data_6TG8 # _entry.id 6TG8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TG8 pdb_00006tg8 10.2210/pdb6tg8/pdb WWPDB D_1292105391 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-16 2 'Structure model' 1 1 2020-09-23 3 'Structure model' 1 2 2021-10-27 4 'Structure model' 1 3 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_database_proc 6 4 'Structure model' atom_type 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_first' 2 2 'Structure model' '_citation.page_last' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_citation.journal_volume' 7 3 'Structure model' '_citation.page_first' 8 3 'Structure model' '_citation.page_last' 9 3 'Structure model' '_citation.year' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_database_2.pdbx_database_accession' 12 4 'Structure model' '_atom_type.pdbx_N_electrons' 13 4 'Structure model' '_atom_type.pdbx_scat_Z' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6TG8 _pdbx_database_status.recvd_initial_deposition_date 2019-11-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kekez, I.' 1 0000-0001-8690-5465 'Matic, S.' 2 ? 'Tomic, S.' 3 ? 'Matkovic-Calogovic, D.' 4 0000-0003-4909-8312 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biomol.Struct.Dyn. _citation.journal_id_ASTM JBSDD6 _citation.journal_id_CSD 0646 _citation.journal_id_ISSN 1538-0254 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 39 _citation.language ? _citation.page_first 6870 _citation.page_last 6881 _citation.title 'Binding of dipeptidyl peptidase III to the oxidative stress cell sensor Kelch-like ECH-associated protein 1 is a two-step process.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1080/07391102.2020.1804455 _citation.pdbx_database_id_PubMed 32811353 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Matic, S.' 1 ? primary 'Kekez, I.' 2 ? primary 'Tomin, M.' 3 ? primary 'Bogar, F.' 4 ? primary 'Supljika, F.' 5 ? primary 'Kazazic, S.' 6 ? primary 'Hanic, M.' 7 ? primary 'Jha, S.' 8 ? primary 'Brkic, H.' 9 ? primary 'Bourgeois, B.' 10 ? primary 'Madl, T.' 11 ? primary 'Gruber, K.' 12 ? primary 'Macheroux, P.' 13 ? primary 'Matkovic-Calogovic, D.' 14 ? primary 'Matovina, M.' 15 ? primary 'Tomic, S.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Kelch-like ECH-associated protein 1' 31583.299 1 ? ? ? ? 2 polymer syn VAL-ILE-ASN-PRO-GLU-THR-GLY-GLU-GLN-ILE-GLN 1227.320 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytosolic inhibitor of Nrf2,INrf2,Kelch-like protein 19' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;PKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTN QWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGT NRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITV HQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT ; ;PKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTN QWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGT NRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITV HQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT ; AAA ? 2 'polypeptide(L)' no no VINPETGEQIQ VINPETGEQIQ PPP ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SODIUM ION' NA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 LYS n 1 3 VAL n 1 4 GLY n 1 5 ARG n 1 6 LEU n 1 7 ILE n 1 8 TYR n 1 9 THR n 1 10 ALA n 1 11 GLY n 1 12 GLY n 1 13 TYR n 1 14 PHE n 1 15 ARG n 1 16 GLN n 1 17 SER n 1 18 LEU n 1 19 SER n 1 20 TYR n 1 21 LEU n 1 22 GLU n 1 23 ALA n 1 24 TYR n 1 25 ASN n 1 26 PRO n 1 27 SER n 1 28 ASP n 1 29 GLY n 1 30 THR n 1 31 TRP n 1 32 LEU n 1 33 ARG n 1 34 LEU n 1 35 ALA n 1 36 ASP n 1 37 LEU n 1 38 GLN n 1 39 VAL n 1 40 PRO n 1 41 ARG n 1 42 SER n 1 43 GLY n 1 44 LEU n 1 45 ALA n 1 46 GLY n 1 47 CYS n 1 48 VAL n 1 49 VAL n 1 50 GLY n 1 51 GLY n 1 52 LEU n 1 53 LEU n 1 54 TYR n 1 55 ALA n 1 56 VAL n 1 57 GLY n 1 58 GLY n 1 59 ARG n 1 60 ASN n 1 61 ASN n 1 62 SER n 1 63 PRO n 1 64 ASP n 1 65 GLY n 1 66 ASN n 1 67 THR n 1 68 ASP n 1 69 SER n 1 70 SER n 1 