data_6T72 # _entry.id 6T72 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6T72 pdb_00006t72 10.2210/pdb6t72/pdb WWPDB D_1292104945 ? ? EMDB EMD-10389 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-01-15 2 'Structure model' 1 1 2020-02-05 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2024-05-22 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Source and taxonomy' 4 3 'Structure model' Advisory 5 3 'Structure model' 'Atomic model' 6 3 'Structure model' 'Data collection' 7 3 'Structure model' 'Derived calculations' 8 3 'Structure model' 'Structure summary' 9 4 'Structure model' 'Data collection' 10 4 'Structure model' 'Database references' 11 4 'Structure model' 'Derived calculations' 12 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' citation 3 2 'Structure model' entity_src_gen 4 3 'Structure model' atom_site 5 3 'Structure model' chem_comp 6 3 'Structure model' entity 7 3 'Structure model' pdbx_branch_scheme 8 3 'Structure model' pdbx_chem_comp_identifier 9 3 'Structure model' pdbx_entity_branch 10 3 'Structure model' pdbx_entity_branch_descriptor 11 3 'Structure model' pdbx_entity_branch_link 12 3 'Structure model' pdbx_entity_branch_list 13 3 'Structure model' pdbx_entity_nonpoly 14 3 'Structure model' pdbx_nonpoly_scheme 15 3 'Structure model' pdbx_struct_assembly_gen 16 3 'Structure model' pdbx_struct_conn_angle 17 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 18 3 'Structure model' struct_asym 19 3 'Structure model' struct_conn 20 3 'Structure model' struct_conn_type 21 3 'Structure model' struct_site 22 3 'Structure model' struct_site_gen 23 4 'Structure model' chem_comp 24 4 'Structure model' chem_comp_atom 25 4 'Structure model' chem_comp_bond 26 4 'Structure model' database_2 27 4 'Structure model' pdbx_struct_oper_list 28 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.type' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 8 2 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 9 3 'Structure model' '_atom_site.B_iso_or_equiv' 10 3 'Structure model' '_atom_site.Cartn_x' 11 3 'Structure model' '_atom_site.Cartn_y' 12 3 'Structure model' '_atom_site.Cartn_z' 13 3 'Structure model' '_atom_site.auth_asym_id' 14 3 'Structure model' '_atom_site.auth_atom_id' 15 3 'Structure model' '_atom_site.auth_comp_id' 16 3 'Structure model' '_atom_site.auth_seq_id' 17 3 'Structure model' '_atom_site.label_asym_id' 18 3 'Structure model' '_atom_site.label_atom_id' 19 3 'Structure model' '_atom_site.label_comp_id' 20 3 'Structure model' '_atom_site.label_entity_id' 21 3 'Structure model' '_atom_site.type_symbol' 22 3 'Structure model' '_chem_comp.name' 23 3 'Structure model' '_chem_comp.type' 24 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 26 3 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.auth_asym_id' 27 3 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.auth_seq_id' 28 3 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_asym_id' 29 3 'Structure model' '_struct_conn.conn_type_id' 30 3 'Structure model' '_struct_conn.id' 31 3 'Structure model' '_struct_conn.pdbx_dist_value' 32 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 33 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 34 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 35 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 36 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 37 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 38 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 39 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 40 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 41 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 42 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 43 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 44 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 45 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 46 3 'Structure model' '_struct_conn_type.id' 47 4 'Structure model' '_chem_comp.pdbx_synonyms' 48 4 'Structure model' '_database_2.pdbx_DOI' 49 4 'Structure model' '_database_2.pdbx_database_accession' 50 4 'Structure model' '_pdbx_struct_oper_list.name' 51 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 52 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6T72 _pdbx_database_status.recvd_initial_deposition_date 2019-10-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Structure of the RsaA N-terminal domain bound to LPS' _pdbx_database_related.db_id EMD-10389 _pdbx_database_related.content_type 'associated EM volume' # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'von Kuegelgen, A.' 1 0000-0002-0017-2414 'Bharat, T.A.M.' 2 0000-0002-0168-0277 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 180 _citation.language ? _citation.page_first 348 _citation.page_last 358.e15 _citation.title 'In Situ Structure of an Intact Lipopolysaccharide-Bound Bacterial Surface Layer.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2019.12.006 _citation.pdbx_database_id_PubMed 31883796 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'von Kugelgen, A.' 1 ? primary 'Tang, H.' 2 ? primary 'Hardy, G.G.' 3 ? primary 'Kureisaite-Ciziene, D.' 4 ? primary 'Brun, Y.V.' 5 ? primary 'Stansfeld, P.J.' 6 ? primary 'Robinson, C.V.' 7 ? primary 'Bharat, T.A.M.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'S-layer protein' 25820.354 1 ? 'TEV site added at the position 250' ? 