 188 DT "C3'" C N S 189 DT "O3'" O N N 190 DT "C2'" C N N 191 DT "C1'" C N R 192 DT N1 N N N 193 DT C2 C N N 194 DT O2 O N N 195 DT N3 N N N 196 DT C4 C N N 197 DT O4 O N N 198 DT C5 C N N 199 DT C7 C N N 200 DT C6 C N N 201 DT HOP3 H N N 202 DT HOP2 H N N 203 DT "H5'" H N N 204 DT "H5''" H N N 205 DT "H4'" H N N 206 DT "H3'" H N N 207 DT "HO3'" H N N 208 DT "H2'" H N N 209 DT "H2''" H N N 210 DT "H1'" H N N 211 DT H3 H N N 212 DT H71 H N N 213 DT H72 H N N 214 DT H73 H N N 215 DT H6 H N N 216 GLN N N N N 217 GLN CA C N S 218 GLN C C N N 219 GLN O O N N 220 GLN CB C N N 221 GLN CG C N N 222 GLN CD C N N 223 GLN OE1 O N N 224 GLN NE2 N N N 225 GLN OXT O N N 226 GLN H H N N 227 GLN H2 H N N 228 GLN HA H N N 229 GLN HB2 H N N 230 GLN HB3 H N N 231 GLN HG2 H N N 232 GLN HG3 H N N 233 GLN HE21 H N N 234 GLN HE22 H N N 235 GLN HXT H N N 236 GLU N N N N 237 GLU CA C N S 238 GLU C C N N 239 GLU O O N N 240 GLU CB C N N 241 GLU CG C N N 242 GLU CD C N N 243 GLU OE1 O N N 244 GLU OE2 O N N 245 GLU OXT O N N 246 GLU H H N N 247 GLU H2 H N N 248 GLU HA H N N 249 GLU HB2 H N N 250 GLU HB3 H N N 251 GLU HG2 H N N 252 GLU HG3 H N N 253 GLU HE2 H N N 254 GLU HXT H N N 255 GLY N N N N 256 GLY CA C N N 257 GLY C C N N 258 GLY O O N N 259 GLY OXT O N N 260 GLY H H N N 261 GLY H2 H N N 262 GLY HA2 H N N 263 GLY HA3 H N N 264 GLY HXT H N N 265 HIS N N N N 266 HIS CA C N S 267 HIS C C N N 268 HIS O O N N 269 HIS CB C N N 270 HIS CG C Y N 271 HIS ND1 N Y N 272 HIS CD2 C Y N 273 HIS CE1 C Y N 274 HIS NE2 N Y N 275 HIS OXT O N N 276 HIS H H N N 277 HIS H2 H N N 278 HIS HA H N N 279 HIS HB2 H N N 280 HIS HB3 H N N 281 HIS HD1 H N N 282 HIS HD2 H N N 283 HIS HE1 H N N 284 HIS HE2 H N N 285 HIS HXT H N N 286 ILE N N N N 287 ILE CA C N S 288 ILE C C N N 289 ILE O O N N 290 ILE CB C N S 291 ILE CG1 C N N 292 ILE CG2 C N N 293 ILE CD1 C N N 294 ILE OXT O N N 295 ILE H H N N 296 ILE H2 H N N 297 ILE HA H N N 298 ILE HB H N N 299 ILE HG12 H N N 300 ILE HG13 H N N 301 ILE HG21 H N N 302 ILE HG22 H N N 303 ILE HG23 H N N 304 ILE HD11 H N N 305 ILE HD12 H N N 306 ILE HD13 H N N 307 ILE HXT H N N 308 LEU N N N N 309 LEU CA C N S 310 LEU C C N N 311 LEU O O N N 312 LEU CB C N N 313 LEU CG C N N 314 LEU CD1 C N N 315 LEU CD2 C N N 316 LEU OXT O N N 317 LEU H H N N 318 LEU H2 H N N 319 LEU HA H N N 320 LEU HB2 H N N 321 LEU HB3 H N N 322 LEU HG H N N 323 LEU HD11 H N N 324 LEU HD12 H N N 325 LEU HD13 H N N 326 LEU HD21 H N N 327 LEU HD22 H N N 328 LEU HD23 H N N 329 LEU HXT H N N 330 LYS N N N N 331 LYS CA C N S 332 LYS C C N N 333 LYS O O N N 334 LYS CB C N N 335 LYS CG C N N 336 LYS CD C N N 337 LYS CE C N N 338 LYS NZ N N N 339 LYS OXT O N N 340 LYS H H N N 341 LYS H2 H N N 342 LYS HA H N N 343 LYS HB2 H N N 344 LYS HB3 H N N 345 LYS HG2 H N N 346 LYS HG3 H N N 347 LYS HD2 H N N 348 LYS HD3 H N N 349 LYS HE2 H N N 350 LYS HE3 H N N 351 LYS HZ1 H N N 352 LYS HZ2 H N N 353 LYS HZ3 H N N 354 LYS HXT H N N 355 MET N N N N 356 MET CA C N S 357 MET C C N N 358 MET O O N N 359 MET CB C N N 360 MET CG C N N 361 MET SD S N N 362 MET CE C N N 363 MET OXT O N N 364 MET H H N N 365 MET H2 H N N 366 MET HA H N N 367 MET HB2 H N N 368 MET HB3 H N N 369 MET HG2 H N N 370 MET HG3 H N N 371 MET HE1 H N N 372 MET HE2 H N