71 ALA n 1 72 LEU n 1 73 ASP n 1 74 CYS n 1 75 TYR n 1 76 ASN n 1 77 PRO n 1 78 MET n 1 79 THR n 1 80 ASN n 1 81 GLN n 1 82 TRP n 1 83 SER n 1 84 PRO n 1 85 CYS n 1 86 ALA n 1 87 PRO n 1 88 MET n 1 89 SER n 1 90 VAL n 1 91 PRO n 1 92 ARG n 1 93 ASN n 1 94 ARG n 1 95 ILE n 1 96 GLY n 1 97 VAL n 1 98 GLY n 1 99 VAL n 1 100 ILE n 1 101 ASP n 1 102 GLY n 1 103 HIS n 1 104 ILE n 1 105 TYR n 1 106 ALA n 1 107 VAL n 1 108 GLY n 1 109 GLY n 1 110 SER n 1 111 HIS n 1 112 GLY n 1 113 CYS n 1 114 ILE n 1 115 HIS n 1 116 HIS n 1 117 ASN n 1 118 SER n 1 119 VAL n 1 120 GLU n 1 121 ARG n 1 122 TYR n 1 123 GLU n 1 124 PRO n 1 125 GLU n 1 126 ARG n 1 127 ASP n 1 128 GLU n 1 129 TRP n 1 130 HIS n 1 131 LEU n 1 132 VAL n 1 133 ALA n 1 134 PRO n 1 135 MET n 1 136 LEU n 1 137 THR n 1 138 ARG n 1 139 ARG n 1 140 ILE n 1 141 GLY n 1 142 VAL n 1 143 GLY n 1 144 VAL n 1 145 ALA n 1 146 VAL n 1 147 LEU n 1 148 ASN n 1 149 ARG n 1 150 LEU n 1 151 LEU n 1 152 TYR n 1 153 ALA n 1 154 VAL n 1 155 GLY n 1 156 GLY n 1 157 PHE n 1 158 ASP n 1 159 GLY n 1 160 THR n 1 161 ASN n 1 162 ARG n 1 163 LEU n 1 164 ASN n 1 165 SER n 1 166 ALA n 1 167 GLU n 1 168 CYS n 1 169 TYR n 1 170 TYR n 1 171 PRO n 1 172 GLU n 1 173 ARG n 1 174 ASN n 1 175 GLU n 1 176 TRP n 1 177 ARG n 1 178 MET n 1 179 ILE n 1 180 THR n 1 181 ALA n 1 182 MET n 1 183 ASN n 1 184 THR n 1 185 ILE n 1 186 ARG n 1 187 SER n 1 188 GLY n 1 189 ALA n 1 190 GLY n 1 191 VAL n 1 192 CYS n 1 193 VAL n 1 194 LEU n 1 195 HIS n 1 196 ASN n 1 197 CYS n 1 198 ILE n 1 199 TYR n 1 200 ALA n 1 201 ALA n 1 202 GLY n 1 203 GLY n 1 204 TYR n 1 205 ASP n 1 206 GLY n 1 207 GLN n 1 208 ASP n 1 209 GLN n 1 210 LEU n 1 211 ASN n 1 212 SER n 1 213 VAL n 1 214 GLU n 1 215 ARG n 1 216 TYR n 1 217 ASP n 1 218 VAL n 1 219 GLU n 1 220 THR n 1 221 GLU n 1 222 THR n 1 223 TRP n 1 224 THR n 1 225 PHE n 1 226 VAL n 1 227 ALA n 1 228 PRO n 1 229 MET n 1 230 LYS n 1 231 HIS n 1 232 ARG n 1 233 ARG n 1 234 SER n 1 235 ALA n 1 236 LEU n 1 237 GLY n 1 238 ILE n 1 239 THR n 1 240 VAL n 1 241 HIS n 1 242 GLN n 1 243 GLY n 1 244 ARG n 1 245 ILE n 1 246 TYR n 1 247 VAL n 1 248 LEU n 1 249 GLY n 1 250 GLY n 1 251 TYR n 1 252 ASP n 1 253 GLY n 1 254 HIS n 1 255 THR n 1 256 PHE n 1 257 LEU n 1 258 ASP n 1 259 SER n 1 260 VAL n 1 261 GLU n 1 262 CYS n 1 263 TYR n 1 264 ASP n 1 265 PRO n 1 266 ASP n 1 267 THR n 1 268 ASP n 1 269 THR n 1 270 TRP n 1 271 SER n 1 272 GLU n 1 273 VAL n 1 274 THR n 1 275 ARG n 1 276 MET n 1 277 THR n 1 278 SER n 1 279 GLY n 1 280 ARG n 1 281 SER n 1 282 GLY n 1 283 VAL n 1 284 GLY n 1 285 VAL n 1 286 ALA n 1 287 VAL n 1 288 THR n 2 1 VAL n 2 2 ILE n 2 3 ASN n 2 4 PRO n 2 5 GLU n 2 6 THR n 2 7 GLY n 2 8 GLU n 2 9 GLN n 2 10 ILE n 2 11 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 288 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KEAP1, INRF2, KIAA0132, KLHL19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 11 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 322 322 PRO PRO AAA . n A 1 2 LYS 2 323 323 LYS LYS AAA . n A 1 3 VAL 3 324 324 VAL VAL AAA . n A 1 4 GLY 4 325 325 GLY GLY AAA . n A 1 5 ARG 5 326 326 ARG ARG AAA . n A 1 6 LEU 6 327 327 LEU LEU AAA . n A 1 7 ILE 7 328 328 ILE ILE AAA . n A 1 8 TYR 8 329 329 TYR TYR AAA . n A 1 9 THR 9 330 330 THR THR AAA . n A 1 10 ALA 10 331 331 ALA ALA AAA . n A 1 11 GLY 11 332 332 GLY GLY AAA . n A 1 12 GLY 12 333 333 GLY GLY AAA . n A 1 13 TYR 13 334 334 TYR TYR AAA . n A 1 14 PHE 14 335 335 PHE PHE AAA . n A 1 15 ARG 15 336 336 ARG ARG AAA . n A 1 16 GLN 16 337 337 GLN GLN AAA . n A 1 17 SER 17 338 338 SER SER AAA . n A 1 18 LEU 18 339 339 LEU LEU AAA . n A 1 19 SER 19 340 340 SER SER AAA . n A 1 20 TYR 20 341 341 TYR TYR AAA . n A 1 21 LEU 21 342 342 LEU LEU AAA . n A 1 22 GLU 22 343 343 GLU GLU AAA . n A 1 23 ALA 23 344 344 ALA ALA AAA . n A 1 24 TYR 24 345 345 TYR TYR AAA . n A 1 25 ASN 25 346 346 ASN ASN AAA . n A 1 26 PRO 26 347 347 PRO PRO AAA . n A 1 27 SER 27 348 348 SER SER