'LPS O-antigen bound to protein' 2 branched syn ;4-acetamido-4,6-dideoxy-alpha-D-mannopyranose-(1-3)-4-acetamido-4,6-dideoxy-alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-3)-4-acetamido-4,6-dideoxy-alpha-D-mannopyranose-(1-3)-4-acetamido-4,6-dideoxy-alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-3)-4-acetamido-4,6-dideoxy-alpha-D-mannopyranose-(1-3)-4-acetamido-4,6-dideoxy-alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-3)-4-acetamido-4,6-dideoxy-alpha-D-mannopyranose-(1-3)-4-acetamido-4,6-dideoxy-alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose ; 2164.121 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Paracrystalline surface layer protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AYTTAQLVTAYTNANLGKAPDAATTLTLDAYATQTQTGGLSDAAALTNTLKLVNSTTAVAIQTYQFFTGVAPSAAGLDFL VDSTTNTNDLNDAYYSKFAQENRFINFSINLATGAGAGATAFAAAYTGVSYAQTVATAYDKIIGNAVATAAGVDVAAAVA FLSRQANIDYLTAFVRANTPFTAAADIDLAVKAALIGTILNAATVSGIGGYATATAAMINDLSDGALSTDNAAGVNLFTA YPSSGVSGSENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;AYTTAQLVTAYTNANLGKAPDAATTLTLDAYATQTQTGGLSDAAALTNTLKLVNSTTAVAIQTYQFFTGVAPSAAGLDFL VDSTTNTNDLNDAYYSKFAQENRFINFSINLATGAGAGATAFAAAYTGVSYAQTVATAYDKIIGNAVATAAGVDVAAAVA FLSRQANIDYLTAFVRANTPFTAAADIDLAVKAALIGTILNAATVSGIGGYATATAAMINDLSDGALSTDNAAGVNLFTA YPSSGVSGSENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 TYR n 1 3 THR n 1 4 THR n 1 5 ALA n 1 6 GLN n 1 7 LEU n 1 8 VAL n 1 9 THR n 1 10 ALA n 1 11 TYR n 1 12 THR n 1 13 ASN n 1 14 ALA n 1 15 ASN n 1 16 LEU n 1 17 GLY n 1 18 LYS n 1 19 ALA n 1 20 PRO n 1 21 ASP n 1 22 ALA n 1 23 ALA n 1 24 THR n 1 25 THR n 1 26 LEU n 1 27 THR n 1 28 LEU n 1 29 ASP n 1 30 ALA n 1 31 TYR n 1 32 ALA n 1 33 THR n 1 34 GLN n 1 35 THR n 1 36 GLN n 1 37 THR n 1 38 GLY n 1 39 GLY n 1 40 LEU n 1 41 SER n 1 42 ASP n 1 43 ALA n 1 44 ALA n 1 45 ALA n 1 46 LEU n 1 47 THR n 1 48 ASN n 1 49 THR n 1 50 LEU n 1 51 LYS n 1 52 LEU n 1 53 VAL n 1 54 ASN n 1 55 SER n 1 56 THR n 1 57 THR n 1 58 ALA n 1 59 VAL n 1 60 ALA n 1 61 ILE n 1 62 GLN n 1 63 THR n 1 64 TYR n 1 65 GLN n 1 66 PHE n 1 67 PHE n 1 68 THR n 1 69 GLY n 1 70 VAL n 1 71 ALA n 1 72 PRO n 1 73 SER n 1 74 ALA n 1 75 ALA n 1 76 GLY n 1 77 LEU n 1 78 ASP n 1 79 PHE n 1 80 LEU n 1 81 VAL n 1 82 ASP n 1 83 SER n 1 84 THR n 1 85 THR n 1 86 ASN n 1 87 THR n 1 88 ASN n 1 89 ASP n 1 90 LEU n 1 91 ASN n 1 92 ASP n 1 93 ALA n 1 94 TYR n 1 95 TYR n 1 96 SER n 1 97 LYS n 1 98 PHE n 1 99 ALA n 1 100 GLN n 1 101 GLU n 1 102 ASN n 1 103 ARG n 1 104 PHE n 1 105 ILE n 1 106 ASN n 1 107 PHE n 1 108 SER n 1 109 ILE n 1 110 ASN n 1 111 LEU n 1 112 ALA n 1 113 THR n 1 114 GLY n 1 115 ALA n 1 116 GLY n 1 117 ALA n 1 118 GLY n 1 119 ALA n 1 120 THR n 1 121 ALA n 1 122 PHE n 1 123 ALA n 1 124 ALA n 1 125 ALA n 1 126 TYR n 1 127 THR n 1 128 GLY n 1 129 VAL n 1 130 SER n 1 131 TYR n 1 132 ALA n 1 133 GLN n 1 134 THR n 1 135 VAL n 1 136 ALA n 1 137 THR n 1 138 ALA n 1 139 TYR n 1 140 ASP n 1 141 LYS n 1 142 ILE n 1 143 ILE n 1 144 GLY n 1 145 ASN n 1 146 ALA n 1 147 VAL n 1 148 ALA n 1 149 THR n 1 150 ALA n 1 151 ALA n 1 152 GLY n 1 153 VAL n 1 154 ASP n 1 155 VAL n 1 156 ALA n 1 157 ALA n 1 158 ALA n 1 159 VAL n 1 160 ALA n 1 161 PHE n 1 162 LEU n 1 163 SER n 1 164 ARG n 1 165 GLN n 1 166 ALA n 1 167 ASN n 1 168 ILE n 1 169 ASP n 1 170 TYR n 1 171 LEU n 1 172 THR n 1 173 ALA n 1 174 PHE n 1 175 VAL n 1 176 ARG n 1 177 ALA n 1 178 ASN n 1 179 THR n 1 180 PRO n 1 181 PHE n 1 182 THR n 1 183 ALA n 1 184 ALA n 1 185 ALA n 1 186 ASP n 1 187 ILE n 1 188 ASP n 1 189 LEU n 1 190 ALA n 1 191 VAL n 1 192 LYS n 1 193 ALA n 1 194 ALA n 1 195 LEU n 1 196 ILE n 1 197 GLY n 1 198 THR n 1 199 ILE n 1 200 LEU n 1 201 ASN n 1 202 ALA n 1 203 ALA n 1 204 THR n 1 205 VAL n 1 206 SER n 1 207 GLY n 1 208 ILE n 1 209 GLY n 1 210 GLY n 1 211 TYR n 1 212 ALA n 1 213 THR n 1 214 ALA n 1 215 THR n 1 216 ALA n 1 217 ALA n 1 218 MET n 1 219 ILE n 1 220 ASN n 1 221 ASP n 1 222 LEU n 1 223 SER n 1 224 ASP n 1 225 GLY n 1 226 ALA n 1 227 LEU n 1 228 SER n 1 229 THR n 1 230 ASP n 1 231 ASN n 1 232 ALA n 1 233 ALA n 1 234 GLY n 1 235 VAL n 1 236 ASN n 1 237 LEU n 1 238 PHE n 1 239 THR n 1 240 ALA n 1 241 TYR n 1 242 PRO n 1 243 SER n 1 244 SER n 1 245 GLY n 1 246 VAL n 1 247 SER n 1 248 GLY n 1 249 SER n 1 250 GLU n 1 251 ASN n 1 252 LEU n 1 253 TYR n 1 254 PHE n 1 255 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 255 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rsaA, CC_1007' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caulobacter vibrioides CB15' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 190650 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Caulobacter vibrioides CB15' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 190650 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 ;WURCS=2.0/2,12,11/[a1122h-1b_1-5][a1122m-1a_1-5_4*NCC/3=O]/1-2-2-1-2-2-1-2-2-1-2-2/a3-b1_b3-c1_c3-d1_d3-e1_e3-f1_f3-g1_g3-h1_h3-i1_i3-j1_j3-k1_k3-l1 ; WURCS PDB2Glycan 1.1.0 2 2 ;[][D-1-deoxy-Manp]{[(3+1)][a-D-Rhap4NAc]{[(3+1)][a-D-Rhap4NAc]{[(3+1)][b-D-Manp]{[(3+1)][a-D-Rhap4NAc]{[(3+1)][a-D-Rhap4NAc]{[(3+1)][b-D-Manp]{[(3+1)][a-D-Rhap4NAc]{[(3+1)][a-D-Rhap4NAc]{[(3+1)][b-D-Manp]{[(3+1)][a-D-Rhap4NAc]{[(3+1)][a-D-Rhap4NAc]{}}}}}}}}}}}} ; LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 MRH C1 O1 1 BMA O3 HO3 sing ? 2 2 3 MRH C1 O1 2 MRH O3 HO3 sing ? 3 2 4 BMA C1 O1 3 MRH O3 HO3 sing ? 4 2 5 MRH C1 O1 4 BMA O3 HO3 sing ? 5 2 6 MRH C1 O1 5 MRH O3 HO3 sing ? 6 2 7 BMA C1 O1 6 MRH O3 HO3 sing ? 7 2 8 MRH C1 O1 7 BMA O3 HO3 sing ? 8 2 9 MRH C1 O1 8 MRH O3 HO3 sing ? 9 2 10 BMA C1 O1 9 MRH O3 HO3 sing ? 10 2 11 MRH C1 O1 10 BMA O3 HO3 sing ? 11 2 12 MRH C1 O1 11 MRH O3 HO3 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose 'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MRH 'D-saccharide, alpha linking' . 4-acetamido-4,6-dideoxy-alpha-D-mannopyranose ;alpha-N-Acetylperosamine; 4-acetamido-4,6-dideoxy-alpha-D-mannose; 4-acetamido-4,6-dideoxy-D-mannose; 4-acetamido-4,6-dideoxy-mannose ; 'C8 H15 N O5' 205.