N 373 MET HE3 H N N 374 MET HXT H N N 375 PHE N N N N 376 PHE CA C N S 377 PHE C C N N 378 PHE O O N N 379 PHE CB C N N 380 PHE CG C Y N 381 PHE CD1 C Y N 382 PHE CD2 C Y N 383 PHE CE1 C Y N 384 PHE CE2 C Y N 385 PHE CZ C Y N 386 PHE OXT O N N 387 PHE H H N N 388 PHE H2 H N N 389 PHE HA H N N 390 PHE HB2 H N N 391 PHE HB3 H N N 392 PHE HD1 H N N 393 PHE HD2 H N N 394 PHE HE1 H N N 395 PHE HE2 H N N 396 PHE HZ H N N 397 PHE HXT H N N 398 PRO N N N N 399 PRO CA C N S 400 PRO C C N N 401 PRO O O N N 402 PRO CB C N N 403 PRO CG C N N 404 PRO CD C N N 405 PRO OXT O N N 406 PRO H H N N 407 PRO HA H N N 408 PRO HB2 H N N 409 PRO HB3 H N N 410 PRO HG2 H N N 411 PRO HG3 H N N 412 PRO HD2 H N N 413 PRO HD3 H N N 414 PRO HXT H N N 415 SER N N N N 416 SER CA C N S 417 SER C C N N 418 SER O O N N 419 SER CB C N N 420 SER OG O N N 421 SER OXT O N N 422 SER H H N N 423 SER H2 H N N 424 SER HA H N N 425 SER HB2 H N N 426 SER HB3 H N N 427 SER HG H N N 428 SER HXT H N N 429 THR N N N N 430 THR CA C N S 431 THR C C N N 432 THR O O N N 433 THR CB C N R 434 THR OG1 O N N 435 THR CG2 C N N 436 THR OXT O N N 437 THR H H N N 438 THR H2 H N N 439 THR HA H N N 440 THR HB H N N 441 THR HG1 H N N 442 THR HG21 H N N 443 THR HG22 H N N 444 THR HG23 H N N 445 THR HXT H N N 446 TRP N N N N 447 TRP CA C N S 448 TRP C C N N 449 TRP O O N N 450 TRP CB C N N 451 TRP CG C Y N 452 TRP CD1 C Y N 453 TRP CD2 C Y N 454 TRP NE1 N Y N 455 TRP CE2 C Y N 456 TRP CE3 C Y N 457 TRP CZ2 C Y N 458 TRP CZ3 C Y N 459 TRP CH2 C Y N 460 TRP OXT O N N 461 TRP H H N N 462 TRP H2 H N N 463 TRP HA H N N 464 TRP HB2 H N N 465 TRP HB3 H N N 466 TRP HD1 H N N 467 TRP HE1 H N N 468 TRP HE3 H N N 469 TRP HZ2 H N N 470 TRP HZ3 H N N 471 TRP HH2 H N N 472 TRP HXT H N N 473 TYR N N N N 474 TYR CA C N S 475 TYR C C N N 476 TYR O O N N 477 TYR CB C N N 478 TYR CG C Y N 479 TYR CD1 C Y N 480 TYR CD2 C Y N 481 TYR CE1 C Y N 482 TYR CE2 C Y N 483 TYR CZ C Y N 484 TYR OH O N N 485 TYR OXT O N N 486 TYR H H N N 487 TYR H2 H N N 488 TYR HA H N N 489 TYR HB2 H N N 490 TYR HB3 H N N 491 TYR HD1 H N N 492 TYR HD2 H N N 493 TYR HE1 H N N 494 TYR HE2 H N N 495 TYR HH H N N 496 TYR HXT H N N 497 VAL N N N N 498 VAL CA C N S 499 VAL C C N N 500 VAL O O N N 501 VAL CB C N N 502 VAL CG1 C N N 503 VAL CG2 C N N 504 VAL OXT O N N 505 VAL H H N N 506 VAL H2 H N N 507 VAL HA H N N 508 VAL HB H N N 509 VAL HG11 H N N 510 VAL HG12 H N N 511 VAL HG13 H N N 512 VAL HG21 H N N 513 VAL HG22 H N N 514 VAL HG23 H N N 515 VAL HXT H N N 516 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 DA OP3 P sing N N 70 DA OP3 HOP3 sing N N 71 DA P OP1 doub N N 72 DA P OP2 sing N N 73 DA P "O5'" sing N N 74 DA OP2 HOP2 sing N N 75 DA "O5'" "C5'" sing N N 76 DA "C5'" "C4'" sing N N 77 DA "C5'" "H5'" sing N N 78 DA "C5'" "H5''" sing N N 79 DA "C4'" "O4'" sing N N 80 DA "C4'" "C3'" sing N N 81 DA "C4'" "H4'" sing N N 82 DA "O4'" "C1'" sing N N 83 DA "C3'" "O3'" sing N N 84 DA "C3'" "C2'" sing N N 85 DA "C3'" "H3'" sing N N 86 DA "O3'" "HO3'" sing N N 87 DA "C2'" "C1'" sing N N 88 DA "C2'" "H2'" sing N N 89 DA "C2'" "H2''" sing N N 90 DA "C1'" N9 sing N N 91 DA "C1'" "H1'" sing N N 92 DA N9 C8 sing Y N 93 DA N9 C4 sing Y N 94 DA C8 N7 doub Y N 95 DA C8 H8 sing N N 96 DA