AAA . n A 1 28 ASP 28 349 349 ASP ASP AAA . n A 1 29 GLY 29 350 350 GLY GLY AAA . n A 1 30 THR 30 351 351 THR THR AAA . n A 1 31 TRP 31 352 352 TRP TRP AAA . n A 1 32 LEU 32 353 353 LEU LEU AAA . n A 1 33 ARG 33 354 354 ARG ARG AAA . n A 1 34 LEU 34 355 355 LEU LEU AAA . n A 1 35 ALA 35 356 356 ALA ALA AAA . n A 1 36 ASP 36 357 357 ASP ASP AAA . n A 1 37 LEU 37 358 358 LEU LEU AAA . n A 1 38 GLN 38 359 359 GLN GLN AAA . n A 1 39 VAL 39 360 360 VAL VAL AAA . n A 1 40 PRO 40 361 361 PRO PRO AAA . n A 1 41 ARG 41 362 362 ARG ARG AAA . n A 1 42 SER 42 363 363 SER SER AAA . n A 1 43 GLY 43 364 364 GLY GLY AAA . n A 1 44 LEU 44 365 365 LEU LEU AAA . n A 1 45 ALA 45 366 366 ALA ALA AAA . n A 1 46 GLY 46 367 367 GLY GLY AAA . n A 1 47 CYS 47 368 368 CYS CYS AAA . n A 1 48 VAL 48 369 369 VAL VAL AAA . n A 1 49 VAL 49 370 370 VAL VAL AAA . n A 1 50 GLY 50 371 371 GLY GLY AAA . n A 1 51 GLY 51 372 372 GLY GLY AAA . n A 1 52 LEU 52 373 373 LEU LEU AAA . n A 1 53 LEU 53 374 374 LEU LEU AAA . n A 1 54 TYR 54 375 375 TYR TYR AAA . n A 1 55 ALA 55 376 376 ALA ALA AAA . n A 1 56 VAL 56 377 377 VAL VAL AAA . n A 1 57 GLY 57 378 378 GLY GLY AAA . n A 1 58 GLY 58 379 379 GLY GLY AAA . n A 1 59 ARG 59 380 380 ARG ARG AAA . n A 1 60 ASN 60 381 381 ASN ASN AAA . n A 1 61 ASN 61 382 382 ASN ASN AAA . n A 1 62 SER 62 383 383 SER SER AAA . n A 1 63 PRO 63 384 384 PRO PRO AAA . n A 1 64 ASP 64 385 385 ASP ASP AAA . n A 1 65 GLY 65 386 386 GLY GLY AAA . n A 1 66 ASN 66 387 387 ASN ASN AAA . n A 1 67 THR 67 388 388 THR THR AAA . n A 1 68 ASP 68 389 389 ASP ASP AAA . n A 1 69 SER 69 390 390 SER SER AAA . n A 1 70 SER 70 391 391 SER SER AAA . n A 1 71 ALA 71 392 392 ALA ALA AAA . n A 1 72 LEU 72 393 393 LEU LEU AAA . n A 1 73 ASP 73 394 394 ASP ASP AAA . n A 1 74 CYS 74 395 395 CYS CYS AAA . n A 1 75 TYR 75 396 396 TYR TYR AAA . n A 1 76 ASN 76 397 397 ASN ASN AAA . n A 1 77 PRO 77 398 398 PRO PRO AAA . n A 1 78 MET 78 399 399 MET MET AAA . n A 1 79 THR 79 400 400 THR THR AAA . n A 1 80 ASN 80 401 401 ASN ASN AAA . n A 1 81 GLN 81 402 402 GLN GLN AAA . n A 1 82 TRP 82 403 403 TRP TRP AAA . n A 1 83 SER 83 404 404 SER SER AAA . n A 1 84 PRO 84 405 405 PRO PRO AAA . n A 1 85 CYS 85 406 406 CYS CYS AAA . n A 1 86 ALA 86 407 407 ALA ALA AAA . n A 1 87 PRO 87 408 408 PRO PRO AAA . n A 1 88 MET 88 409 409 MET MET AAA . n A 1 89 SER 89 410 410 SER SER AAA . n A 1 90 VAL 90 411 411 VAL VAL AAA . n A 1 91 PRO 91 412 412 PRO PRO AAA . n A 1 92 ARG 92 413 413 ARG ARG AAA . n A 1 93 ASN 93 414 414 ASN ASN AAA . n A 1 94 ARG 94 415 415 ARG ARG AAA . n A 1 95 ILE 95 416 416 ILE ILE AAA . n A 1 96 GLY 96 417 417 GLY GLY AAA . n A 1 97 VAL 97 418 418 VAL VAL AAA . n A 1 98 GLY 98 419 419 GLY GLY AAA . n A 1 99 VAL 99 420 420 VAL VAL AAA . n A 1 100 ILE 100 421 421 ILE ILE AAA . n A 1 101 ASP 101 422 422 ASP ASP AAA . n A 1 102 GLY 102 423 423 GLY GLY AAA . n A 1 103 HIS 103 424 424 HIS HIS AAA . n A 1 104 ILE 104 425 425 ILE ILE AAA . n A 1 105 TYR 105 426 426 TYR TYR AAA . n A 1 106 ALA 106 427 427 ALA ALA AAA . n A 1 107 VAL 107 428 428 VAL VAL AAA . n A 1 108 GLY 108 429 429 GLY GLY AAA . n A 1 109 GLY 109 430 430 GLY GLY AAA . n A 1 110 SER 110 431 431 SER SER AAA . n A 1 111 HIS 111 432 432 HIS HIS AAA . n A 1 112 GLY 112 433 433 GLY GLY AAA . n A 1 113 CYS 113 434 434 CYS CYS AAA . n A 1 114 ILE 114 435 435 ILE ILE AAA . n A 1 115 HIS 115 436 436 HIS HIS AAA . n A 1 116 HIS 116 437 437 HIS HIS AAA . n A 1 117 ASN 117 438 438 ASN ASN AAA . n A 1 118 SER 118 439 439 SER SER AAA . n A 1 119 VAL 119 440 440 VAL VAL AAA . n A 1 120 GLU 120 441 441 GLU GLU AAA . n A 1 121 ARG 121 442 442 ARG ARG AAA . n A 1 122 TYR 122 443 443 TYR TYR AAA . n A 1 123 GLU 123 444 444 GLU GLU AAA . n A 1 124 PRO 124 445 445 PRO PRO AAA . n A 1 125 GLU 125 446 446 GLU GLU AAA . n A 1 126 ARG 126 447 447 ARG ARG AAA . n A 1 127 ASP 127 448 448 ASP ASP AAA . n A 1 128 GLU 128 449 449 GLU GLU AAA . n A 1 129 TRP 129 450 450 TRP