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 TYR 2 3 3 TYR TYR A . n A 1 3 THR 3 4 4 THR THR A . n A 1 4 THR 4 5 5 THR THR A . n A 1 5 ALA 5 6 6 ALA ALA A . n A 1 6 GLN 6 7 7 GLN GLN A . n A 1 7 LEU 7 8 8 LEU LEU A . n A 1 8 VAL 8 9 9 VAL VAL A . n A 1 9 THR 9 10 10 THR THR A . n A 1 10 ALA 10 11 11 ALA ALA A . n A 1 11 TYR 11 12 12 TYR TYR A . n A 1 12 THR 12 13 13 THR THR A . n A 1 13 ASN 13 14 14 ASN ASN A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 ASN 15 16 16 ASN ASN A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 GLY 17 18 18 GLY GLY A . n A 1 18 LYS 18 19 19 LYS LYS A . n A 1 19 ALA 19 20 20 ALA ALA A . n A 1 20 PRO 20 21 21 PRO PRO A . n A 1 21 ASP 21 22 22 ASP ASP A . n A 1 22 ALA 22 23 23 ALA ALA A . n A 1 23 ALA 23 24 24 ALA ALA A . n A 1 24 THR 24 25 25 THR THR A . n A 1 25 THR 25 26 26 THR THR A . n A 1 26 LEU 26 27 27 LEU LEU A . n A 1 27 THR 27 28 28 THR THR A . n A 1 28 LEU 28 29 29 LEU LEU A . n A 1 29 ASP 29 30 30 ASP ASP A . n A 1 30 ALA 30 31 31 ALA ALA A . n A 1 31 TYR 31 32 32 TYR TYR A . n A 1 32 ALA 32 33 33 ALA ALA A . n A 1 33 THR 33 34 34 THR THR A . n A 1 34 GLN 34 35 35 GLN GLN A . n A 1 35 THR 35 36 36 THR THR A . n A 1 36 GLN 36 37 37 GLN GLN A . n A 1 37 THR 37 38 38 THR THR A . n A 1 38 GLY 38 39 39 GLY GLY A . n A 1 39 GLY 39 40 40 GLY GLY A . n A 1 40 LEU 40 41 41 LEU LEU A . n A 1 41 SER 41 42 42 SER SER A . n A 1 42 ASP 42 43 43 ASP ASP A . n A 1 43 ALA 43 44 44 ALA ALA A . n A 1 44 ALA 44 45 45 ALA ALA A . n A 1 45 ALA 45 46 46 ALA ALA A . n A 1 46 LEU 46 47 47 LEU LEU A . n A 1 47 THR 47 48 48 THR THR A . n A 1 48 ASN 48 49 49 ASN ASN A . n A 1 49 THR 49 50 50 THR THR A . n A 1 50 LEU 50 51 51 LEU LEU A . n A 1 51 LYS 51 52 52 LYS LYS A . n A 1 52 LEU 52 53 53 LEU LEU A . n A 1 53 VAL 53 54 54 VAL VAL A . n A 1 54 ASN 54 55 55 ASN ASN A . n A 1 55 SER 55 56 56 SER SER A . n A 1 56 THR 56 57 57 THR THR A . n A 1 57 THR 57 58 58 THR THR A . n A 1 58 ALA 58 59 59 ALA ALA A . n A 1 59 VAL 59 60 60 VAL VAL A . n A 1 60 ALA 60 61 61 ALA ALA A . n A 1 61 ILE 61 62 62 ILE ILE A . n A 1 62 GLN 62 63 63 GLN GLN A . n A 1 63 THR 63 64 64 THR THR A . n A 1 64 TYR 64 65 65 TYR TYR A . n A 1 65 GLN 65 66 66 GLN GLN A . n A 1 66 PHE 66 67 67 PHE PHE A . n A 1 67 PHE 67 68 68 PHE PHE A . n A 1 68 THR 68 69 69 THR THR A . n A 1 69 GLY 69 70 70 GLY GLY A . n A 1 70 VAL 70 71 71 VAL VAL A . n A 1 71 ALA 71 72 72 ALA ALA A . n A 1 72 PRO 72 73 73 PRO PRO A . n A 1 73 SER 73 74 74 SER SER A . n A 1 74 ALA 74 75 75 ALA ALA A . n A 1 75 ALA 75 76 76 ALA ALA A . n A 1 76 GLY 76 77 77 GLY GLY A . n A 1 77 LEU 77 78 78 LEU LEU A . n A 1 78 ASP 78 79 79 ASP ASP A . n A 1 79 PHE 79 80 80 PHE PHE A . n A 1 80 LEU 80 81 81 LEU LEU A . n A 1 81 VAL 81 82 82 VAL VAL A . n A 1 82 ASP 82 83 83 ASP ASP A . n A 1 83 SER 83 84 84 SER SER A . n A 1 84 THR 84 85 85 THR THR A . n A 1 85 THR 85 86 86 THR THR A . n A 1 86 ASN 86 87 87 ASN ASN A . n A 1 87 THR 87 88 88 THR THR A . n A 1 88 ASN 88 89 89 ASN ASN A . n A 1 89 ASP 89 90 90 ASP ASP A . n A 1 90 LEU 90 91 91 LEU LEU A . n A 1 91 ASN 91 92 92 ASN ASN A . n A 1 92 ASP 92 93 93 ASP ASP A . n A 1 93 ALA 93 94 94 ALA ALA A . n A 1 94 TYR 94 95 95 TYR TYR A . n A 1 95 TYR 95 96 96 TYR TYR A . n A 1 96 SER 96 97 97 SER SER A . n A 1 97 LYS 97 98 98 LYS LYS A . n A 1 98 PHE 98 99 99 PHE PHE A . n A 1 99 ALA 99 100 100 ALA ALA A . n A 1 100 GLN 100 101 101 GLN GLN A . n A 1 101 GLU 101 102 102 GLU GLU A . n A 1 102 ASN 102 103 103 ASN ASN A . n A 1 103 ARG 103 104 104 ARG ARG A . n A 1 104 PHE 104 105 105 PHE PHE A . n A 1 105 ILE 105 106 106 ILE ILE A . n A 1 106 ASN 106 107 107 ASN ASN A . n A 1 107 PHE 107 108 108 PHE PHE A . n A 1 108 SER 108 109 109 SER SER A . n A 1 109 ILE 109 110 110 ILE ILE A . n A 1 110 ASN 110 111 111 ASN ASN A . n A 1 111 LEU 111 112 112 LEU LEU A . n A 1 112 ALA 112 113 113 ALA ALA A . n A 1 113 THR 113 114 114 THR THR A . n A 1 114 GLY 114 115 115 GLY GLY A . n A 1 115 ALA 115 116 116 ALA ALA A . n A 1 116 GLY 116 117 117 GLY GLY A . n A 1 117 ALA 117 118 118 ALA ALA A . n A 1 118 GLY 118 119 119 GLY GLY A . n A 1 119 ALA 119 120 120 ALA ALA A . n A 1 120 THR 120 121 121 THR THR A . n A 1 121 ALA 121 122 122 ALA ALA A . n A 1 122 PHE 122 123 123 PHE PHE A . n A 1 123 ALA 123 124 124 ALA ALA A . n A 1 124 ALA 124 125 125 ALA ALA A . n A 1 125 ALA 125 126 126 ALA ALA A . n A 1 126 TYR 126 127 127 TYR TYR A . n A 1 127 THR 127 128 128 THR THR A . n A 1 128 GLY 128 129 129 GLY GLY A . n A 1 129 VAL 129 130 130 VAL VAL A . n A 1 130 SER 130 131 131 SER SER A . n A 1 131 TYR 131 132 132 TYR TYR A . n A 1 132 ALA 132 133 133 ALA ALA A . n A 1 133 GLN 133 134 134 GLN GLN A . n A 1 134 THR 134 135 135 THR THR A . n A 1 135 VAL 135 136 136 VAL VAL A . n A 1 136 ALA 136 137 137 ALA ALA A . n A 1 137 THR 137 138 138 THR THR A . n A 1 138 ALA 138 139 139 ALA ALA A . n A 1 139 TYR 139 140 140 TYR TYR A . n A 1 140 ASP 140 141 141 ASP ASP A . n A 1 141 LYS 141 142 142 LYS LYS A . n A 1 142 ILE 142 143 143 ILE ILE A . n A 1 143 ILE 143 144 144 ILE ILE A . n A 1 144 GLY 144 145 145 GLY GLY A . n A 1 145 ASN 145 146 146 ASN ASN A . n A 1 146 ALA 146 147 147 ALA ALA A . n A 1 147 VAL 147 148 148 VAL VAL A . n A 1 148 ALA 148 149 149 ALA ALA A . n A 1 149 THR 149 150 150 THR THR A . n A 1 150 ALA 150 151 151 ALA ALA A . n A 1 151 ALA 151 152 152 ALA ALA A . n A 1 152 GLY 152 153 153 GLY GLY A . n A 1 153 VAL 153 154 154 VAL VAL A . n A 1 154 ASP 154 155 155 ASP ASP A . n A 1 155 VAL 155 156 156 VAL VAL A . n A 1 156 ALA 156 157 157 ALA ALA A . n A 1 157 ALA 157 158 158 ALA ALA A . n A 1 158 ALA 158 159 159 ALA ALA A . n A 1 159 VAL 159 160 160 VAL VAL A . n A 1 160 ALA 160 161 161 ALA ALA A . n A 1 161 PHE 161 162 162 PHE PHE A . n A 1 162 LEU 162 163 163 LEU LEU A . n A 1 163 SER 163 164 164 SER SER A . n A 1 164 ARG 164 165 165 ARG ARG A . n A 1 165 GLN 165 166 166 GLN GLN A . n A 1 166 ALA 166 167 167 ALA ALA A . n A 1 167 ASN 167 168 168 ASN ASN A . n A 1 168 ILE 168 169 169 ILE ILE A . n A 1 169 ASP 169 170 170 ASP ASP A . n A 1 170 TYR 170 171 171 TYR TYR A . n A 1 171 LEU 171 172 172 LEU LEU A . n A 1 172 THR 172 173 173 THR THR A . n A 1 173 ALA 173 174 174 ALA ALA A . n A 1 174 PHE 174 175 175 PHE PHE A . n A 1 175 VAL 175 176 176 VAL VAL A . n A 1 176 ARG 176 177 177 ARG ARG A . n A 1 177 ALA 177 178 178 ALA ALA A . n A 1 178 ASN 178 179 179 ASN ASN A . n A 1 179 THR 179 180 180 THR THR A . n A 1 180 PRO 180 181 181 PRO PRO A . n A 1 181 PHE 181 182 182 PHE PHE A . n A 1 182 THR 182 183 183 THR THR A . n A 1 183 ALA 183 184 184 ALA ALA A . n A 1 184 ALA 184 185 185 ALA ALA A . n A 1 185 ALA 185 186 186 ALA ALA A . n A 1 186 ASP 186 187 187 ASP ASP A . n A 1 187 ILE 187 188 188 ILE ILE A . n A 1 188 ASP 188 189 189 ASP ASP A . n A 1 189 LEU 189 190 190 LEU LEU A . n A 1 190 ALA 190 191 191 ALA ALA A . n A 1 191 VAL 191 192 192 VAL VAL A . n A 1 192 LYS 192 193 193 LYS LYS A . n A 1 193 ALA 193 194 194 ALA ALA A . n A 1 194 ALA 194 195 195 ALA ALA A . n A 1 195 LEU 195 196 196 LEU LEU A . n A 1 196 ILE 196 197 197 ILE ILE A . n A 1 197 GLY 197 198 