data_6SFT # _entry.id 6SFT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6SFT pdb_00006sft 10.2210/pdb6sft/pdb WWPDB D_1292103582 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-10 2 'Structure model' 1 1 2021-01-13 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6SFT _pdbx_database_status.recvd_initial_deposition_date 2019-08-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'apo ARR_CleD assignments' 27990 unspecified BMRB 'Solution structure of protein ARR_CleD in complex with c-di-GMP' 50001 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Habazettl, J.' 1 ? 'Hee, C.S.' 2 ? 'Jenal, U.' 3 ? 'Schirmer, T.' 4 ? 'Grzesiek, S.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 17211 _citation.page_last 17220 _citation.title 'Intercepting second-messenger signaling by rationally designed peptides sequestering c-di-GMP.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2001232117 _citation.pdbx_database_id_PubMed 32611811 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hee, C.S.' 1 0000-0002-7697-312X primary 'Habazettl, J.' 2 0000-0002-7976-768X primary 'Schmutz, C.' 3 ? primary 'Schirmer, T.' 4 0000-0001-9512-8346 primary 'Jenal, U.' 5 0000-0002-1637-3376 primary 'Grzesiek, S.' 6 0000-0003-1998-4225 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Two-component receiver protein CleD' 4174.684 1 ? ? ? 'ARR_CleD is the arginine rich region of CleD, ranging from K140 to S174. It binds intercalated dimeric c-di-GMP' 2 non-polymer syn ;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) ; 690.411 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SKPREWVEAVAYVGPDRRRFNSADYKGPRKRKADAS _entity_poly.pdbx_seq_one_letter_code_can SKPREWVEAVAYVGPDRRRFNSADYKGPRKRKADAS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) ; _pdbx_entity_nonpoly.comp_id C2E # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 PRO n 1 4 ARG n 1 5 GLU n 1 6 TRP n 1 7 VAL n 1 8 GLU n 1 9 ALA n 1 10 VAL n 1 11 ALA n 1 12 TYR n 1 13 VAL n 1 14 GLY n 1 15 PRO n 1 16 ASP n 1 17 ARG n 1 18 ARG n 1 19 ARG n 1 20 PHE n 1 21 ASN n 1 22 SER n 1 23 ALA n 1 24 ASP n 1 25 TYR n 1 26 LYS n 1 27 GLY n 1 28 PRO n 1 29 ARG n 1 30 LYS n 1 31 ARG n 1 32 LYS n 1 33 ALA n 1 34 ASP n 1 35 ALA n 1 36 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 36 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cleD, CCNA_03198' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'NA1000 / CB15N' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caulobacter vibrioides (strain NA1000 / CB15N)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 565050 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 19089 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details pET28a-His-SUMO-ARR_CleD _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C2E non-polymer . ;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) ; 'c-di-GMP; Cyclic