TRP AAA . n A 1 130 HIS 130 451 451 HIS HIS AAA . n A 1 131 LEU 131 452 452 LEU LEU AAA . n A 1 132 VAL 132 453 453 VAL VAL AAA . n A 1 133 ALA 133 454 454 ALA ALA AAA . n A 1 134 PRO 134 455 455 PRO PRO AAA . n A 1 135 MET 135 456 456 MET MET AAA . n A 1 136 LEU 136 457 457 LEU LEU AAA . n A 1 137 THR 137 458 458 THR THR AAA . n A 1 138 ARG 138 459 459 ARG ARG AAA . n A 1 139 ARG 139 460 460 ARG ARG AAA . n A 1 140 ILE 140 461 461 ILE ILE AAA . n A 1 141 GLY 141 462 462 GLY GLY AAA . n A 1 142 VAL 142 463 463 VAL VAL AAA . n A 1 143 GLY 143 464 464 GLY GLY AAA . n A 1 144 VAL 144 465 465 VAL VAL AAA . n A 1 145 ALA 145 466 466 ALA ALA AAA . n A 1 146 VAL 146 467 467 VAL VAL AAA . n A 1 147 LEU 147 468 468 LEU LEU AAA . n A 1 148 ASN 148 469 469 ASN ASN AAA . n A 1 149 ARG 149 470 470 ARG ARG AAA . n A 1 150 LEU 150 471 471 LEU LEU AAA . n A 1 151 LEU 151 472 472 LEU LEU AAA . n A 1 152 TYR 152 473 473 TYR TYR AAA . n A 1 153 ALA 153 474 474 ALA ALA AAA . n A 1 154 VAL 154 475 475 VAL VAL AAA . n A 1 155 GLY 155 476 476 GLY GLY AAA . n A 1 156 GLY 156 477 477 GLY GLY AAA . n A 1 157 PHE 157 478 478 PHE PHE AAA . n A 1 158 ASP 158 479 479 ASP ASP AAA . n A 1 159 GLY 159 480 480 GLY GLY AAA . n A 1 160 THR 160 481 481 THR THR AAA . n A 1 161 ASN 161 482 482 ASN ASN AAA . n A 1 162 ARG 162 483 483 ARG ARG AAA . n A 1 163 LEU 163 484 484 LEU LEU AAA . n A 1 164 ASN 164 485 485 ASN ASN AAA . n A 1 165 SER 165 486 486 SER SER AAA . n A 1 166 ALA 166 487 487 ALA ALA AAA . n A 1 167 GLU 167 488 488 GLU GLU AAA . n A 1 168 CYS 168 489 489 CYS CYS AAA . n A 1 169 TYR 169 490 490 TYR TYR AAA . n A 1 170 TYR 170 491 491 TYR TYR AAA . n A 1 171 PRO 171 492 492 PRO PRO AAA . n A 1 172 GLU 172 493 493 GLU GLU AAA . n A 1 173 ARG 173 494 494 ARG ARG AAA . n A 1 174 ASN 174 495 495 ASN ASN AAA . n A 1 175 GLU 175 496 496 GLU GLU AAA . n A 1 176 TRP 176 497 497 TRP TRP AAA . n A 1 177 ARG 177 498 498 ARG ARG AAA . n A 1 178 MET 178 499 499 MET MET AAA . n A 1 179 ILE 179 500 500 ILE ILE AAA . n A 1 180 THR 180 501 501 THR THR AAA . n A 1 181 ALA 181 502 502 ALA ALA AAA . n A 1 182 MET 182 503 503 MET MET AAA . n A 1 183 ASN 183 504 504 ASN ASN AAA . n A 1 184 THR 184 505 505 THR THR AAA . n A 1 185 ILE 185 506 506 ILE ILE AAA . n A 1 186 ARG 186 507 507 ARG ARG AAA . n A 1 187 SER 187 508 508 SER SER AAA . n A 1 188 GLY 188 509 509 GLY GLY AAA . n A 1 189 ALA 189 510 510 ALA ALA AAA . n A 1 190 GLY 190 511 511 GLY GLY AAA . n A 1 191 VAL 191 512 512 VAL VAL AAA . n A 1 192 CYS 192 513 513 CYS CYS AAA . n A 1 193 VAL 193 514 514 VAL VAL AAA . n A 1 194 LEU 194 515 515 LEU LEU AAA . n A 1 195 HIS 195 516 516 HIS HIS AAA . n A 1 196 ASN 196 517 517 ASN ASN AAA . n A 1 197 CYS 197 518 518 CYS CYS AAA . n A 1 198 ILE 198 519 519 ILE ILE AAA . n A 1 199 TYR 199 520 520 TYR TYR AAA . n A 1 200 ALA 200 521 521 ALA ALA AAA . n A 1 201 ALA 201 522 522 ALA ALA AAA . n A 1 202 GLY 202 523 523 GLY GLY AAA . n A 1 203 GLY 203 524 524 GLY GLY AAA . n A 1 204 TYR 204 525 525 TYR TYR AAA . n A 1 205 ASP 205 526 526 ASP ASP AAA . n A 1 206 GLY 206 527 527 GLY GLY AAA . n A 1 207 GLN 207 528 528 GLN GLN AAA . n A 1 208 ASP 208 529 529 ASP ASP AAA . n A 1 209 GLN 209 530 530 GLN GLN AAA . n A 1 210 LEU 210 531 531 LEU LEU AAA . n A 1 211 ASN 211 532 532 ASN ASN AAA . n A 1 212 SER 212 533 533 SER SER AAA . n A 1 213 VAL 213 534 534 VAL VAL AAA . n A 1 214 GLU 214 535 535 GLU GLU AAA . n A 1 215 ARG 215 536 536 ARG ARG AAA . n A 1 216 TYR 216 537 537 TYR TYR AAA . n A 1 217 ASP 217 538 538 ASP ASP AAA . n A 1 218 VAL 218 539 539 VAL VAL AAA . n A 1 219 GLU 219 540 540 GLU GLU AAA . n A 1 220 THR 220 541 541 THR THR AAA . n A 1 221 GLU 221 542 542 GLU GLU AAA . n A 1 222 THR 222 543 543 THR THR AAA . n A 1 223 TRP 223 544 544 TRP TRP AAA . n A 1 224 THR 224 545 545 THR THR AAA . n A 1 225 PHE 225 546 546 PHE PHE AAA . n A 1 226 VAL 226 547 547 VAL VAL AAA . n A 1 227 ALA 227 548 548 ALA ALA AAA . n A 