198 GLY GLY A . n A 1 198 THR 198 199 199 THR THR A . n A 1 199 ILE 199 200 200 ILE ILE A . n A 1 200 LEU 200 201 201 LEU LEU A . n A 1 201 ASN 201 202 202 ASN ASN A . n A 1 202 ALA 202 203 203 ALA ALA A . n A 1 203 ALA 203 204 204 ALA ALA A . n A 1 204 THR 204 205 205 THR THR A . n A 1 205 VAL 205 206 206 VAL VAL A . n A 1 206 SER 206 207 207 SER SER A . n A 1 207 GLY 207 208 208 GLY GLY A . n A 1 208 ILE 208 209 209 ILE ILE A . n A 1 209 GLY 209 210 210 GLY GLY A . n A 1 210 GLY 210 211 211 GLY GLY A . n A 1 211 TYR 211 212 212 TYR TYR A . n A 1 212 ALA 212 213 213 ALA ALA A . n A 1 213 THR 213 214 214 THR THR A . n A 1 214 ALA 214 215 215 ALA ALA A . n A 1 215 THR 215 216 216 THR THR A . n A 1 216 ALA 216 217 217 ALA ALA A . n A 1 217 ALA 217 218 218 ALA ALA A . n A 1 218 MET 218 219 219 MET MET A . n A 1 219 ILE 219 220 220 ILE ILE A . n A 1 220 ASN 220 221 221 ASN ASN A . n A 1 221 ASP 221 222 222 ASP ASP A . n A 1 222 LEU 222 223 223 LEU LEU A . n A 1 223 SER 223 224 224 SER SER A . n A 1 224 ASP 224 225 225 ASP ASP A . n A 1 225 GLY 225 226 226 GLY GLY A . n A 1 226 ALA 226 227 227 ALA ALA A . n A 1 227 LEU 227 228 228 LEU LEU A . n A 1 228 SER 228 229 229 SER SER A . n A 1 229 THR 229 230 230 THR THR A . n A 1 230 ASP 230 231 231 ASP ASP A . n A 1 231 ASN 231 232 232 ASN ASN A . n A 1 232 ALA 232 233 233 ALA ALA A . n A 1 233 ALA 233 234 234 ALA ALA A . n A 1 234 GLY 234 235 235 GLY GLY A . n A 1 235 VAL 235 236 236 VAL VAL A . n A 1 236 ASN 236 237 237 ASN ASN A . n A 1 237 LEU 237 238 238 LEU LEU A . n A 1 238 PHE 238 239 239 PHE PHE A . n A 1 239 THR 239 240 240 THR THR A . n A 1 240 ALA 240 241 241 ALA ALA A . n A 1 241 TYR 241 242 242 TYR TYR A . n A 1 242 PRO 242 243 243 PRO PRO A . n A 1 243 SER 243 244 ? ? ? A . n A 1 244 SER 244 245 ? ? ? A . n A 1 245 GLY 245 246 ? ? ? A . n A 1 246 VAL 246 247 ? ? ? A . n A 1 247 SER 247 248 ? ? ? A . n A 1 248 GLY 248 249 ? ? ? A . n A 1 249 SER 249 250 ? ? ? A . n A 1 250 GLU 250 251 ? ? ? A . n A 1 251 ASN 251 252 ? ? ? A . n A 1 252 LEU 252 253 ? ? ? A . n A 1 253 TYR 253 254 ? ? ? A . n A 1 254 PHE 254 255 ? ? ? A . n A 1 255 GLN 255 256 ? ? ? A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BMA 1 B BMA 1 A BMA 412 n B 2 MRH 2 B MRH 2 A Per 411 n B 2 MRH 3 B MRH 3 A Per 410 n B 2 BMA 4 B BMA 4 A BMA 409 n B 2 MRH 5 B MRH 5 A Per 408 n B 2 MRH 6 B MRH 6 A Per 407 n B 2 BMA 7 B BMA 7 A BMA 406 n B 2 MRH 8 B MRH 8 A Per 405 n B 2 MRH 9 B MRH 9 A Per 404 n B 2 BMA 10 B BMA 10 A BMA 403 n B 2 MRH 11 B MRH 11 A Per 402 n B 2 MRH 12 B MRH 12 A Per 401 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 301 300 CA CA A . D 3 CA 1 302 301 CA CA A . E 3 CA 1 303 302 CA CA A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id B _pdbx_unobs_or_zero_occ_atoms.auth_comp_id BMA _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id BMA _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O1 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6T72 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6T72 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6T72 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 6T72 _struct.title 'Structure of the RsaA N-terminal domain bound to LPS' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6T72 _struct_keywords.text 'S-layer LPS RsaA, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SLAP_CAUVC _struct_ref.pdbx_db_accession P35828 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AYTTAQLVTAYTNANLGKAPDAATTLTLDAYATQTQTGGLSDAAALTNTLKLVNSTTAVAIQTYQFFTGVAPSAAGLDFL VDSTTNTNDLNDAYYSKFAQENRFINFSINLATGAGAGATAFAAAYTGVSYAQTVATAYDKIIGNAVATAAGVDVAAAVA FLSRQANIDYLTAFVRANTPFTAAADIDLAVKAALIGTILNAATVSGIGGYATATAAMINDLSDGALSTDNAAGVNLFTA YPSSGVSGS ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6T72 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 249 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35828 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 250 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 250 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6T72 GLU A 250 ? UNP P35828 ? ? 'expression tag' 251 1 1 6T72 ASN A 251 ? UNP P35828 ? ? 'expression tag' 252 2 1 6T72 LEU A 252 ? UNP P35828 ? ? 'expression tag' 253 3 1 6T72 TYR A 253 ? UNP P35828 ? ? 'expression tag' 254 4 1 6T72 PHE A 254 ? UNP P35828 ? ? 'expression tag' 255 5 1 6T72 GLN A 255 ? UNP P35828 ? ? 'expression tag' 256 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetradecameric _pdbx_struct_assembly.oligomeric_count 14 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1250 ? 1 MORE -20 ? 1 'SSA (A^2)' 12300 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ;The complex was intensively studied with native mass spectrometry. Using high energy tandem mass spectrometry the stochiometry of the complex was determined as a mixture of 20 and 21 subunits of the N-terminal domain of RsaA, 6 full lipopolysaccharide molecules and 1 copy of hydrolysed polysaccharide. Submitted structure is a focussed refinement on the central 14 subunits. ; # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1 0 0 0 0 1 0 0 0 0 1 0 2 'point symmetry operation' ? ? -0.87965823 0.46413291 -0.10383663 246.05044698 -0.45655415 -0.88522446 -0.08908402 394.83967074 -0.13326555 -0.03095645 0.99059678 49.60884023 3 'point symmetry operation' ? ? -0.90940533 -0.39350375 -0.13467271 395.00071275 0.40224692 -0.91446027 -0.04426991 252.08605224 -0.10573247 -0.09443097 0.98990072 62.95386276 4 'point symmetry operation' ? ? -0.26314223 -0.95710930 -0.12123515 378.57842639 0.96374288 -0.26654232 0.01244424 45.73429304 -0.04422480 -0.11356491 0.99254581 62.77122320 5 'point symmetry operation' ? ? 0.58045339 -0.81121831 -0.07070164 208.51956410 0.81426982 0.57890636 0.04280294 -72.41085241 0.00620710 -0.08241533 0.99657874 56.06466061 6 'point symmetry operation' ? ? 0.99774402 -0.06624841 -0.01086334 9.30545864 0.06647173 0.99755281 0.02167738 -15.15467377 0.00940066 -0.02235058 0.99970600 52.34932757 7 'point symmetry operation' ? ? 