diguanosine monophosphate' 'C20 H24 N10 O14 P2' 690.411 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 139 139 SER SER A . n A 1 2 LYS 2 140 140 LYS LYS A . n A 1 3 PRO 3 141 141 PRO PRO A . n A 1 4 ARG 4 142 142 ARG ARG A . n A 1 5 GLU 5 143 143 GLU GLU A . n A 1 6 TRP 6 144 144 TRP TRP A . n A 1 7 VAL 7 145 145 VAL VAL A . n A 1 8 GLU 8 146 146 GLU GLU A . n A 1 9 ALA 9 147 147 ALA ALA A . n A 1 10 VAL 10 148 148 VAL VAL A . n A 1 11 ALA 11 149 149 ALA ALA A . n A 1 12 TYR 12 150 150 TYR TYR A . n A 1 13 VAL 13 151 151 VAL VAL A . n A 1 14 GLY 14 152 152 GLY GLY A . n A 1 15 PRO 15 153 153 PRO PRO A . n A 1 16 ASP 16 154 154 ASP ASP A . n A 1 17 ARG 17 155 155 ARG ARG A . n A 1 18 ARG 18 156 156 ARG ARG A . n A 1 19 ARG 19 157 157 ARG ARG A . n A 1 20 PHE 20 158 158 PHE PHE A . n A 1 21 ASN 21 159 159 ASN ASN A . n A 1 22 SER 22 160 160 SER SER A . n A 1 23 ALA 23 161 161 ALA ALA A . n A 1 24 ASP 24 162 162 ASP ASP A . n A 1 25 TYR 25 163 163 TYR TYR A . n A 1 26 LYS 26 164 164 LYS LYS A . n A 1 27 GLY 27 165 165 GLY GLY A . n A 1 28 PRO 28 166 166 PRO PRO A . n A 1 29 ARG 29 167 167 ARG ARG A . n A 1 30 LYS 30 168 168 LYS LYS A . n A 1 31 ARG 31 169 169 ARG ARG A . n A 1 32 LYS 32 170 170 LYS LYS A . n A 1 33 ALA 33 171 171 ALA ALA A . n A 1 34 ASP 34 172 172 ASP ASP A . n A 1 35 ALA 35 173 173 ALA ALA A . n A 1 36 SER 36 174 174 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 C2E 1 501 501 C2E C2E A . C 2 C2E 1 502 502 C2E C2E A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6SFT _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6SFT _struct.title 'Solution structure of protein ARR_CleD in complex with c-di-GMP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6SFT _struct_keywords.text 'c-di-GMP, CleD, CheY, Response Regulator, Signaling protein' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0H3CCM2_CAUVN _struct_ref.pdbx_db_accession A0A0H3CCM2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KPREWVEAVAYVGPDRRRFNSADYKGPRKRKADAS _struct_ref.pdbx_align_begin 140 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6SFT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0H3CCM2 _struct_ref_seq.db_align_beg 140 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 140 _struct_ref_seq.pdbx_auth_seq_align_end 174 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6SFT _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A0H3CCM2 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 139 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2010 ? 1 MORE 9 ? 