1 228 PRO 228 549 549 PRO PRO AAA . n A 1 229 MET 229 550 550 MET MET AAA . n A 1 230 LYS 230 551 551 LYS LYS AAA . n A 1 231 HIS 231 552 552 HIS HIS AAA . n A 1 232 ARG 232 553 553 ARG ARG AAA . n A 1 233 ARG 233 554 554 ARG ARG AAA . n A 1 234 SER 234 555 555 SER SER AAA . n A 1 235 ALA 235 556 556 ALA ALA AAA . n A 1 236 LEU 236 557 557 LEU LEU AAA . n A 1 237 GLY 237 558 558 GLY GLY AAA . n A 1 238 ILE 238 559 559 ILE ILE AAA . n A 1 239 THR 239 560 560 THR THR AAA . n A 1 240 VAL 240 561 561 VAL VAL AAA . n A 1 241 HIS 241 562 562 HIS HIS AAA . n A 1 242 GLN 242 563 563 GLN GLN AAA . n A 1 243 GLY 243 564 564 GLY GLY AAA . n A 1 244 ARG 244 565 565 ARG ARG AAA . n A 1 245 ILE 245 566 566 ILE ILE AAA . n A 1 246 TYR 246 567 567 TYR TYR AAA . n A 1 247 VAL 247 568 568 VAL VAL AAA . n A 1 248 LEU 248 569 569 LEU LEU AAA . n A 1 249 GLY 249 570 570 GLY GLY AAA . n A 1 250 GLY 250 571 571 GLY GLY AAA . n A 1 251 TYR 251 572 572 TYR TYR AAA . n A 1 252 ASP 252 573 573 ASP ASP AAA . n A 1 253 GLY 253 574 574 GLY GLY AAA . n A 1 254 HIS 254 575 575 HIS HIS AAA . n A 1 255 THR 255 576 576 THR THR AAA . n A 1 256 PHE 256 577 577 PHE PHE AAA . n A 1 257 LEU 257 578 578 LEU LEU AAA . n A 1 258 ASP 258 579 579 ASP ASP AAA . n A 1 259 SER 259 580 580 SER SER AAA . n A 1 260 VAL 260 581 581 VAL VAL AAA . n A 1 261 GLU 261 582 582 GLU GLU AAA . n A 1 262 CYS 262 583 583 CYS CYS AAA . n A 1 263 TYR 263 584 584 TYR TYR AAA . n A 1 264 ASP 264 585 585 ASP ASP AAA . n A 1 265 PRO 265 586 586 PRO PRO AAA . n A 1 266 ASP 266 587 587 ASP ASP AAA . n A 1 267 THR 267 588 588 THR THR AAA . n A 1 268 ASP 268 589 589 ASP ASP AAA . n A 1 269 THR 269 590 590 THR THR AAA . n A 1 270 TRP 270 591 591 TRP TRP AAA . n A 1 271 SER 271 592 592 SER SER AAA . n A 1 272 GLU 272 593 593 GLU GLU AAA . n A 1 273 VAL 273 594 594 VAL VAL AAA . n A 1 274 THR 274 595 595 THR THR AAA . n A 1 275 ARG 275 596 596 ARG ARG AAA . n A 1 276 MET 276 597 597 MET MET AAA . n A 1 277 THR 277 598 598 THR THR AAA . n A 1 278 SER 278 599 599 SER SER AAA . n A 1 279 GLY 279 600 600 GLY GLY AAA . n A 1 280 ARG 280 601 601 ARG ARG AAA . n A 1 281 SER 281 602 602 SER SER AAA . n A 1 282 GLY 282 603 603 GLY GLY AAA . n A 1 283 VAL 283 604 604 VAL VAL AAA . n A 1 284 GLY 284 605 605 GLY GLY AAA . n A 1 285 VAL 285 606 606 VAL VAL AAA . n A 1 286 ALA 286 607 607 ALA ALA AAA . n A 1 287 VAL 287 608 608 VAL VAL AAA . n A 1 288 THR 288 609 609 THR THR AAA . n B 2 1 VAL 1 476 75 VAL VAL PPP . n B 2 2 ILE 2 477 76 ILE ILE PPP . n B 2 3 ASN 3 478 77 ASN ASN PPP . n B 2 4 PRO 4 479 78 PRO PRO PPP . n B 2 5 GLU 5 480 79 GLU GLU PPP . n B 2 6 THR 6 481 80 THR THR PPP . n B 2 7 GLY 7 482 81 GLY GLY PPP . n B 2 8 GLU 8 483 82 GLU GLU PPP . n B 2 9 GLN 9 484 83 GLN GLN PPP . n B 2 10 ILE 10 485 84 ILE ILE PPP . n B 2 11 GLN 11 486 85 GLN GLN PPP . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NA 1 701 10 NA NA AAA . D 4 HOH 1 801 2 HOH HOH AAA . D 4 HOH 2 802 7 HOH HOH AAA . D 4 HOH 3 803 1 HOH HOH AAA . D 4 HOH 4 804 5 HOH HOH AAA . D 4 HOH 5 805 9 HOH HOH AAA . D 4 HOH 6 806 3 HOH HOH AAA . D 4 HOH 7 807 8 HOH HOH AAA . D 4 HOH 8 808 6 HOH HOH AAA . D 4 HOH 9 809 4 HOH HOH AAA . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0257 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? 1.171.40.53 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 7.0.077 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? 