N7 C5 sing Y N 97 DA C5 C6 sing Y N 98 DA C5 C4 doub Y N 99 DA C6 N6 sing N N 100 DA C6 N1 doub Y N 101 DA N6 H61 sing N N 102 DA N6 H62 sing N N 103 DA N1 C2 sing Y N 104 DA C2 N3 doub Y N 105 DA C2 H2 sing N N 106 DA N3 C4 sing Y N 107 DC OP3 P sing N N 108 DC OP3 HOP3 sing N N 109 DC P OP1 doub N N 110 DC P OP2 sing N N 111 DC P "O5'" sing N N 112 DC OP2 HOP2 sing N N 113 DC "O5'" "C5'" sing N N 114 DC "C5'" "C4'" sing N N 115 DC "C5'" "H5'" sing N N 116 DC "C5'" "H5''" sing N N 117 DC "C4'" "O4'" sing N N 118 DC "C4'" "C3'" sing N N 119 DC "C4'" "H4'" sing N N 120 DC "O4'" "C1'" sing N N 121 DC "C3'" "O3'" sing N N 122 DC "C3'" "C2'" sing N N 123 DC "C3'" "H3'" sing N N 124 DC "O3'" "HO3'" sing N N 125 DC "C2'" "C1'" sing N N 126 DC "C2'" "H2'" sing N N 127 DC "C2'" "H2''" sing N N 128 DC "C1'" N1 sing N N 129 DC "C1'" "H1'" sing N N 130 DC N1 C2 sing N N 131 DC N1 C6 sing N N 132 DC C2 O2 doub N N 133 DC C2 N3 sing N N 134 DC N3 C4 doub N N 135 DC C4 N4 sing N N 136 DC C4 C5 sing N N 137 DC N4 H41 sing N N 138 DC N4 H42 sing N N 139 DC C5 C6 doub N N 140 DC C5 H5 sing N N 141 DC C6 H6 sing N N 142 DG OP3 P sing N N 143 DG OP3 HOP3 sing N N 144 DG P OP1 doub N N 145 DG P OP2 sing N N 146 DG P "O5'" sing N N 147 DG OP2 HOP2 sing N N 148 DG "O5'" "C5'" sing N N 149 DG "C5'" "C4'" sing N N 150 DG "C5'" "H5'" sing N N 151 DG "C5'" "H5''" sing N N 152 DG "C4'" "O4'" sing N N 153 DG "C4'" "C3'" sing N N 154 DG "C4'" "H4'" sing N N 155 DG "O4'" "C1'" sing N N 156 DG "C3'" "O3'" sing N N 157 DG "C3'" "C2'" sing N N 158 DG "C3'" "H3'" sing N N 159 DG "O3'" "HO3'" sing N N 160 DG "C2'" "C1'" sing N N 161 DG "C2'" "H2'" sing N N 162 DG "C2'" "H2''" sing N N 163 DG "C1'" N9 sing N N 164 DG "C1'" "H1'" sing N N 165 DG N9 C8 sing Y N 166 DG N9 C4 sing Y N 167 DG C8 N7 doub Y N 168 DG C8 H8 sing N N 169 DG N7 C5 sing Y N 170 DG C5 C6 sing N N 171 DG C5 C4 doub Y N 172 DG C6 O6 doub N N 173 DG C6 N1 sing N N 174 DG N1 C2 sing N N 175 DG N1 H1 sing N N 176 DG C2 N2 sing N N 177 DG C2 N3 doub N N 178 DG N2 H21 sing N N 179 DG N2 H22 sing N N 180 DG N3 C4 sing N N 181 DT OP3 P sing N N 182 DT OP3 HOP3 sing N N 183 DT P OP1 doub N N 184 DT P OP2 sing N N 185 DT P "O5'" sing N N 186 DT OP2 HOP2 sing N N 187 DT "O5'" "C5'" sing N N 188 DT "C5'" "C4'" sing N N 189 DT "C5'" "H5'" sing N N 190 DT "C5'" "H5''" sing N N 191 DT "C4'" "O4'" sing N N 192 DT "C4'" "C3'" sing N N 193 DT "C4'" "H4'" sing N N 194 DT "O4'" "C1'" sing N N 195 DT "C3'" "O3'" sing N N 196 DT "C3'" "C2'" sing N N 197 DT "C3'" "H3'" sing N N 198 DT "O3'" "HO3'" sing N N 199 DT "C2'" "C1'" sing N N 200 DT "C2'" "H2'" sing N N 201 DT "C2'" "H2''" sing N N 202 DT "C1'" N1 sing N N 203 DT "C1'" "H1'" sing N N 204 DT N1 C2 sing N N 205 DT N1 C6 sing N N 206 DT C2 O2 doub N N 207 DT C2 N3 sing N N 208 DT N3 C4 sing N N 209 DT N3 H3 sing N N 210 DT C4 O4 doub N N 211 DT C4 C5 sing N N 212 DT C5 C7 sing N N 213 DT C5 C6 doub N N 214 DT C7 H71 sing N N 215 DT C7 H72 sing N N 216 DT C7 H73 sing N N 217 DT C6 H6 sing N N 218 GLN N CA sing N N 219 GLN N H sing N N 220 GLN N H2 sing N N 221 GLN CA C sing N N 222 GLN CA CB sing N N 223 GLN CA HA sing N N 224 GLN C O doub N N 225 GLN C OXT sing N N 226 GLN CB CG sing N N 227 GLN CB