1 'SSA (A^2)' 4020 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details 'dissociation constant K_D - 110 nM' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 35 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 169 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 173 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 7 ? GLU A 8 ? VAL A 145 GLU A 146 AA1 2 VAL A 13 ? GLY A 14 ? VAL A 151 GLY A 152 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 7 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 145 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 14 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 152 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A C2E 501 ? 8 'binding site for residue C2E A 501' AC2 Software A C2E 502 ? 7 'binding site for residue C2E A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 12 ? TYR A 150 . ? 1_555 ? 2 AC1 8 ASP A 16 ? ASP A 154 . ? 1_555 ? 3 AC1 8 ARG A 17 ? ARG A 155 . ? 1_555 ? 4 AC1 8 ARG A 18 ? ARG A 156 . ? 1_555 ? 5 AC1 8 LYS A 30 ? LYS A 168 . ? 1_555 ? 6 AC1 8 ARG A 31 ? ARG A 169 . ? 1_555 ? 7 AC1 8 LYS A 32 ? LYS A 170 . ? 1_555 ? 8 AC1 8 C2E C . ? C2E A 502 . ? 1_555 ? 9 AC2 7 ARG A 17 ? ARG A 155 . ? 1_555 ? 10 AC2 7 ARG A 18 ? ARG A 156 . ? 1_555 ? 11 AC2 7 PHE A 20 ? PHE A 158 . ? 1_555 ? 12 AC2 7 TYR A 25 ? TYR A 163 . ? 1_555 ? 13 AC2 7 LYS A 30 ? LYS A 168 . ? 1_555 ? 14 AC2 7 ARG A 31 ? ARG A 169 . ? 1_555 ? 15 AC2 7 C2E B . ? C2E A 501 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 140 ? ? -161.71 75.14 2 1 ARG A 142 ? ? -70.55 -136.04 3 1 ARG A 157 ? ? -155.41 -13.03 4 1 LYS A 168 ? ? -144.12 14.55 5 2 PRO A 141 ? ? -78.64 -124.73 6 2 ARG A 142 ? ? -146.87 47.60 7 2 ARG A 157 ? ? -155.61 -10.45 8 2 LYS A 168 ? ? -143.86 15.12 9 3 LYS A 140 ? ? -165.24 59.62 10 3 ARG A 142 ? ? -69.73 -138.84 11 3 GLU A 143 ? ? 53.24 72.51 12 3 ARG A 157 ? ? -155.74 -7.57 13 3 LYS A 168 ? ? -141.24 14.63 14 4 LYS A 140 ? ? -165.39 67.00 15 4 PRO A 141 ? ? -81.73 -121.19 16 4 ARG A 157 ? ? -155.95 -9.53 17 4 LYS A 168 ? ? -141.08 14.24 18 5 LYS A 140 ? ? 53.64 76.82 19 5 PRO A 141 ? ? -55.31 171.80 20 5 ARG A 157 ? ? -150.36 -11.91 21 5 LYS A 168 ? ? -143.02 15.35 22 6 ARG A 142 ? ? -72.69 -134.89 23 6 ARG A 157 ? ? -155.80 -9.84 24 7 ARG A 142 ? ? -66.25 -137.62 25 7 ARG A 157 ? ? -154.99 -14.90 26 7 LYS A 168 ? ? -145.13 16.91 27 8 LYS A 140 ? ? -163.34 -42.75 28 8 PRO A 141 ? ? -94.75 -112.37 29 8 ARG A 142 ? ? -135.48 -130.83 30 8 LYS A 168 ? ? -141.58 14.20 31 9 ARG A 142 ? ? -65.83 -132.17 32 9 ARG A 157 ? ? -155.95 -8.69 33 9 LYS A 168 ? ? -142.69 15.00 34 10 ARG A 142 ? ? -71.45 -136.00 35 10 ARG A 157 ? ? -155.53 -11.41 36 10 LYS A 168 ? ? -144.27 15.40 # _pdbx_entry_details.entry_id 6SFT _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_nmr_ensemble.entry_id 6SFT _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6SFT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;1.0 mM [U-99% 15N] ARR_CleD, 3.0 mM C2E, 100 mM sodium chloride, 2 mM magnesim chloride, 20 mM sodium phosphate, 0.02 % sodium azide, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N_sample solution ? 