data_6THH # _entry.id 6THH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.344 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6THH WWPDB D_1292105489 # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 6EXP _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6THH _pdbx_database_status.recvd_initial_deposition_date 2019-11-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Manav, M.C.' 1 0000-0003-3540-2803 'Brodersen, D.E.' 2 0000-0002-5413-4667 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 5993 _citation.page_last 5993 _citation.title 'Structural basis for inhibition of an archaeal CRISPR-Cas type I-D large subunit by an anti-CRISPR protein.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-020-19847-x _citation.pdbx_database_id_PubMed 33239638 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Manav, M.C.' 1 ? primary 'Van, L.B.' 2 ? primary 'Lin, J.' 3 ? primary 'Fuglsang, A.' 4 ? primary 'Peng, X.' 5 ? primary 'Brodersen, D.E.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6THH _cell.details ? _cell.formula_units_Z ? _cell.length_a 157.990 _cell.length_a_esd ? _cell.length_b 157.990 _cell.length_b_esd ? _cell.length_c 130.240 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6THH _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SIRV3 AcrID1 (gp02) anti-CRISPR protein' 13086.693 2 ? ? ? ? 2 polymer man 'CRISPR-associated protein, CscA' 98332.102 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MNYKELEKMLDVIFENSEIKEIDLFFDPEVEISKQEFEDLVKNADPLQKVVGDNYITETFEWWEFENQYLEFELDYYVKD EKIFVLEMHFWRKIRKLEHHHHHH ; ;MNYKELEKMLDVIFENSEIKEIDLFFDPEVEISKQEFEDLVKNADPLQKVVGDNYITETFEWWEFENQYLEFELDYYVKD EKIFVLEMHFWRKIRKLEHHHHHH ; A,B ? 2 'polypeptide(L)' no yes ;(MSE)RNLKRIV(MSE)GENKLIGLVRTALDSITLGQGVNEAKIKSPQSYAFHTISVGTISLDICKAIYSSSEIGRKQLE NLSKKYN(MSE)PFEDLWFYGGFLHDWNKLSGKEESLENKEELTKKIIDKLKLPNEFLHGIST(MSE)AEGHLPDNLHLP LWVSIKLAD(MSE)LLISDIGSVRDVFYFANSDSYRNAIEALKEYNLELNYVSSTFRLFTLIASKELLNDVFNEKSGYFP LISYADGIVFLKRKNSQPVLLSKIVDLLSRQVFSSSSEVIEEKISDIEKCIKNKEELFRQ(MSE)NIDVKSAIYDEEGKV KQINAFLPTKVCKPFEDVVGNLDNKSKLQVAREVIERNRKDIPFGLLIYFVNKFSKNEEDYIRKGLGINEKSLKYLLNIG DVQKALDKILELLEKRYAEQSSDKTLLYYVKFSSSGNIIDDLPKITDRPNDYCVVCG(MSE)PIYSSNPVRFVQYASELG GRAEIWIPREKALDEIDNVRDDWKVCPICIYEANL(MSE)KDRVKPPYFIVTFYPGVPISLLNIIDFDFSQSSIKYYIDE EKDTYFTAFEK(MSE)GGRLEPYVKKVLPAYFSSKVIIKASEVSNFSLSTRLSKSELNKLLPYAP(MSE)IS(MSE)IFL TSPVLISSNLYE(MSE)PIAHERVISITSTYNYTF(MSE)KSLNSNLLTLYSIFAYSAKYDA(MSE)RKICGRSDLDNCL GYLTEE(MSE)DLYSSVDPALGVLSIG(MSE)GVGTPIDTDEKFFSAFLPVSGYLLKVTGKVSK(MSE)GETLKSSIFSI AYALKDIIKSQKVSKYDVTGFLRDGVD(MSE)FFKTTSVIKDKEDRIGISVNAAISSLENKYALDDQHRAQVYSALQDIF KTLYSIEEESDRSLAISIANTLSNWLYIAYKLVLQGDKSLEHHHHHH ; ;MRNLKRIVMGENKLIGLVRTALDSITLGQGVNEAKIKSPQSYAFHTISVGTISLDICKAIYSSSEIGRKQLENLSKKYNM PFEDLWFYGGFLHDWNKLSGKEESLENKEELTKKIIDKLKLPNEFLHGISTMAEGHLPDNLHLPLWVSIKLADMLLISDI