HB2 sing N N 228 GLN CB HB3 sing N N 229 GLN CG CD sing N N 230 GLN CG HG2 sing N N 231 GLN CG HG3 sing N N 232 GLN CD OE1 doub N N 233 GLN CD NE2 sing N N 234 GLN NE2 HE21 sing N N 235 GLN NE2 HE22 sing N N 236 GLN OXT HXT sing N N 237 GLU N CA sing N N 238 GLU N H sing N N 239 GLU N H2 sing N N 240 GLU CA C sing N N 241 GLU CA CB sing N N 242 GLU CA HA sing N N 243 GLU C O doub N N 244 GLU C OXT sing N N 245 GLU CB CG sing N N 246 GLU CB HB2 sing N N 247 GLU CB HB3 sing N N 248 GLU CG CD sing N N 249 GLU CG HG2 sing N N 250 GLU CG HG3 sing N N 251 GLU CD OE1 doub N N 252 GLU CD OE2 sing N N 253 GLU OE2 HE2 sing N N 254 GLU OXT HXT sing N N 255 GLY N CA sing N N 256 GLY N H sing N N 257 GLY N H2 sing N N 258 GLY CA C sing N N 259 GLY CA HA2 sing N N 260 GLY CA HA3 sing N N 261 GLY C O doub N N 262 GLY C OXT sing N N 263 GLY OXT HXT sing N N 264 HIS N CA sing N N 265 HIS N H sing N N 266 HIS N H2 sing N N 267 HIS CA C sing N N 268 HIS CA CB sing N N 269 HIS CA HA sing N N 270 HIS C O doub N N 271 HIS C OXT sing N N 272 HIS CB CG sing N N 273 HIS CB HB2 sing N N 274 HIS CB HB3 sing N N 275 HIS CG ND1 sing Y N 276 HIS CG CD2 doub Y N 277 HIS ND1 CE1 doub Y N 278 HIS ND1 HD1 sing N N 279 HIS CD2 NE2 sing Y N 280 HIS CD2 HD2 sing N N 281 HIS CE1 NE2 sing Y N 282 HIS CE1 HE1 sing N N 283 HIS NE2 HE2 sing N N 284 HIS OXT HXT sing N N 285 ILE N CA sing N N 286 ILE N H sing N N 287 ILE N H2 sing N N 288 ILE CA C sing N N 289 ILE CA CB sing N N 290 ILE CA HA sing N N 291 ILE C O doub N N 292 ILE C OXT sing N N 293 ILE CB CG1 sing N N 294 ILE CB CG2 sing N N 295 ILE CB HB sing N N 296 ILE CG1 CD1 sing N N 297 ILE CG1 HG12 sing N N 298 ILE CG1 HG13 sing N N 299 ILE CG2 HG21 sing N N 300 ILE CG2 HG22 sing N N 301 ILE CG2 HG23 sing N N 302 ILE CD1 HD11 sing N N 303 ILE CD1 HD12 sing N N 304 ILE CD1 HD13 sing N N 305 ILE OXT HXT sing N N 306 LEU N CA sing N N 307 LEU N H sing N N 308 LEU N H2 sing N N 309 LEU CA C sing N N 310 LEU CA CB sing N N 311 LEU CA HA sing N N 312 LEU C O doub N N 313 LEU C OXT sing N N 314 LEU CB CG sing N N 315 LEU CB HB2 sing N N 316 LEU CB HB3 sing N N 317 LEU CG CD1 sing N N 318 LEU CG CD2 sing N N 319 LEU CG HG sing N N 320 LEU CD1 HD11 sing N N 321 LEU CD1 HD12 sing N N 322 LEU CD1 HD13 sing N N 323 LEU CD2 HD21 sing N N 324 LEU CD2 HD22 sing N N 325 LEU CD2 HD23 sing N N 326 LEU OXT HXT sing N N 327 LYS N CA sing N N 328 LYS N H sing N N 329 LYS N H2 sing N N 330 LYS CA C sing N N 331 LYS CA CB sing N N 332 LYS CA HA sing N N 333 LYS C O doub N N 334 LYS C OXT sing N N 335 LYS CB CG sing N N 336 LYS CB HB2 sing N N 337 LYS CB HB3 sing N N 338 LYS CG CD sing N N 339 LYS CG HG2 sing N N 340 LYS CG HG3 sing N N 341 LYS CD CE sing N N 342 LYS CD HD2 sing N N 343 LYS CD HD3 sing N N 344 LYS CE NZ sing N N 345 LYS CE HE2 sing N N 346 LYS CE HE3 sing N N 347 LYS NZ HZ1 sing N N 348 LYS NZ HZ2 sing N N 349 LYS NZ HZ3 sing N N 350 LYS OXT HXT sing N N 351 MET N CA sing N N 352 MET N H sing N N 353 MET N H2 sing N N 354 MET CA C sing N N 355 MET CA CB sing N N 356 MET CA HA sing N N 357 MET C O doub N N 358 MET C OXT sing N N 359 MET CB CG sing N N 360 MET CB HB2 sing N N 361 MET CB HB3 sing N N 362 MET CG SD sing N N 363 MET CG HG2 sing N N 364 MET CG HG3 