7.0.077 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6TG8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.296 _cell.length_a_esd ? _cell.length_b 75.296 _cell.length_b_esd ? _cell.length_c 127.539 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6TG8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TG8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.8 M sodium acetate pH 7.0, 0.1 M Bis-Tris propane pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ELETTRA BEAMLINE 5.2R' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.2R _diffrn_source.pdbx_synchrotron_site ELETTRA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6TG8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.45 _reflns.d_resolution_low 65.208 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11948 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.1 _reflns.pdbx_Rmerge_I_obs 0.110 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 40.66 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1198 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.614 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.060 _refine.aniso_B[1][2] -0.030 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.060 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.196 _refine.B_iso_max ? _refine.B_iso_mean 69.133 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.963 _refine.correlation_coeff_Fo_to_Fc_free 0.923 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6TG8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.750 _refine.ls_d_res_low 17 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11310 _refine.ls_number_reflns_R_free 560 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.490 _refine.ls_percent_reflns_R_free 4.951 _refine.ls_R_factor_all 0.185 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2584 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1810 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1zgk _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.651 _refine.pdbx_overall_ESU_R_Free 0.337 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 18.237 _refine.overall_SU_ML 0.321 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.750 _refine_hist.d_res_low 17 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 2312 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2302 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 2381 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 2111 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.499 1.644 3246 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.212 1.572 4871 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.742 5.000 303 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.296 20.657 137 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.645 15.000 356 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.114 15.000 23 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.052 0.200 298 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2771 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 546 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.201 0.200 446 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 2181 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 1117 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.088 0.200 1125 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.129 0.200 45 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.243 0.200 4 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.157 0.200 17 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.215 0.200 2 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.891 7.152 1206 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.874 7.148 1205 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.247 10.730 1508 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.246 10.736 1509 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.518 7.848 1175 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.494 7.841 1173 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 8.655 11.528 1737 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.647 11.529 1737 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 10.990 82.487 2556 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 10.988 82.533 2557 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.750 2.820 . . 33 769 100.0000 . . . 0.390 . 0.390 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.820 2.896 . . 