0.68566983 0.72784357 0.01003134 -72.40449768 -0.72704824 0.68546193 -0.03927838 174.56740716 -0.03546462 0.01963873 0.99917795 59.94143345 8 'point symmetry operation' ? ? -0.12904659 0.99126003 -0.02739572 23.20243075 -0.98646569 -0.13114258 -0.09842291 358.77898654 -0.10115544 0.01432379 0.99476751 79.00159711 9 'point symmetry operation' ? ? -0.19537736 0.97951570 -0.04875113 42.20391473 -0.97508962 -0.19933665 -0.09728891 369.23034429 -0.10501390 0.02852867 0.99406146 27.44434265 10 'point symmetry operation' ? ? 0.63401752 0.77331351 -0.00282988 -66.31855272 -0.77194314 0.63266734 -0.06193407 195.24140440 -0.04610408 0.04145179 0.99807623 7.99155179 11 'point symmetry operation' ? ? 0.63211081 -0.77321872 -0.05068260 194.47067512 0.77487800 0.63076411 0.04123987 -72.42491429 0.00008132 -0.06534100 0.99786299 4.19173382 12 'point symmetry operation' ? ? -0.20037783 -0.97245869 -0.11904964 373.94318829 0.97863553 -0.20438547 0.02233991 33.71924603 -0.04605666 -0.11202978 0.99263695 13.66187740 13 'point symmetry operation' ? ? -0.88179394 -0.44844629 -0.14606631 404.31767796 0.45891264 -0.88727049 -0.04637090 240.92468977 -0.10880547 -0.10792126 0.98818742 17.45682344 14 'point symmetry operation' ? ? -0.90514695 0.41321313 -0.09981943 260.64870632 -0.40271422 -0.90870191 -0.10991864 395.09142444 -0.13612593 -0.05929382 0.98891555 7.36444140 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? ASN A 15 ? THR A 4 ASN A 16 1 ? 13 HELX_P HELX_P2 AA2 ASP A 21 ? THR A 37 ? ASP A 22 THR A 38 1 ? 17 HELX_P HELX_P3 AA3 SER A 41 ? LEU A 52 ? SER A 42 LEU A 53 1 ? 12 HELX_P HELX_P4 AA4 THR A 57 ? GLY A 69 ? THR A 58 GLY A 70 1 ? 13 HELX_P HELX_P5 AA5 SER A 73 ? ASP A 82 ? SER A 74 ASP A 83 1 ? 10 HELX_P HELX_P6 AA6 ASP A 92 ? SER A 96 ? ASP A 93 SER A 97 5 ? 5 HELX_P HELX_P7 AA7 ALA A 99 ? GLY A 114 ? ALA A 100 GLY A 115 1 ? 16 HELX_P HELX_P8 AA8 GLY A 118 ? TYR A 126 ? GLY A 119 TYR A 127 1 ? 9 HELX_P HELX_P9 AA9 SER A 130 ? GLY A 144 ? SER A 131 GLY A 145 1 ? 15 HELX_P HELX_P10 AB1 ASN A 145 ? GLY A 152 ? ASN A 146 GLY A 153 1 ? 8 HELX_P HELX_P11 AB2 ASP A 154 ? ARG A 164 ? ASP A 155 ARG A 165 1 ? 11 HELX_P HELX_P12 AB3 ARG A 164 ? THR A 179 ? ARG A 165 THR A 180 1 ? 16 HELX_P HELX_P13 AB4 ALA A 183 ? VAL A 205 ? ALA A 184 VAL A 206 1 ? 23 HELX_P HELX_P14 AB5 GLY A 209 ? SER A 223 ? GLY A 210 SER A 224 1 ? 15 HELX_P HELX_P15 AB6 ASN A 236 ? TYR A 241 ? ASN A 237 TYR A 242 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B BMA . O3 ? ? ? 1_555 B MRH . C1 ? ? B BMA 1 B MRH 2 1_555 ? ? ? ? ? ? ? 1.454 ? ? covale2 covale both ? B MRH . O3 ? ? ? 1_555 B MRH . C1 ? ? B MRH 2 B MRH 3 1_555 ? ? ? ? ? ? ? 1.456 ? ? covale3 covale both ? B MRH . O3 ? ? ? 1_555 B BMA . C1 ? ? B MRH 3 B BMA 4 1_555 ? ? ? ? ? ? ? 1.450 ? ? covale4 covale both ? B BMA . O3 ? ? ? 1_555 B MRH . C1 ? ? B BMA 4 B MRH 5 1_555 ? ? ? ? ? ? ? 1.449 ? ? covale5 covale both ? B MRH . O3 ? ? ? 1_555 B MRH . C1 ? ? B MRH 5 B MRH 6 1_555 ? ? ? ? ? ? ? 1.458 ? ? covale6 covale both ? B MRH . O3 ? ? ? 1_555 B BMA . C1 ? ? B MRH 6 B BMA 7 1_555 ? ? ? ? ? ? ? 1.440 ? ? covale7 covale both ? B BMA . O3 ? ? ? 1_555 B MRH . C1 ? ? B BMA 7 B MRH 8 1_555 ? ? ? ? ? ? ? 1.447 ? ? covale8 covale both ? B MRH . O3 ? ? ? 1_555 B MRH . C1 ? ? B MRH 8 B MRH 9 1_555 ? ? ? ? ? ? ? 1.455 ? ? covale9 covale both ? B MRH . O3 ? ? ? 1_555 B BMA . C1 ? ? B MRH 9 B BMA 10 1_555 ? ? ? ? ? ? ? 1.448 ? ? covale10 covale both ? B BMA . O3 ? ? ? 1_555 B MRH . C1 ? ? B BMA 10 B MRH 11 1_555 ? ? ? ? ? ? ? 1.449 ? ? covale11 covale both ? B MRH . O3 ? ? ? 1_555 B MRH . C1 ? ? B MRH 11 B MRH 12 1_555 ? ? ? ? ? ? ? 1.450 ? ? metalc1 metalc ? ? A LEU 16 O ? ? ? 1_555 D CA . CA ? ? A LEU 17 A CA 302 1_555 ? ? ? ? ? ? ? 2.895 ? ? metalc2 metalc ? ? A ASP 78 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 79 A CA 302 1_555 ? ? ? ? ? ? ? 3.189 ? ? metalc3 metalc ? ? A ASP 82 O ? ? ? 1_555 D CA . CA ? ? A ASP 83 A CA 302 1_555 ? ? ? ? ? ? ? 2.971 ? ? metalc4 metalc ? ? A ASP 82 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 83 A CA 302 1_555 ? ? ? ? ? ? ? 3.050 ? ? metalc5 metalc ? ? A SER 83 O ? ? ? 1_555 C CA . CA ? ? A SER 84 A CA 301 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc6 metalc ? ? A ASN 86 O ? ? ? 1_555 C CA . CA ? ? A ASN 87 A CA 301 1_555 ? ? ? ? ? ? ? 2.944 ? ? metalc7 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 90 A CA 301 1_555 ? ? ? ? ? ? ? 2.665 ? ? metalc8 metalc ? ? A ASP 92 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 93 A CA 301 1_555 ? ? ? ? ? ? ? 2.851 ? ? metalc9 metalc ? ? A ASP 221 O ? ? ? 1_555 E CA . CA ? ? A ASP 222 A CA 303 1_555 ? ? ? ? ? ? ? 2.999 ? ? metalc10 metalc ? ? A ASP 221 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 222 A CA 303 1_555 ? ? ? ? ? ? ? 2.473 ? ? metalc11 metalc ? ? A ASP 224 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 225 A CA 303 1_555 ? ? ? ? ? ? ? 2.835 ? ? metalc12 metalc ? ? A ASP 224 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 225 A CA 303 1_555 ? ? ? ? ? ? ? 2.996 ? ? metalc13 metalc ? ? A ALA 226 O ? ? ? 1_555 E CA . CA ? ? A ALA 227 A CA 303 1_555 ? ? ? ? ? ? ? 2.383 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A LEU 16 ? A LEU 17 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD1 ? A ASP 78 ? A ASP 79 ? 1_555 78.5 ? 2 O ? A LEU 16 ? A LEU 17 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? A ASP 82 ? A ASP 83 ? 1_555 83.0 ? 3 OD1 ? A ASP 78 ? A ASP 79 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 O ? A ASP 82 ? A ASP 83 ? 1_555 77.9 ? 4 O ? A LEU 16 ? A LEU 17 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD2 ? A ASP 82 ? A ASP 83 ? 1_555 59.6 ? 5 OD1 ? A ASP 78 ? A ASP 79 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD2 ? A ASP 82 ? A ASP 83 ? 1_555 124.4 ? 6 O ? A ASP 82 ? A ASP 83 ? 1_555 CA ? D CA . ? A CA 302 ? 1_555 OD2 ? A ASP 82 ? A ASP 83 ? 1_555 63.2 ? 7 O ? A SER 83 ? A SER 84 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 O ? A ASN 86 ? A ASN 87 ? 1_555 84.5 ? 8 O ? A SER 83 ? A SER 84 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD1 ? A ASP 89 ? A ASP 90 ? 1_555 96.8 ? 9 O ? A ASN 86 ? A ASN 87 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD1 ? A ASP 89 ? A ASP 90 ? 1_555 76.6 ? 10 O ? A SER 83 ? A SER 84 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD2 ? A ASP 92 ? A ASP 93 ? 