sing N N 365 MET SD CE sing N N 366 MET CE HE1 sing N N 367 MET CE HE2 sing N N 368 MET CE HE3 sing N N 369 MET OXT HXT sing N N 370 PHE N CA sing N N 371 PHE N H sing N N 372 PHE N H2 sing N N 373 PHE CA C sing N N 374 PHE CA CB sing N N 375 PHE CA HA sing N N 376 PHE C O doub N N 377 PHE C OXT sing N N 378 PHE CB CG sing N N 379 PHE CB HB2 sing N N 380 PHE CB HB3 sing N N 381 PHE CG CD1 doub Y N 382 PHE CG CD2 sing Y N 383 PHE CD1 CE1 sing Y N 384 PHE CD1 HD1 sing N N 385 PHE CD2 CE2 doub Y N 386 PHE CD2 HD2 sing N N 387 PHE CE1 CZ doub Y N 388 PHE CE1 HE1 sing N N 389 PHE CE2 CZ sing Y N 390 PHE CE2 HE2 sing N N 391 PHE CZ HZ sing N N 392 PHE OXT HXT sing N N 393 PRO N CA sing N N 394 PRO N CD sing N N 395 PRO N H sing N N 396 PRO CA C sing N N 397 PRO CA CB sing N N 398 PRO CA HA sing N N 399 PRO C O doub N N 400 PRO C OXT sing N N 401 PRO CB CG sing N N 402 PRO CB HB2 sing N N 403 PRO CB HB3 sing N N 404 PRO CG CD sing N N 405 PRO CG HG2 sing N N 406 PRO CG HG3 sing N N 407 PRO CD HD2 sing N N 408 PRO CD HD3 sing N N 409 PRO OXT HXT sing N N 410 SER N CA sing N N 411 SER N H sing N N 412 SER N H2 sing N N 413 SER CA C sing N N 414 SER CA CB sing N N 415 SER CA HA sing N N 416 SER C O doub N N 417 SER C OXT sing N N 418 SER CB OG sing N N 419 SER CB HB2 sing N N 420 SER CB HB3 sing N N 421 SER OG HG sing N N 422 SER OXT HXT sing N N 423 THR N CA sing N N 424 THR N H sing N N 425 THR N H2 sing N N 426 THR CA C sing N N 427 THR CA CB sing N N 428 THR CA HA sing N N 429 THR C O doub N N 430 THR C OXT sing N N 431 THR CB OG1 sing N N 432 THR CB CG2 sing N N 433 THR CB HB sing N N 434 THR OG1 HG1 sing N N 435 THR CG2 HG21 sing N N 436 THR CG2 HG22 sing N N 437 THR CG2 HG23 sing N N 438 THR OXT HXT sing N N 439 TRP N CA sing N N 440 TRP N H sing N N 441 TRP N H2 sing N N 442 TRP CA C sing N N 443 TRP CA CB sing N N 444 TRP CA HA sing N N 445 TRP C O doub N N 446 TRP C OXT sing N N 447 TRP CB CG sing N N 448 TRP CB HB2 sing N N 449 TRP CB HB3 sing N N 450 TRP CG CD1 doub Y N 451 TRP CG CD2 sing Y N 452 TRP CD1 NE1 sing Y N 453 TRP CD1 HD1 sing N N 454 TRP CD2 CE2 doub Y N 455 TRP CD2 CE3 sing Y N 456 TRP NE1 CE2 sing Y N 457 TRP NE1 HE1 sing N N 458 TRP CE2 CZ2 sing Y N 459 TRP CE3 CZ3 doub Y N 460 TRP CE3 HE3 sing N N 461 TRP CZ2 CH2 doub Y N 462 TRP CZ2 HZ2 sing N N 463 TRP CZ3 CH2 sing Y N 464 TRP CZ3 HZ3 sing N N 465 TRP CH2 HH2 sing N N 466 TRP OXT HXT sing N N 467 TYR N CA sing N N 468 TYR N H sing N N 469 TYR N H2 sing N N 470 TYR CA C sing N N 471 TYR CA CB sing N N 472 TYR CA HA sing N N 473 TYR C O doub N N 474 TYR C OXT sing N N 475 TYR CB CG sing N N 476 TYR CB HB2 sing N N 477 TYR CB HB3 sing N N 478 TYR CG CD1 doub Y N 479 TYR CG CD2 sing Y N 480 TYR CD1 CE1 sing Y N 481 TYR CD1 HD1 sing N N 482 TYR CD2 CE2 doub Y N 483 TYR CD2 HD2 sing N N 484 TYR CE1 CZ doub Y N 485 TYR CE1 HE1 sing N N 486 TYR CE2 CZ sing Y N 487 TYR CE2 HE2 sing N N 488 TYR CZ OH sing N N 489 TYR OH HH sing N N 490 TYR OXT HXT sing N N 491 VAL N CA sing N N 492 VAL N H sing N N 493 VAL N H2 sing N N 494 VAL CA C sing N N 495 VAL CA CB sing N N 496 VAL CA HA sing N N 497 VAL C O doub N N 498 VAL C OXT sing N N 499 VAL CB CG1 sing N N 500 VAL CB CG2 sing N N 501 VAL CB HB sing N N 502 VAL CG1 HG11 sing N N 503 VAL CG1 HG12 sing N N 504 VAL CG1 HG13 sing N N 505 VAL CG2 HG21 sing N N 506 VAL CG2 HG22 sing N N 507 VAL CG2 HG23 sing N N 508 VAL OXT HXT sing N N 509 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 6RYL 'double helix' 6RYL 'b-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 F DC 1 1_555 G DG 16 1_555 -0.022 -0.454 -0.316 -4.791 4.665 2.951 1 F_DC1:DG16_G F 1 ? G 16 ? 