2 ;0.9 mM [U-99% 13C; U-99% 15N] ARR_CleD, 2.7 mM C2E, 100 mM sodium chloride, 2 mM magnesium chloride, 20 mM sodium phosphate, 0.02 % sodium azide, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N_13C_sample solution ? 3 ;0.6 mM [U-99% 13C; U-99% 15N] ARR_CleD, 1.8 mM C2E, 66.6 mM sodium chloride, 1.33 mM magnesium chloride, 13.33 mM sodium phosphate, 9 mg/mL Pf1 phage, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N-13C-phages 'filamentous virus' 'D2O splitting of 8Hz is enough' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 ARR_CleD 1.0 ? mM '[U-99% 15N]' 1 C2E 3.0 ? mM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 'magnesim chloride' 2 ? mM 'natural abundance' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium azide' 0.02 ? % 'natural abundance' 2 ARR_CleD 0.9 ? mM '[U-99% 13C; U-99% 15N]' 2 C2E 2.7 ? mM 'natural abundance' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 'magnesium chloride' 2 ? mM 'natural abundance' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 'sodium azide' 0.02 ? % 'natural abundance' 3 ARR_CleD 0.6 ? mM '[U-99% 13C; U-99% 15N]' 3 C2E 1.8 ? mM 'natural abundance' 3 'sodium chloride' 66.6 ? mM 'natural abundance' 3 'magnesium chloride' 1.33 ? mM 'natural abundance' 3 'sodium phosphate' 13.33 ? mM 'natural abundance' 3 'Pf1 phage' 9 ? mg/mL 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 6.5 0.47 ? ? M conditions_1 0.04 pH ? 0.1 K 2 298 atm 1 6.5 0.31 ? ? M conditions_2 ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-15N HSQC' 2 isotropic 3 1 1 '3D 1H-15N NOESY' 1 isotropic 4 1 1 '3D 1H-15N TOCSY' 1 isotropic 5 1 1 '3D 1H-15N NH2 NOESY' 1 isotropic 9 1 1 '3D 1H-15N NH2 TOCSY' 1 isotropic 6 1 1 '2D 1H-1H NOESY' 2 isotropic 8 1 2 '3D HNCA' 3 isotropic 7 1 2 '3D HNCO' 3 isotropic 13 1 2 '3D CBCA(CO)NH' 3 isotropic 12 1 2 '3D HBHA(CO)NH' 3 isotropic 11 1 2 '3D CBCANH' 3 isotropic 10 1 2 '3D C(CO)NH' 1 isotropic 15 1 2 '2D 1H-1H NOESY isotpe filtered' 2 isotropic 16 1 1 '3D 15N t1 interleaved' 1 isotropic 14 1 1 '3D 15N t2 interleaved' 1 isotropic 17 1 1 '2D 1H-15N NOE without sturation' 1 isotropic 19 1 1 '2D 1H-15N NOE with sturation' 1 isotropic 24 1 2 '3D HN(CO)CA' 1 isotropic 18 2 2 '3D HN(CO)CA without decoupling' 1 anisotropic 25 1 2 '2D 1H-15N HSQC IPAP' 1 isotropic 23 2 2 '2D 1H-15N HSQC IPAP' 1 anisotropic # _pdbx_nmr_refine.entry_id 6SFT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' 2.34 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' 'X-PLOR NIH' 2.34 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' Sparky 3.115 Goddard 4 'peak picking' Sparky 3.115 Goddard 5 processing NMRPipe 8.9 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 6 'data analysis' ModelFree 4 Palmer 7 'peak picking' PIPP ? Garrett 8 collection TopSpin ? 