1_555 144.7 ? 11 O ? A ASN 86 ? A ASN 87 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD2 ? A ASP 92 ? A ASP 93 ? 1_555 120.0 ? 12 OD1 ? A ASP 89 ? A ASP 90 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD2 ? A ASP 92 ? A ASP 93 ? 1_555 68.3 ? 13 O ? A ASP 221 ? A ASP 222 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 OD1 ? A ASP 221 ? A ASP 222 ? 1_555 59.1 ? 14 O ? A ASP 221 ? A ASP 222 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 OD1 ? A ASP 224 ? A ASP 225 ? 1_555 75.4 ? 15 OD1 ? A ASP 221 ? A ASP 222 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 OD1 ? A ASP 224 ? A ASP 225 ? 1_555 133.2 ? 16 O ? A ASP 221 ? A ASP 222 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 OD2 ? A ASP 224 ? A ASP 225 ? 1_555 70.7 ? 17 OD1 ? A ASP 221 ? A ASP 222 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 OD2 ? A ASP 224 ? A ASP 225 ? 1_555 105.4 ? 18 OD1 ? A ASP 224 ? A ASP 225 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 OD2 ? A ASP 224 ? A ASP 225 ? 1_555 44.3 ? 19 O ? A ASP 221 ? A ASP 222 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 O ? A ALA 226 ? A ALA 227 ? 1_555 66.5 ? 20 OD1 ? A ASP 221 ? A ASP 222 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 O ? A ALA 226 ? A ALA 227 ? 1_555 93.9 ? 21 OD1 ? A ASP 224 ? A ASP 225 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 O ? A ALA 226 ? A ALA 227 ? 1_555 76.1 ? 22 OD2 ? A ASP 224 ? A ASP 225 ? 1_555 CA ? E CA . ? A CA 303 ? 1_555 O ? A ALA 226 ? A ALA 227 ? 1_555 113.0 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ALA _pdbx_validate_close_contact.auth_seq_id_1 124 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 128 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 58 ? ? -103.75 -61.25 2 1 ASN A 92 ? ? -97.63 40.81 3 1 ASP A 231 ? ? 39.17 53.04 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 165 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.144 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_entry_details.entry_id 6T72 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _em_3d_fitting.entry_id 6T72 _em_3d_fitting.id 1 _em_3d_fitting.details ;The carbon backbone of the RsaA protein was manually traced through a single subunit of the cryo-EM density using Coot (Emsley et al., 2010). Initially, side chains were assigned in regions with density corresponding to characteristic aromatic residues allowing us to deduce the register of the amino acid sequence in the map. Side chains for residues 2-243 of RsaA were thus assigned unambiguously and the structure was refined and manually rebuilt using Refmac5 (Murshudov et al., 2011) inside the CCP-EM (Burnley et al., 2017) software suite and Coot. ; _em_3d_fitting.overall_b_value 85.819 _em_3d_fitting.ref_protocol 'BACKBONE TRACE' _em_3d_fitting.ref_space RECIPROCAL _em_3d_fitting.target_criteria 'Best fit' _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 6T72 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm 'FOURIER SPACE' _em_3d_reconstruction.details ;Particles from two main 3D classes containing 21 or 20 RsaA subunits were combined for a focused 3D auto refinement on the central 14 subunits using the output from the 3D classification as a starting model. The final map was obtained from 115,776 particles and post-processed using a soft mask focused on the inner fourteen subunits. ; _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages 2 _em_3d_reconstruction.num_particles 115776 _em_3d_reconstruction.resolution 3.7 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ;Buffer solutions were prepared fresh from sterile filtered concentrated stocksolutions. Solutions were filtered through a 0.22 um filter to avoid microbial contamination and degassed using a vacuum fold pump. The pH of the HEPES stock solution was adjusted with sodium hydroxide at 4 deg C. ; _em_buffer.pH 7.5 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details 'Structure of RsaA N-terminal domain bound to LPS' _em_entity_assembly.name 'Structure of RsaA N-terminal domain bound to LPS' _em_entity_assembly.source NATURAL _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_image_scans.entry_id 6T72 _em_image_scans.id 1 _em_image_scans.dimension_height 3710 _em_image_scans.dimension_width 3838 _em_image_scans.frames_per_image 20 _em_image_scans.image_recording_id 1 _em_image_scans.sampling_size ? _em_image_scans.scanner_model ? _em_image_scans.used_frames_per_image 1-20 _em_image_scans.citation_id ? _em_image_scans.number_digital_images ? _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.details ? # _em_imaging.id 1 _em_imaging.entry_id 6T72 _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure 'ZEMLIN TABLEAU' _em_imaging.c2_aperture_diameter 50 _em_imaging.calibrated_defocus_max -4000 _em_imaging.calibrated_defocus_min -1000 _em_imaging.calibrated_magnification 130000 _em_imaging.cryogen NITROGEN _em_imaging.details 'EPU software' _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_max -4000 _em_imaging.nominal_defocus_min -1000 _em_imaging.nominal_magnification 130000 _em_imaging.recording_temperature_maximum 70 _em_imaging.recording_temperature_minimum 70 _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details '20 seconds, 15 mA' _em_sample_support.grid_material COPPER/RHODIUM _em_sample_support.grid_mesh_size 200 _em_sample_support.grid_type 'Quantifoil R2/2' _em_sample_support.method ? _em_sample_support.film_material ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 283.15 _em_vitrification.cryogen_name ETHANE _em_vitrification.details ;Vitrobot options: Blot time 3 seconds, Blot force -13,1, Wait time 10 seconds, Drain time 0.5 seconds, ; _em_vitrification.humidity 100 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.entry_id 6T72 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 6T72 _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 6T72 _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry C1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 244 ? A SER 243 2 1 Y 1 A SER 245 ? A SER 244 3 1 Y 1 A GLY 246 ? A GLY 245 4 1 Y 1 A VAL 247 ? A VAL 246 5 1 Y 1 A SER 248 ? A SER 247 6 