19 1 1 F DA 2 1_555 G DT 15 1_555 -0.707 0.051 0.733 5.214 -8.286 14.537 2 F_DA2:DT15_G F 2 ? G 15 ? 20 1 1 F DC 3 1_555 G DG 14 1_555 -0.338 2.923 0.936 -13.335 -4.063 -83.751 3 F_DC3:DG14_G F 3 ? G 14 ? ? ? 1 F DA 4 1_555 G DT 13 1_555 0.167 -0.156 -0.309 5.204 -24.089 4.967 4 F_DA4:DT13_G F 4 ? G 13 ? 20 1 1 F DA 5 1_555 G DT 12 1_555 0.268 -0.167 0.453 -1.383 -2.806 9.243 5 F_DA5:DT12_G F 5 ? G 12 ? 20 1 1 F DC 6 1_555 G DG 11 1_555 -0.428 0.070 0.270 2.197 6.417 1.287 6 F_DC6:DG11_G F 6 ? G 11 ? 19 1 1 F DC 7 1_555 G DG 10 1_555 -0.171 -0.290 -0.223 4.530 -6.772 -7.207 7 F_DC7:DG10_G F 7 ? G 10 ? 19 1 1 F DC 8 1_555 G DG 9 1_555 -0.369 -0.417 -0.425 7.519 -16.189 5.266 8 F_DC8:DG9_G F 8 ? G 9 ? 19 1 1 F DA 9 1_555 G DT 8 1_555 0.525 -0.132 -0.254 4.073 -3.027 -3.307 9 F_DA9:DT8_G F 9 ? G 8 ? 20 1 1 F DT 10 1_555 G DA 7 1_555 -0.336 -0.485 0.561 -6.238 -18.570 0.219 10 F_DT10:DA7_G F 10 ? G 7 ? 20 1 1 F DT 11 1_555 G DA 6 1_555 0.267 0.005 -0.022 16.747 -10.218 16.234 11 F_DT11:DA6_G F 11 ? G 6 ? 20 1 1 F DA 12 1_555 G DT 5 1_555 0.281 -0.080 0.238 2.667 -44.016 6.930 12 F_DA12:DT5_G F 12 ? G 5 ? 20 1 1 F DA 13 1_555 G DT 4 1_555 0.234 0.148 0.528 5.736 -11.500 9.808 13 F_DA13:DT4_G F 13 ? G 4 ? 20 1 1 F DC 14 1_555 G DG 3 1_555 0.290 -0.111 -0.252 19.109 -10.008 1.599 14 F_DC14:DG3_G F 14 ? G 3 ? 19 1 1 F DA 15 1_555 G DT 2 1_555 -0.213 -0.408 -0.254 -0.658 -10.849 -2.186 15 F_DA15:DT2_G F 15 ? G 2 ? 20 1 1 F DC 16 1_555 G DG 1 1_555 -0.054 -0.154 -0.243 -1.367 -14.776 -4.409 16 F_DC16:DG1_G F 16 ? G 1 ? 19 1 1 H DC 1 1_555 I DG 16 1_555 0.282 -0.381 0.193 1.267 -5.171 -8.504 17 H_DC1:DG16_I H 1 ? I 16 ? 19 1 1 H DA 2 1_555 I DT 15 1_555 0.138 -0.417 0.048 -12.474 -23.726 -0.358 18 H_DA2:DT15_I H 2 ? I 15 ? 20 1 1 H DC 3 1_555 I DG 14 1_555 0.036 -0.130 -0.056 13.135 -20.376 9.517 19 H_DC3:DG14_I H 3 ? I 14 ? 19 1 1 H DA 4 1_555 I DT 13 1_555 0.542 -0.272 -0.288 9.652 -14.914 -3.529 20 H_DA4:DT13_I H 4 ? I 13 ? 20 1 1 H DA 5 1_555 I DT 12 1_555 0.326 -0.397 0.523 8.345 -25.951 7.843 21 H_DA5:DT12_I H 5 ? I 12 ? 20 1 1 H DC 6 1_555 I DG 11 1_555 -0.212 0.282 -0.871 22.522 -25.111 -2.679 22 H_DC6:DG11_I H 6 ? I 11 ? 19 1 1 H DC 7 1_555 I DG 10 1_555 0.493 -0.695 0.465 -6.485 -21.047 1.099 23 H_DC7:DG10_I H 7 ? I 10 ? 19 1 1 H DC 8 1_555 I DG 9 1_555 0.151 -0.573 0.145 4.232 3.254 3.115 24 H_DC8:DG9_I H 8 ? I 9 ? 19 1 1 H DA 9 1_555 I DT 8 1_555 0.443 -0.044 -0.003 5.687 -21.462 -2.300 25 H_DA9:DT8_I H 9 ? I 8 ? 20 1 1 H DT 10 1_555 I DA 7 1_555 -0.593 -0.029 -0.310 20.212 -16.697 2.996 26 H_DT10:DA7_I H 10 ? I 7 ? 20 1 1 H DT 11 1_555 I DA 6 1_555 -0.540 -0.171 -0.270 9.149 -19.756 0.310 27 H_DT11:DA6_I H 11 ? I 6 ? 20 1 1 H DA 12 1_555 I DT 5 1_555 0.196 -0.128 0.043 6.767 2.417 9.503 28 H_DA12:DT5_I H 12 ? I 5 ? 