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 C2E P1 P N N 74 C2E O2P O N N 75 C2E O1P O N N 76 C2E "O5'" O N N 77 C2E "C5'" C N N 78 C2E "C4'" C N R 79 C2E "O4'" O N N 80 C2E "C3'" C N S 81 C2E "O3'" O N N 82 C2E "C2'" C N R 83 C2E "O2'" O N N 84 C2E "C1'" C N R 85 C2E N9 N Y N 86 C2E C8 C Y N 87 C2E N7 N Y N 88 C2E C5 C Y N 89 C2E C6 C N N 90 C2E O6 O N N 91 C2E N1 N N N 92 C2E C2 C N N 93 C2E N2 N N N 94 C2E N3 N N N 95 C2E C4 C Y N 96 C2E P11 P N N 97 C2E O21 O N N 98 C2E O11 O N N 99 C2E O5A O N N 100 C2E C5A C N N 101 C2E C4A C N R 102 C2E O4A O N N 103 C2E C3A C N S 104 C2E O3A O N N 105 C2E C2A C N R 106 C2E O2A O N N 107 C2E C1A C N R 108 C2E N91 N Y N 109 C2E C81 C Y N 110 C2E N71 N Y N 111 C2E C51 C Y N 112 C2E C61 C N N 113 C2E O61 O N N 114 C2E N11 N N N 115 C2E C21 C N N 116 C2E N21 N N N 117 C2E N31 N N N 118 C2E C41 C Y N 119 C2E HO2P H N N 120 C2E "H5'1" H N N 121 C2E "H5'2" H N N 122 C2E "H4'" H N N 123 C2E "H3'" H N N 124 C2E "H2'" H N N 125 C2E "HO2'" H N N 126 C2E "H1'" H N N 127 C2E H8 H N N 128 C2E HN1 H N N 129 C2E HN21 H N N 130 C2E HN22 H N N 131 C2E HO21 H N N 132 C2E H511 H N N 133 C2E H512 H N N 134 C2E H4A H N N 135 C2E H3A H N N 136 C2E H2A H N N 137 C2E HO2A H N N 138 C2E H1A H N N 139 C2E H81 H N N 140 C2E HN11 H N N 141 C2E HN24 H N N 142 C2E HN23 H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 LYS N N N N 173 LYS CA C N S 174 LYS C C N N 175 LYS O O N N 176 LYS CB C N N 177 LYS CG C N N 178 LYS CD C N N 179 LYS CE C N N 180 LYS NZ N N N 181 LYS OXT O N N 182 LYS H H N N 183 LYS H2 H N N 184 LYS HA H N N 185 LYS HB2 H N N 186 LYS HB3 H N N 187 LYS HG2 H N N 188 LYS HG3 H N N 189 LYS HD2 H N N 190 LYS HD3 H N N 191 LYS HE2 H N N 192 LYS HE3 H N N 193 LYS HZ1 H N N 194 LYS HZ2 H N N 195 LYS HZ3 H N N 196 LYS HXT H N N 197 PHE N N N N 198 PHE CA C N S 199 PHE C C N N 200 PHE O O N N 201 PHE CB C N N 202 PHE CG C Y N 203 PHE CD1 C Y N 204 PHE CD2 C Y N 205 PHE CE1 C Y N 206 PHE CE2 C Y N 207 PHE CZ C Y N 208 PHE OXT O N N 209 PHE H H N N 210 PHE H2 H N N 211 PHE HA H N N 212 PHE HB2 H N N 213 PHE HB3 H N N 214 PHE HD1 H N N 215 PHE HD2 H N N 216 PHE HE1 H N N 217 PHE HE2 H N N 218 PHE HZ H N N 219 PHE HXT H N N 220 PRO N N N N 221 PRO CA C N S 222 PRO C C N N 223 PRO O O N N 224 PRO CB C N N 225 PRO CG C N N 226 PRO CD C N N 227 PRO OXT O N N 228 PRO H H N N 229 PRO HA H N N 230 PRO HB2 H N N 231 PRO HB3 H N N 232 PRO HG2 H N N 233 PRO HG3 H N N 234 PRO HD2 H N N 235 PRO HD3 H N N 236 PRO HXT H N N 237 SER N N N N 238 SER CA C N S 239 SER C C N N 240 SER O O N N 241 SER CB C N N 242 SER OG O N N 243 SER OXT O N N 244 SER H H N N 245 SER H2 H N N 246 SER HA H N N 247 SER HB2 H N N 248 SER HB3 H N N 249 SER HG H N N 250 SER HXT H N N 251 TRP N N N N 252 TRP CA C N S 253 TRP C C N N 254 TRP O O N N 255 TRP CB C N N 256 TRP CG C Y N 257 TRP CD1 C Y N 258 TRP CD2 C Y N 259 TRP NE1 N Y N 260 TRP CE2 C Y N 261 TRP CE3 C Y N 262 TRP CZ2 C Y N 263 TRP CZ3 C Y N 264 TRP CH2 C Y N 265 TRP OXT O N N 266 TRP H H N N 267 TRP H2 H N N 268 TRP HA