1 Y 1 A GLY 249 ? A GLY 248 7 1 Y 1 A SER 250 ? A SER 249 8 1 Y 1 A GLU 251 ? A GLU 250 9 1 Y 1 A ASN 252 ? A ASN 251 10 1 Y 1 A LEU 253 ? A LEU 252 11 1 Y 1 A TYR 254 ? A TYR 253 12 1 Y 1 A PHE 255 ? A PHE 254 13 1 Y 1 A GLN 256 ? A GLN 255 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BMA C1 C N R 74 BMA C2 C N S 75 BMA C3 C N S 76 BMA C4 C N S 77 BMA C5 C N R 78 BMA C6 C N N 79 BMA O1 O N N 80 BMA O2 O N N 81 BMA O3 O N N 82 BMA O4 O N N 83 BMA O5 O N N 84 BMA O6 O N N 85 BMA H1 H N N 86 BMA H2 H N N 87 BMA H3 H N N 88 BMA H4 H N N 89 BMA H5 H N N 90 BMA H61 H N N 91 BMA H62 H N N 92 BMA HO1 H N N 93 BMA HO2 H N N 94 BMA HO3 H N N 95 BMA HO4 H N N 96 BMA HO6 H N N 97 CA CA CA N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 MRH C1 C N S 237 MRH O5 O N N 238 MRH C5 C N R 239 MRH C6 C N N 240 MRH C4 C N S 241 MRH N4 N N N 242 MRH C7 C N N 243 MRH C8 C N N 244 MRH O7 O N N 245 MRH C3 C N S 246 MRH O3 O N N 247 MRH C2 C N S 248 MRH O2 O N N 249 MRH O1 O N N 250 MRH H1 H N N 251 MRH H5 H N N 252 MRH H61 H N N 253 MRH H62 H N N 254 MRH H5A H N N 255 MRH H4 H N N 256 MRH H7 H N N 257 MRH H8 H N N 258 MRH H9 H N N 259 MRH H10 H N N 260 MRH H3 H N N 261 MRH HO3 H N N 262 MRH H2 H N N 263 MRH HO2 H N N 264 MRH HO1 H N N 265 PHE N N N N 266 PHE CA C N S 267 PHE C C N N 268 PHE O O N N 269 PHE CB C N N 270 PHE CG C Y N 271 PHE CD1 C Y N 272 PHE CD2 C Y N 273 PHE CE1 C Y N 274 PHE CE2 C Y N 275 PHE CZ C Y N 276 PHE OXT O N N 277 PHE H H N N 278 PHE H2 H N N 279 PHE HA H N N 280 PHE HB2 H N N 281 PHE HB3 H N N 282 PHE HD1 H N N 283 PHE HD2 H N N 284 PHE HE1 H N N 285 PHE HE2 H N N 286 PHE HZ H N N 287 PHE HXT H N N 288 PRO N N N N 289 PRO CA C N S 290 PRO C C N N 291 PRO O O N N 292 PRO CB C N N 293 PRO CG C N N 294 PRO CD C N N 295 PRO OXT O N N 296 PRO H H N N 297 PRO HA H N N 298 PRO HB2 H N N 299 PRO HB3 H N N 300 PRO HG2 H N N 301 PRO HG3 H N N 302 PRO HD2 H N N 303 PRO HD3 H N N 304 PRO HXT H N N 305 SER N N N N 306 SER CA C N S 307 SER C C N N 308 SER O O N N 309 SER CB C N N 310 SER OG O N N 311 SER OXT O N N 312 SER H H N N 313 SER H2 H N N 314 SER HA H N N 315 SER HB2 H N N 316 SER HB3 H N N 317 SER HG H N N 318 SER HXT H N N 319 THR N N N N 320 THR CA C N S 321 THR C C N N 322 THR O O N N 323 THR CB C N R 324 THR OG1 O N N 325 THR CG2 C N N 326 THR OXT O N N 327 THR H H N N 328 THR H2 H N N 329 THR HA H N N 330 THR HB H N N 331 THR HG1 H N N 332 THR HG21 H N N 333 THR HG22 H N N 334 THR HG23 H N N 335 THR HXT H N N 336 TYR N N N N 337 TYR CA C N S 338 TYR C C N N 339 TYR O O N N 340 TYR CB C N N 341 TYR CG C Y N 342 TYR CD1 C Y N 343 TYR CD2 C Y N 344 TYR CE1 C Y N 345 TYR CE2 C Y N 346 TYR CZ C Y N 347 TYR OH O N N 348 TYR OXT O N N 349 TYR H H N N 350 TYR H2 H N N 351 TYR HA H N N 352 TYR HB2 H N N 353 TYR HB3 H N N 354 TYR HD1 H N N 355 TYR HD2 H N N 356 TYR HE1 H N N 357 TYR HE2 H N N 358 TYR HH H N N 359 TYR HXT H N N 360 VAL N N N N 361 VAL CA C N S 362 VAL C C N N 363 VAL O O N N 364 VAL CB C N N 365 VAL CG1 C N N 366 VAL CG2 C N N 367 VAL OXT O N N 368 VAL H H N N 369 VAL H2 H N N 370 VAL HA H N N 371 VAL HB H N N 372 VAL HG11 H N N 373 VAL HG12 H N N 374 VAL HG13 H N N 375 VAL HG21 H N N 376 VAL HG22 H N N 377 VAL HG23 H N N 378 VAL HXT H N N 379 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BMA C1 C2 sing N N 70 BMA C1 O1 sing N N 71 BMA C1 O5 sing N N 72 BMA C1 H1 sing N N 73 BMA C2 C3 sing N N 74 BMA C2 O2 sing N N 75 BMA C2 H2 sing N N 76 BMA C3 C4 sing N N 77 BMA C3 O3 sing N N 78 BMA C3 H3 sing N N 79 BMA C4 C5 sing N N 80 BMA C4 O4 sing N N 81 BMA C4 H4 sing N N 82 BMA C5 C6 sing N N 83 BMA C5 O5 sing N N 84 BMA C5 H5 sing N N 85 BMA C6 O6 sing N N 86 BMA C6 H61 sing N N 87 BMA C6 H62 sing N N 88 BMA O1 HO1 sing N N 89 BMA O2 HO2 sing N N 90 BMA O3 HO3 sing N N 91 BMA O4 HO4 sing N N 92 BMA O6 HO6 sing N N 93 GLN N CA sing N N 94 GLN N H sing N N 95 GLN N H2 sing N N 96 GLN CA C sing N N 97 GLN CA CB sing N N 98 GLN CA HA sing N N 99 GLN C O doub N N 100 GLN C OXT sing N N 101 GLN CB CG sing N N 102 GLN CB HB2 sing N N 103 GLN CB HB3 sing N N 104 GLN CG CD sing N N 105 GLN CG HG2 sing N N 106 GLN CG HG3 sing N N 107 GLN CD OE1 doub N N 108 GLN CD NE2 sing N N 109 GLN NE2 HE21 sing N N 110 GLN NE2 HE22 sing N N 111 GLN OXT HXT sing N N 112 GLU N CA sing N N 113 GLU N H sing N N 114 GLU N H2 sing N N 115 GLU CA C sing N N 116 GLU CA CB sing N N 117 GLU CA HA sing N N 118 GLU C O doub N N 119 GLU C OXT sing N N 120 GLU CB CG sing N N 121 GLU CB HB2 sing N N 122 GLU CB HB3 sing N N 123 GLU CG CD sing N N 124 GLU CG HG2 sing N N 125 GLU CG HG3 sing N N 126 GLU CD OE1 doub N N 127 GLU CD OE2 sing N N 128 GLU OE2 HE2 sing N N 129 GLU OXT HXT sing N N 130 GLY N CA sing N N 131 GLY N H sing N N 132 GLY N H2 sing N N 133 GLY CA C sing N N 134 GLY CA HA2 sing N N 135 GLY CA HA3 sing N N 136 GLY C O doub N N 137 GLY C OXT sing N N 138 GLY OXT HXT sing N N 139 ILE N CA sing N N 140 ILE N H sing N N 141 ILE N H2 sing N N 142 ILE CA C sing N N 143 ILE CA CB sing N N 144 ILE CA HA sing N N 145 ILE C O doub N N 146 ILE C OXT sing N N 147 ILE CB CG1 sing N N 148 ILE CB CG2 sing N N 149 ILE CB HB sing N N 150 ILE CG1 CD1 sing N N 151 ILE CG1 HG12 sing N N 152 ILE CG1 HG13 sing N N 153 ILE CG2 HG21 sing N N 154 ILE CG2 HG22 sing N N 155 ILE CG2 HG23 sing N N 156 ILE CD1 HD11 sing N N 157 ILE CD1 HD12 sing N N 158 ILE CD1 HD13 sing N N 159 ILE OXT HXT sing N N 160 LEU N CA sing N N 161 LEU N H sing N N 162 LEU N H2 sing N N 163 LEU CA C sing N N 164 LEU CA CB sing N N 165 LEU CA HA sing N N 166 LEU C O doub N N 167 LEU C OXT sing N N 168 LEU CB CG sing N N 169 LEU CB HB2 sing N N 170 LEU CB HB3 sing N N 171 LEU CG CD1 sing N N 172 LEU CG CD2 sing N N 173 LEU CG HG sing N N 174 LEU CD1 HD11 sing N N 175 LEU CD1 HD12 sing N N 176 LEU CD1 HD13 sing N N 177 LEU CD2 HD21 sing N N 178 LEU CD2 HD22 sing N N 179 LEU CD2 HD23 sing N N 180 LEU OXT HXT sing N N 181 LYS N CA sing N N 182 LYS N H sing N N 183 LYS N H2 sing N N 184 LYS CA C sing N N 185 LYS CA CB sing N N 186 LYS CA HA sing N N 187 LYS C O doub N N 188 LYS C OXT sing N N 189 LYS CB CG sing N N 190 LYS CB HB2 sing N N 191 LYS CB HB3 sing N N 192 LYS CG CD sing N N 193 