20 1 1 H DA 13 1_555 I DT 4 1_555 0.267 -0.406 0.013 6.640 -14.738 -0.658 29 H_DA13:DT4_I H 13 ? I 4 ? 20 1 1 H DC 14 1_555 I DG 3 1_555 -0.006 -0.533 -0.034 10.584 -17.426 -3.506 30 H_DC14:DG3_I H 14 ? I 3 ? 19 1 1 H DA 15 1_555 I DT 2 1_555 0.539 -0.375 0.456 -5.145 -17.530 -0.340 31 H_DA15:DT2_I H 15 ? I 2 ? 20 1 1 H DC 16 1_555 I DG 1 1_555 0.566 -0.373 0.355 -3.072 -3.909 -2.614 32 H_DC16:DG1_I H 16 ? I 1 ? 19 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 F DC 1 1_555 G DG 16 1_555 F DA 2 1_555 G DT 15 1_555 0.014 -0.509 2.877 -6.615 4.574 33.137 -1.502 -0.939 2.732 7.877 11.391 34.072 1 FF_DC1DA2:DT15DG16_GG F 1 ? G 16 ? F 2 ? G 15 ? 1 F DA 2 1_555 G DT 15 1_555 F DC 3 1_555 G DG 14 1_555 0.395 -2.007 3.289 3.334 7.320 81.525 -1.714 -0.219 3.143 5.594 -2.547 81.852 2 FF_DA2DC3:DG14DT15_GG F 2 ? G 15 ? F 3 ? G 14 ? 1 F DC 3 1_555 G DG 14 1_555 F DA 4 1_555 G DT 13 1_555 -0.107 2.354 3.075 9.669 -2.529 -9.449 -7.248 9.449 2.624 11.818 45.191 -13.746 3 FF_DC3DA4:DT13DG14_GG F 3 ? G 14 ? F 4 ? G 13 ? 1 F DA 4 1_555 G DT 13 1_555 F DA 5 1_555 G DT 12 1_555 0.582 -0.382 3.193 -8.272 8.203 34.794 -1.672 -2.001 2.827 13.265 13.378 36.635 4 FF_DA4DA5:DT12DT13_GG F 4 ? G 13 ? F 5 ? G 12 ? 1 F DA 5 1_555 G DT 12 1_555 F DC 6 1_555 G DG 11 1_555 -0.093 -1.096 3.252 0.082 6.254 23.932 -4.371 0.241 2.876 14.762 -0.193 24.724 5 FF_DA5DC6:DG11DT12_GG F 5 ? G 12 ? F 6 ? G 11 ? 1 F DC 6 1_555 G DG 11 1_555 F DC 7 1_555 G DG 10 1_555 -0.872 -0.354 3.303 2.405 -10.841 35.055 0.948 1.719 3.204 -17.464 -3.874 36.719 6 FF_DC6DC7:DG10DG11_GG F 6 ? G 11 ? F 7 ? G 10 ? 1 F DC 7 1_555 G DG 10 1_555 F DC 8 1_555 G DG 9 1_555 0.908 0.139 3.264 8.443 0.707 36.543 0.121 -0.274 3.385 1.109 -13.247 37.480 7 FF_DC7DC8:DG9DG10_GG F 7 ? G 10 ? F 8 ? G 9 ? 1 F DC 8 1_555 G DG 9 1_555 F DA 9 1_555 G DT 8 1_555 -1.140 -0.189 3.434 -4.807 17.535 38.225 -2.186 1.056 3.174 25.118 6.886 42.183 8 FF_DC8DA9:DT8DG9_GG F 8 ? G 9 ? F 9 ? G 8 ? 1 F DA 9 1_555 G DT 8 1_555 F DT 10 1_555 G DA 7 1_555 0.506 -0.809 3.598 -7.602 -3.582 29.563 -0.756 -2.594 3.437 -6.848 14.531 30.709 9 FF_DA9DT10:DA7DT8_GG F 9 ? G 8 ? F 10 ? G 7 ? 1 F DT 10 1_555 G DA 7 1_555 F DT 11 1_555 G DA 6 1_555 0.325 -0.678 2.793 1.421 -0.406 28.008 -1.316 -0.382 2.815 -0.838 -2.934 28.047 10 FF_DT10DT11:DA6DA7_GG F 10 ? G 7 ? F 11 ? G 6 ? 1 F DT 11 1_555 G DA 6 1_555 F DA 12 1_555 G DT 5 1_555 -1.243 1.444 3.807 0.004 -3.353 45.321 2.209 1.610 3.697 -4.345 -0.006 45.438 11 FF_DT11DA12:DT5DA6_GG F 11 ? G 6 ? F 12 ? G 5 ? 1 F DA 12 1_555 G DT 5 1_555 F DA 13 1_555 G DT 4 1_555 0.963 0.635 3.230 -1.424 -7.521 40.569 1.684 -1.515 3.036 -10.732 2.032 41.255 12 FF_DA12DA13:DT4DT5_GG F 12 ? G 5 ? F 13 ? G 4 ? 1 F DA 13 1_555 G DT 4 1_555 F DC 14 1_555 G DG 3 1_555 -0.074 -0.282 2.979 4.705 1.869 26.884 -1.017 1.214 2.898 3.975 -10.007 27.348 13 FF_DA13DC14:DG3DT4_GG F 13 ? G 4 ? F 14 ? G 3 ? 1 F DC 14 1_555 G DG 3 1_555 F DA 15 1_555 G DT 2 1_555 -0.586 -0.168 3.662 -4.721 8.327 38.499 -1.345 0.243 3.595 12.396 7.028 39.627 14 FF_DC14DA15:DT2DG3_GG F 14 ? G 3 ? F 15 ? G 2 ? 1 F DA 15 1_555 G DT 2 1_555 F DC 16 1_555 G DG 1 1_555 0.095 -0.877 3.382 2.206 -1.753 35.416 -1.171 0.180 3.419 -2.877 -3.618 35.524 15 FF_DA15DC16:DG1DT2_GG F 15 ? G 2 ? F 16 ? G 1 ? 