H N N 269 TRP HB2 H N N 270 TRP HB3 H N N 271 TRP HD1 H N N 272 TRP HE1 H N N 273 TRP HE3 H N N 274 TRP HZ2 H N N 275 TRP HZ3 H N N 276 TRP HH2 H N N 277 TRP HXT H N N 278 TYR N N N N 279 TYR CA C N S 280 TYR C C N N 281 TYR O O N N 282 TYR CB C N N 283 TYR CG C Y N 284 TYR CD1 C Y N 285 TYR CD2 C Y N 286 TYR CE1 C Y N 287 TYR CE2 C Y N 288 TYR CZ C Y N 289 TYR OH O N N 290 TYR OXT O N N 291 TYR H H N N 292 TYR H2 H N N 293 TYR HA H N N 294 TYR HB2 H N N 295 TYR HB3 H N N 296 TYR HD1 H N N 297 TYR HD2 H N N 298 TYR HE1 H N N 299 TYR HE2 H N N 300 TYR HH H N N 301 TYR HXT H N N 302 VAL N N N N 303 VAL CA C N S 304 VAL C C N N 305 VAL O O N N 306 VAL CB C N N 307 VAL CG1 C N N 308 VAL CG2 C N N 309 VAL OXT O N N 310 VAL H H N N 311 VAL H2 H N N 312 VAL HA H N N 313 VAL HB H N N 314 VAL HG11 H N N 315 VAL HG12 H N N 316 VAL HG13 H N N 317 VAL HG21 H N N 318 VAL HG22 H N N 319 VAL HG23 H N N 320 VAL HXT H N N 321 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 C2E P1 O2P sing N N 70 C2E O1P P1 doub N N 71 C2E "O5'" P1 sing N N 72 C2E "C5'" "O5'" sing N N 73 C2E "C4'" "O4'" sing N N 74 C2E "C4'" "C5'" sing N N 75 C2E "C3'" "C4'" sing N N 76 C2E "O3'" P11 sing N N 77 C2E "O3'" "C3'" sing N N 78 C2E "C2'" "C3'" sing N N 79 C2E "C2'" "C1'" sing N N 80 C2E "O2'" "C2'" sing N N 81 C2E "C1'" "O4'" sing N N 82 C2E "C1'" N9 sing N N 83 C2E N9 C4 sing Y N 84 C2E N9 C8 sing Y N 85 C2E C8 N7 doub Y N 86 C2E C5 N7 sing Y N 87 C2E C5 C6 sing N N 88 C2E C6 O6 doub N N 89 C2E N1 C6 sing N N 90 C2E C2 N1 sing N N 91 C2E N2 C2 sing N N 92 C2E N3 C2 doub N N 93 C2E N3 C4 sing N N 94 C2E C4 C5 doub Y N 95 C2E P11 O21 sing N N 96 C2E P11 O5A sing N N 97 C2E O11 P11 doub N N 98 C2E C5A O5A sing N N 99 C2E C5A C4A sing N N 100 C2E C4A O4A sing N N 101 C2E C4A C3A sing N N 102 C2E O4A C1A sing N N 103 C2E C3A C2A sing N N 104 C2E O3A C3A sing N N 105 C2E O3A P1 sing N N 106 C2E C2A O2A sing N N 107 C2E C1A C2A sing N N 108 C2E C1A N91 sing N N 109 C2E N91 C41 sing Y N 110 C2E C81 N71 doub Y N 111 C2E C81 N91 sing Y N 112 C2E N71 C51 sing Y N 113 C2E C51 C41 doub Y N 114 C2E C51 C61 sing N N 115 C2E C61 O61 doub N N 116 C2E C61 N11 sing N N 117 C2E C21 N11 sing N N 118 C2E C21 N21 sing N N 119 C2E N31 C21 doub N N 120 C2E C41 N31 sing N N 121 C2E O2P HO2P sing N N 122 C2E "C5'" "H5'1" sing N N 123 C2E "C5'" "H5'2" sing N N 124 C2E "C4'" "H4'" sing N N 125 C2E "C3'" "H3'" sing N N 126 C2E "C2'" "H2'" sing N N 127 C2E "O2'" "HO2'" sing N N 128 C2E "C1'" "H1'" sing N N 129 C2E C8 H8 sing N N 130 C2E N1 HN1 sing N N 131 C2E N2 HN21 sing N N 132 C2E N2 HN22 sing N N 133 C2E O21 HO21 sing N N 134 C2E C5A H511 sing N N 135 C2E C5A H512 sing N N 136 C2E C4A H4A sing N N 137 C2E C3A H3A sing N N 138 C2E C2A H2A sing N N 139 C2E O2A HO2A sing N N 140 C2E C1A H1A sing N N 141 C2E C81 H81 sing N N 142 C2E N11 HN11 sing N N 143 C2E N21 HN24 sing N N 144 