28 781 100.0000 . . . 0.388 . 0.341 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.896 2.978 . . 34 703 100.0000 . . . 0.468 . 0.315 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.978 3.067 . . 34 717 100.0000 . . . 0.283 . 0.288 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.067 3.165 . . 48 676 100.0000 . . . 0.431 . 0.262 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.165 3.274 . . 43 677 100.0000 . . . 0.310 . 0.250 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.274 3.394 . . 27 629 100.0000 . . . 0.332 . 0.230 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.394 3.528 . . 35 637 100.0000 . . . 0.330 . 0.215 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.528 3.680 . . 42 581 100.0000 . . . 0.287 . 0.198 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.680 3.853 . . 29 578 100.0000 . . . 0.288 . 0.178 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.853 4.053 . . 26 565 100.0000 . . . 0.176 . 0.164 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.053 4.288 . . 19 528 100.0000 . . . 0.163 . 0.120 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.288 4.569 . . 33 482 100.0000 . . . 0.186 . 0.114 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.569 4.914 . . 36 460 100.0000 . . . 0.169 . 0.105 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.914 5.350 . . 16 449 100.0000 . . . 0.231 . 0.118 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.350 5.929 . . 18 405 100.0000 . . . 0.282 . 0.159 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.929 6.748 . . 20 355 100.0000 . . . 0.296 . 0.189 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.748 8.039 . . 19 308 100.0000 . . . 0.255 . 0.201 . . . . . . . . . . . 'X-RAY DIFFRACTION' 8.039 10.549 . . 14 267 100.0000 . . . 0.213 . 0.148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 10.549 17.813 . . 4 181 92.9648 . . . 0.306 . 0.200 . . . . . . . . . . . # _struct.entry_id 6TG8 _struct.title 'Crystal structure of the Kelch domain in complex with 11 amino acid peptide (model of the ETGE loop)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TG8 _struct_keywords.text 'complex, beta proteins, Kelch motif, ligase' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KEAP1_HUMAN Q14145 ? 1 ;PKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTN QWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGT NRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITV HQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT ; 322 2 PDB 6TG8 6TG8 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6TG8 AAA 1 ? 288 ? Q14145 322 ? 609 ? 322 609 2 2 6TG8 PPP 1 ? 11 ? 6TG8 476 ? 486 ? 476 486 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1090 ? 1 MORE -9 ? 1 'SSA (A^2)' 12830 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 264 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 268 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id AAA _struct_conf.beg_auth_seq_id 585 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id AAA _struct_conf.end_auth_seq_id 589 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A THR 9 O ? ? ? 1_555 C NA . NA ? ? AAA THR 330 AAA NA 701 1_555 ? ? ? ? ? ? ? 3.158 ? ? metalc2 metalc ? ? A THR 9 OG1 ? ? ? 1_555 C NA . NA ? ? AAA THR 330 AAA NA 701 1_555 ? ? ? ? ? ? ? 3.050 ? ? metalc3 metalc ? ? A GLY 11 O ? ? ? 1_555 C NA . NA ? ? AAA GLY 332 AAA NA 701 1_555 ? ? ? ? ? ? ? 2.831 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A THR 9 ? AAA THR 330 ? 1_555 NA ? C NA . ? AAA NA 701 ? 1_555 OG1 ? A THR 9 ? AAA THR 330 ? 1_555 69.3 ? 2 O ? A THR 9 ? AAA THR 330 ? 1_555 NA ? C NA . ? AAA NA 701 ? 1_555 O ? A GLY 11 ? AAA GLY 332 ? 1_555 122.8 ? 3 OG1 ? A THR 9 ? AAA THR 330 ? 1_555 NA ? C NA . ? AAA NA 701 ? 1_555 O ? A GLY 11 ? AAA GLY 332 ? 1_555 112.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 4 ? AA5 ? 2 ? AA6 ? 4 ? AA7 ? 