1 H DC 1 1_555 I DG 16 1_555 H DA 2 1_555 I DT 15 1_555 -0.048 -0.166 3.629 2.115 1.366 41.842 -0.390 0.311 3.615 1.910 -2.958 41.914 16 HH_DC1DA2:DT15DG16_II H 1 ? I 16 ? H 2 ? I 15 ? 1 H DA 2 1_555 I DT 15 1_555 H DC 3 1_555 I DG 14 1_555 1.143 -0.608 2.599 5.040 0.920 28.195 -1.400 -1.374 2.737 1.870 -10.238 28.647 17 HH_DA2DC3:DG14DT15_II H 2 ? I 15 ? H 3 ? I 14 ? 1 H DC 3 1_555 I DG 14 1_555 H DA 4 1_555 I DT 13 1_555 -1.029 0.835 3.509 2.676 11.227 40.276 -0.123 1.749 3.535 15.913 -3.793 41.830 18 HH_DC3DA4:DT13DG14_II H 3 ? I 14 ? H 4 ? I 13 ? 1 H DA 4 1_555 I DT 13 1_555 H DA 5 1_555 I DT 12 1_555 1.416 -0.213 3.256 -3.890 -7.976 35.641 0.733 -2.771 3.065 -12.789 6.237 36.694 19 HH_DA4DA5:DT12DT13_II H 4 ? I 13 ? H 5 ? I 12 ? 1 H DA 5 1_555 I DT 12 1_555 H DC 6 1_555 I DG 11 1_555 0.048 -0.190 2.898 12.538 5.122 25.832 -1.373 2.338 2.565 10.581 -25.901 29.114 20 HH_DA5DC6:DG11DT12_II H 5 ? I 12 ? H 6 ? I 11 ? 1 H DC 6 1_555 I DG 11 1_555 H DC 7 1_555 I DG 10 1_555 0.367 -0.250 4.173 -4.837 1.851 40.354 -0.620 -1.208 4.089 2.670 6.976 40.671 21 HH_DC6DC7:DG10DG11_II H 6 ? I 11 ? H 7 ? I 10 ? 1 H DC 7 1_555 I DG 10 1_555 H DC 8 1_555 I DG 9 1_555 0.922 0.280 3.036 4.749 5.465 33.830 -0.335 -0.851 3.139 9.261 -8.048 34.574 22 HH_DC7DC8:DG9DG10_II H 7 ? I 10 ? H 8 ? I 9 ? 1 H DC 8 1_555 I DG 9 1_555 H DA 9 1_555 I DT 8 1_555 -0.599 1.123 3.378 2.199 -3.284 40.186 2.002 1.118 3.244 -4.766 -3.191 40.372 23 HH_DC8DA9:DT8DG9_II H 8 ? I 9 ? H 9 ? I 8 ? 1 H DA 9 1_555 I DT 8 1_555 H DT 10 1_555 I DA 7 1_555 0.925 -0.651 2.834 1.850 4.808 25.795 -2.540 -1.608 2.728 10.635 -4.091 26.295 24 HH_DA9DT10:DA7DT8_II H 9 ? I 8 ? H 10 ? I 7 ? 1 H DT 10 1_555 I DA 7 1_555 H DT 11 1_555 I DA 6 1_555 -0.540 0.050 3.541 3.159 10.068 37.460 -1.248 1.227 3.388 15.309 -4.804 38.866 25 HH_DT10DT11:DA6DA7_II H 10 ? I 7 ? H 11 ? I 6 ? 1 H DT 11 1_555 I DA 6 1_555 H DA 12 1_555 I DT 5 1_555 0.973 1.420 3.529 -3.157 -4.434 45.935 2.205 -1.521 3.316 -5.658 4.029 46.239 26 HH_DT11DA12:DT5DA6_II H 11 ? I 6 ? H 12 ? I 5 ? 1 H DA 12 1_555 I DT 5 1_555 H DA 13 1_555 I DT 4 1_555 -1.236 0.803 3.444 -2.393 -3.514 37.152 1.741 1.597 3.426 -5.493 3.741 37.386 27 HH_DA12DA13:DT4DT5_II H 12 ? I 5 ? H 13 ? I 4 ? 1 H DA 13 1_555 I DT 4 1_555 H DC 14 1_555 I DG 3 1_555 0.135 -0.199 3.132 1.003 1.541 28.632 -0.734 -0.057 3.120 3.112 -2.025 28.690 28 HH_DA13DC14:DG3DT4_II H 13 ? I 4 ? H 14 ? I 3 ? 1 H DC 14 1_555 I DG 3 1_555 H DA 15 1_555 I DT 2 1_555 0.109 0.401 3.757 -3.783 4.990 43.281 -0.013 -0.564 3.756 6.724 5.097 43.710 29 HH_DC14DA15:DT2DG3_II H 14 ? I 3 ? H 15 ? I 2 ? 1 H DA 15 1_555 I DT 2 1_555 H DC 16 1_555 I DG 1 1_555 0.513 -0.756 3.358 -0.337 -0.487 33.787 -1.220 -0.939 3.364 -0.837 0.580 33.792 30 HH_DA15DC16:DG1DT2_II H 15 ? I 2 ? H 16 ? I 1 ? # _pdbx_audit_support.funding_organization 'German Research Foundation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6RY3 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6RYL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012097 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002767 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021780 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011719 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P # loop_