C2E N21 HN23 sing N N 145 GLU N CA sing N N 146 GLU N H sing N N 147 GLU N H2 sing N N 148 GLU CA C sing N N 149 GLU CA CB sing N N 150 GLU CA HA sing N N 151 GLU C O doub N N 152 GLU C OXT sing N N 153 GLU CB CG sing N N 154 GLU CB HB2 sing N N 155 GLU CB HB3 sing N N 156 GLU CG CD sing N N 157 GLU CG HG2 sing N N 158 GLU CG HG3 sing N N 159 GLU CD OE1 doub N N 160 GLU CD OE2 sing N N 161 GLU OE2 HE2 sing N N 162 GLU OXT HXT sing N N 163 GLY N CA sing N N 164 GLY N H sing N N 165 GLY N H2 sing N N 166 GLY CA C sing N N 167 GLY CA HA2 sing N N 168 GLY CA HA3 sing N N 169 GLY C O doub N N 170 GLY C OXT sing N N 171 GLY OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 PHE N CA sing N N 197 PHE N H sing N N 198 PHE N H2 sing N N 199 PHE CA C sing N N 200 PHE CA CB sing N N 201 PHE CA HA sing N N 202 PHE C O doub N N 203 PHE C OXT sing N N 204 PHE CB CG sing N N 205 PHE CB HB2 sing N N 206 PHE CB HB3 sing N N 207 PHE CG CD1 doub Y N 208 PHE CG CD2 sing Y N 209 PHE CD1 CE1 sing Y N 210 PHE CD1 HD1 sing N N 211 PHE CD2 CE2 doub Y N 212 PHE CD2 HD2 sing N N 213 PHE CE1 CZ doub Y N 214 PHE CE1 HE1 sing N N 215 PHE CE2 CZ sing Y N 216 PHE CE2 HE2 sing N N 217 PHE CZ HZ sing N N 218 PHE OXT HXT sing N N 219 PRO N CA sing N N 220 PRO N CD sing N N 221 PRO N H sing N N 222 PRO CA C sing N N 223 PRO CA CB sing N N 224 PRO CA HA sing N N 225 PRO C O doub N N 226 PRO C OXT sing N N 227 PRO CB CG sing N N 228 PRO CB HB2 sing N N 229 PRO CB HB3 sing N N 230 PRO CG CD sing N N 231 PRO CG HG2 sing N N 232 PRO CG HG3 sing N N 233 PRO CD HD2 sing N N 234 PRO CD HD3 sing N N 235 PRO OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 TRP N CA sing N N 250 TRP N H sing N N 251 TRP N H2 sing N N 252 TRP CA C sing N N 253 TRP CA CB sing N N 254 TRP CA HA sing N N 255 TRP C O doub N N 256 TRP C OXT sing N N 257 TRP CB CG sing N N 258 TRP CB HB2 sing N N 259 TRP CB HB3 sing N N 260 TRP CG CD1 doub Y N 261 TRP CG CD2 sing Y N 262 TRP CD1 NE1 sing Y N 263 TRP CD1 HD1 sing N N 264 TRP CD2 CE2 doub Y N 265 TRP CD2 CE3 sing Y N 266 TRP NE1 CE2 sing Y N 267 TRP NE1 HE1 sing N N 268 TRP CE2 CZ2 sing Y N 269 TRP CE3 CZ3 doub Y N 270 TRP CE3 HE3 sing N N 271 TRP CZ2 CH2 doub Y N 272 TRP CZ2 HZ2 sing N N 273 TRP CZ3 CH2 sing Y N 274 TRP CZ3 HZ3 sing N N 275 TRP CH2 HH2 sing N N 276 TRP OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_audit_support.funding_organization 'Swiss National Science Foundation' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number 'SNF 31-149927' _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id C2E _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id C2E _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 DRX ? Bruker 600 'TXI probe head' 2 DRX ? Bruker 900 'TCI probe head' 3 DRX ? Bruker 800 'TXI probe head' # _atom_sites.entry_id 6SFT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P # loop_