4 ? AA8 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA8 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 31 ? LEU A 34 ? TRP AAA 352 LEU AAA 355 AA1 2 LEU A 21 ? TYR A 24 ? LEU AAA 342 TYR AAA 345 AA1 3 LEU A 6 ? ALA A 10 ? LEU AAA 327 ALA AAA 331 AA1 4 GLY A 284 ? THR A 288 ? GLY AAA 605 THR AAA 609 AA2 1 ALA A 45 ? VAL A 49 ? ALA AAA 366 VAL AAA 370 AA2 2 LEU A 52 ? VAL A 56 ? LEU AAA 373 VAL AAA 377 AA2 3 LEU A 72 ? ASN A 76 ? LEU AAA 393 ASN AAA 397 AA2 4 GLN A 81 ? CYS A 85 ? GLN AAA 402 CYS AAA 406 AA3 1 ARG A 59 ? ASN A 61 ? ARG AAA 380 ASN AAA 382 AA3 2 ASN A 66 ? ASP A 68 ? ASN AAA 387 ASP AAA 389 AA4 1 GLY A 96 ? ILE A 100 ? GLY AAA 417 ILE AAA 421 AA4 2 HIS A 103 ? VAL A 107 ? HIS AAA 424 VAL AAA 428 AA4 3 VAL A 119 ? GLU A 123 ? VAL AAA 440 GLU AAA 444 AA4 4 GLU A 128 ? LEU A 131 ? GLU AAA 449 LEU AAA 452 AA5 1 SER A 110 ? HIS A 111 ? SER AAA 431 HIS AAA 432 AA5 2 ILE A 114 ? HIS A 115 ? ILE AAA 435 HIS AAA 436 AA6 1 GLY A 143 ? LEU A 147 ? GLY AAA 464 LEU AAA 468 AA6 2 LEU A 150 ? PHE A 157 ? LEU AAA 471 PHE AAA 478 AA6 3 ARG A 162 ? TYR A 170 ? ARG AAA 483 TYR AAA 491 AA6 4 GLU A 175 ? ILE A 179 ? GLU AAA 496 ILE AAA 500 AA7 1 GLY A 190 ? LEU A 194 ? GLY AAA 511 LEU AAA 515 AA7 2 CYS A 197 ? ALA A 201 ? CYS AAA 518 ALA AAA 522 AA7 3 VAL A 213 ? ASP A 217 ? VAL AAA 534 ASP AAA 538 AA7 4 THR A 222 ? VAL A 226 ? THR AAA 543 VAL AAA 547 AA8 1 GLY A 237 ? HIS A 241 ? GLY AAA 558 HIS AAA 562 AA8 2 ARG A 244 ? TYR A 251 ? ARG AAA 565 TYR AAA 572 AA8 3 PHE A 256 ? TYR A 263 ? PHE AAA 577 TYR AAA 584 AA8 4 GLU A 272 ? ARG A 275 ? GLU AAA 593 ARG AAA 596 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 32 ? O LEU AAA 353 N ALA A 23 ? N ALA AAA 344 AA1 2 3 O GLU A 22 ? O GLU AAA 343 N THR A 9 ? N THR AAA 330 AA1 3 4 N ALA A 10 ? N ALA AAA 331 O GLY A 284 ? O GLY AAA 605 AA2 1 2 N CYS A 47 ? N CYS AAA 368 O TYR A 54 ? O TYR AAA 375 AA2 2 3 N LEU A 53 ? N LEU AAA 374 O TYR A 75 ? O TYR AAA 396 AA2 3 4 N CYS A 74 ? N CYS AAA 395 O SER A 83 ? O SER AAA 404 AA3 1 2 N ASN A 60 ? N ASN AAA 381 O THR A 67 ? O THR AAA 388 AA4 1 2 N GLY A 96 ? N GLY AAA 417 O VAL A 107 ? O VAL AAA 428 AA4 2 3 N ILE A 104 ? N ILE AAA 425 O TYR A 122 ? O TYR AAA 443 AA4 3 4 N ARG A 121 ? N ARG AAA 442 O HIS A 130 ? O HIS AAA 451 AA5 1 2 N HIS A 111 ? N HIS AAA 432 O ILE A 114 ? O ILE AAA 435 AA6 1 2 N GLY A 143 ? N GLY AAA 464 O VAL A 154 ? O VAL AAA 475 AA6 2 3 N LEU A 151 ? N LEU AAA 472 O TYR A 169 ? O TYR AAA 490 AA6 3 4 N ALA A 166 ? N ALA AAA 487 O ILE A 179 ? O ILE AAA 500 AA7 1 2 N GLY A 190 ? N GLY AAA 511 O ALA A 201 ? O ALA AAA 522 AA7 2 3 N ILE A 198 ? N ILE AAA 519 O TYR A 216 ? O TYR AAA 537 AA7 3 4 N VAL A 213 ? N VAL AAA 534 O VAL A 226 ? O VAL AAA 547 AA8 1 2 N GLY A 237 ? N GLY AAA 558 O LEU A 248 ? O LEU AAA 569 AA8 2 3 N GLY A 249 ? N GLY AAA 570 O SER A 259 ? O SER AAA 580 AA8 3 4 N VAL A 260 ? N VAL AAA 581 O VAL A 273 ? O VAL AAA 594 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG AAA 336 ? A 73.25 -30.37 2 1 ARG AAA 336 ? B 76.07 -41.47 3 1 ASP AAA 385 ? ? -47.13 -74.19 4 1 ASN AAA 387 ? ? -170.49 142.42 5 1 ARG AAA 415 ? ? 70.65 35.59 6 1 ASP AAA 422 ? ? 71.03 45.32 7 1 ILE AAA 435 ? ? -56.32 106.77 8 1 ASP AAA 448 ? ? 74.20 60.32 9 1 ASP AAA 589 ? ? 38.78 51.55 # _pdbx_entry_details.entry_id 6TG8 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NA NA NA N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Croatian Science Foundation' _pdbx_audit_support.country Croatia _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ZGK _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6TG8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013281 _atom_sites.fract_transf_matrix[1][2] 0.007668 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015335 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007841 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 NA 11 11 4.766 3.285 3.176 8.842 1.268 0.314 1.114 129.424 0.676 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_