LYS CG HG2 sing N N 194 LYS CG HG3 sing N N 195 LYS CD CE sing N N 196 LYS CD HD2 sing N N 197 LYS CD HD3 sing N N 198 LYS CE NZ sing N N 199 LYS CE HE2 sing N N 200 LYS CE HE3 sing N N 201 LYS NZ HZ1 sing N N 202 LYS NZ HZ2 sing N N 203 LYS NZ HZ3 sing N N 204 LYS OXT HXT sing N N 205 MET N CA sing N N 206 MET N H sing N N 207 MET N H2 sing N N 208 MET CA C sing N N 209 MET CA CB sing N N 210 MET CA HA sing N N 211 MET C O doub N N 212 MET C OXT sing N N 213 MET CB CG sing N N 214 MET CB HB2 sing N N 215 MET CB HB3 sing N N 216 MET CG SD sing N N 217 MET CG HG2 sing N N 218 MET CG HG3 sing N N 219 MET SD CE sing N N 220 MET CE HE1 sing N N 221 MET CE HE2 sing N N 222 MET CE HE3 sing N N 223 MET OXT HXT sing N N 224 MRH C6 C5 sing N N 225 MRH O5 C1 sing N N 226 MRH O5 C5 sing N N 227 MRH C1 C2 sing N N 228 MRH C5 C4 sing N N 229 MRH C8 C7 sing N N 230 MRH O7 C7 doub N N 231 MRH C7 N4 sing N N 232 MRH C2 O2 sing N N 233 MRH C2 C3 sing N N 234 MRH C4 N4 sing N N 235 MRH C4 C3 sing N N 236 MRH C3 O3 sing N N 237 MRH C1 O1 sing N N 238 MRH C1 H1 sing N N 239 MRH C5 H5 sing N N 240 MRH C6 H61 sing N N 241 MRH C6 H62 sing N N 242 MRH C6 H5A sing N N 243 MRH C4 H4 sing N N 244 MRH N4 H7 sing N N 245 MRH C8 H8 sing N N 246 MRH C8 H9 sing N N 247 MRH C8 H10 sing N N 248 MRH C3 H3 sing N N 249 MRH O3 HO3 sing N N 250 MRH C2 H2 sing N N 251 MRH O2 HO2 sing N N 252 MRH O1 HO1 sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TYR N CA sing N N 323 TYR N H sing N N 324 TYR N H2 sing N N 325 TYR CA C sing N N 326 TYR CA CB sing N N 327 TYR CA HA sing N N 328 TYR C O doub N N 329 TYR C OXT sing N N 330 TYR CB CG sing N N 331 TYR CB HB2 sing N N 332 TYR CB HB3 sing N N 333 TYR CG CD1 doub Y N 334 TYR CG CD2 sing Y N 335 TYR CD1 CE1 sing Y N 336 TYR CD1 HD1 sing N N 337 TYR CD2 CE2 doub Y N 338 TYR CD2 HD2 sing N N 339 TYR CE1 CZ doub Y N 340 TYR CE1 HE1 sing N N 341 TYR CE2 CZ sing Y N 342 TYR CE2 HE2 sing N N 343 TYR CZ OH sing N N 344 TYR OH HH sing N N 345 TYR OXT HXT sing N N 346 VAL N CA sing N N 347 VAL N H sing N N 348 VAL N H2 sing N N 349 VAL CA C sing N N 350 VAL CA CB sing N N 351 VAL CA HA sing N N 352 VAL C O doub N N 353 VAL C OXT sing N N 354 VAL CB CG1 sing N N 355 VAL CB CG2 sing N N 356 VAL CB HB sing N N 357 VAL CG1 HG11 sing N N 358 VAL CG1 HG12 sing N N 359 VAL CG1 HG13 sing N N 360 VAL CG2 HG21 sing N N 361 VAL CG2 HG22 sing N N 362 VAL CG2 HG23 sing N N 363 VAL OXT HXT sing N N 364 # loop_ _em_buffer_component.buffer_id _em_buffer_component.id _em_buffer_component.concentration _em_buffer_component.concentration_units _em_buffer_component.formula _em_buffer_component.name 1 1 25 mM C8H18N2O4S HEPES 1 2 100 mM NaCl 'sodium chloride' 1 3 1 mM MgCl2 'magnesium chloride' 1 4 1 mM CaCl2 'calcium chloride' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details 'RELION refinement with in-built CTF correction. The function is similar to a Wiener filter, so amplitude correction included.' # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag YES _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 0.577 # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 190650 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Caulobacter vibrioides CB15' _em_entity_assembly_naturalsource.strain YB1001 _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ;Movies were motion corrected and dose weighted with MotionCor2 (Zheng et al., 2017) implemented in Relion 3.0 (Zivanov et al., 2018). Contrast transfer functions (CTFs) of the resulting motion corrected micrographs were estimated using CTFFIND4 (Rohou and Grigorieff, 2015). ; # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 43 _em_image_recording.average_exposure_time 8.0 _em_image_recording.details ;Images were collected in movie-mode and subjected to 8 seconds of exposure where a total dose of 43 e-/A2 was applied, and 20 frames were recorded per movie. ; _em_image_recording.detector_mode COUNTING _em_image_recording.film_or_detector_model 'GATAN K2 SUMMIT (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged 1 _em_image_recording.num_real_images 2422 # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector . _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name 'GIF Quantum LS' _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.energyfilter_slit_width 20 _em_imaging_optics.phase_plate . _em_imaging_optics.sph_aberration_corrector . # _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.details ;Particles were automatically picked from the motion and CTF corrected micrographs using the AutoPick function in Relion 3.0 (Zivanov et al., 2018). As particle reference a 3 dimensional reconstruction from an earlier dataset with different pixelsize was used which was reconstructed using an unbiased subtomogram average structure of the same sample. ; _em_particle_selection.method ? _em_particle_selection.num_particles_selected 129633 _em_particle_selection.reference_model ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' 'RELION was used throughout the entire single particle analysis.' RELION 3.0 1 ? ? 2 'IMAGE ACQUISITION' ? EPU ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' 'CTFFIND was used as implemented in Relion 3.0' CTFFIND 4.1.13 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? Coot 0.9-pre ? 1 ? 8 OTHER ? ? ? ? ? ? 9 'INITIAL EULER ASSIGNMENT' ? RELION 3.0 1 ? ? 10 'FINAL EULER ASSIGNMENT' ? RELION 3.0 1 ? ? 11 CLASSIFICATION ? RELION 3.0 1 ? ? 12 RECONSTRUCTION ? RELION 3.0 1 ? ? 13 'MODEL REFINEMENT' ? REFMAC 5 ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration 2.5 _em_specimen.details 'RsaA N-terminal domain with LPS' _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 202231/Z/16/Z _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BMA 1 n 2 MRH 2 n 2 MRH 3 n 2 BMA 4 n 2 MRH 5 n 2 MRH 6 n 2 BMA 7 n 2 MRH 8 n 2 MRH 9 n 2 BMA 10 n 2 MRH 11 n 2 MRH 12 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 BMA ? ? BMA ? ? 'SUBJECT OF INVESTIGATION' ? 2 CA ? ? CA ? ? 'SUBJECT OF INVESTIGATION' ? 3 MRH ? ? MRH ? ? 'SUBJECT OF INVESTIGATION' ? # _atom_sites.entry_id 6T72 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S # loop_