GSVRDVFYFANSDSYRNAIEALKEYNLELNYVSSTFRLFTLIASKELLNDVFNEKSGYFPLISYADGIVFLKRKNSQPVL LSKIVDLLSRQVFSSSSEVIEEKISDIEKCIKNKEELFRQMNIDVKSAIYDEEGKVKQINAFLPTKVCKPFEDVVGNLDN KSKLQVAREVIERNRKDIPFGLLIYFVNKFSKNEEDYIRKGLGINEKSLKYLLNIGDVQKALDKILELLEKRYAEQSSDK TLLYYVKFSSSGNIIDDLPKITDRPNDYCVVCGMPIYSSNPVRFVQYASELGGRAEIWIPREKALDEIDNVRDDWKVCPI CIYEANLMKDRVKPPYFIVTFYPGVPISLLNIIDFDFSQSSIKYYIDEEKDTYFTAFEKMGGRLEPYVKKVLPAYFSSKV IIKASEVSNFSLSTRLSKSELNKLLPYAPMISMIFLTSPVLISSNLYEMPIAHERVISITSTYNYTFMKSLNSNLLTLYS IFAYSAKYDAMRKICGRSDLDNCLGYLTEEMDLYSSVDPALGVLSIGMGVGTPIDTDEKFFSAFLPVSGYLLKVTGKVSK MGETLKSSIFSIAYALKDIIKSQKVSKYDVTGFLRDGVDMFFKTTSVIKDKEDRIGISVNAAISSLENKYALDDQHRAQV YSALQDIFKTLYSIEEESDRSLAISIANTLSNWLYIAYKLVLQGDKSLEHHHHHH ; C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 TYR n 1 4 LYS n 1 5 GLU n 1 6 LEU n 1 7 GLU n 1 8 LYS n 1 9 MET n 1 10 LEU n 1 11 ASP n 1 12 VAL n 1 13 ILE n 1 14 PHE n 1 15 GLU n 1 16 ASN n 1 17 SER n 1 18 GLU n 1 19 ILE n 1 20 LYS n 1 21 GLU n 1 22 ILE n 1 23 ASP n 1 24 LEU n 1 25 PHE n 1 26 PHE n 1 27 ASP n 1 28 PRO n 1 29 GLU n 1 30 VAL n 1 31 GLU n 1 32 ILE n 1 33 SER n 1 34 LYS n 1 35 GLN n 1 36 GLU n 1 37 PHE n 1 38 GLU n 1 39 ASP n 1 40 LEU n 1 41 VAL n 1 42 LYS n 1 43 ASN n 1 44 ALA n 1 45 ASP n 1 46 PRO n 1 47 LEU n 1 48 GLN n 1 49 LYS n 1 50 VAL n 1 51 VAL n 1 52 GLY n 1 53 ASP n 1 54 ASN n 1 55 TYR n 1 56 ILE n 1 57 THR n 1 58 GLU n 1 59 THR n 1 60 PHE n 1 61 GLU n 1 62 TRP n 1 63 TRP n 1 64 GLU n 1 65 PHE n 1 66 GLU n 1 67 ASN n 1 68 GLN n 1 69 TYR n 1 70 LEU n 1 71 GLU n 1 72 PHE n 1 73 GLU n 1 74 LEU n 1 75 ASP n 1 76 TYR n 1 77 TYR n 1 78 VAL n 1 79 LYS n 1 80 ASP n 1 81 GLU n 1 82 LYS n 1 83 ILE n 1 84 PHE n 1 85 VAL n 1 86 LEU n 1 87 GLU n 1 88 MET n 1 89 HIS n 1 90 PHE n 1 91 TRP n 1 92 ARG n 1 93 LYS n 1 94 ILE n 1 95 ARG n 1 96 LYS n 1 97 LEU n 1 98 GLU n 1 99 HIS n 1 100 HIS n 1 101 HIS n 1 102 HIS n 1 103 HIS n 1 104 HIS n 2 1 MSE n 2 2 ARG n 2 3 ASN n 2 4 LEU n 2 5 LYS n 2 6 ARG n 2 7 ILE n 2 8 VAL n 2 9 MSE n 2 10 GLY n 2 11 GLU n 2 12 ASN n 2 13 LYS n 2 14 LEU n 2 15 ILE n 2 16 GLY n 2 17 LEU n 2 18 VAL n 2 19 ARG n 2 20 THR n 2 21 ALA n 2 22 LEU n 2 23 ASP n 2 24 SER n 2 25 ILE n 2 26 THR n 2 27 LEU n 2 28 GLY n 2 29 GLN n 2 30 GLY n 2 31 VAL n 2 32 ASN n 2 33 GLU n 2 34 ALA n 2 35 LYS n 2 36 ILE n 2 37 LYS n 2 38 SER n 2 39 PRO n 2 40 GLN n 2 41 SER n 2 42 TYR n 2 43 ALA n 2 44 PHE n 2 45 HIS n 2 46 THR n 2 47 ILE n 2 48 SER n 2 49 VAL n 2 50 GLY n 2 51 THR n 2 52 ILE n 2 53 SER n 2 54 LEU n 2 55 ASP n 2 56 ILE n 2 57 CYS n 2 58 LYS n 2 59 ALA n 2 60 ILE n 2 61 TYR n 2 62 SER n 2 63 SER n 2 64 SER n 2 65 GLU n 2 66 ILE n 2 67 GLY n 2 68 ARG n 2 69 LYS n 2 70 GLN n 2 71 LEU n 2 72 GLU n 2 73 ASN n 2 74 LEU n 2 75 SER n 2 76 LYS n 2 77 LYS n 2 78 TYR n 2 79 ASN n 2 80 MSE n 2 81 PRO n 2 82 PHE n 2 83 GLU n 2 84 ASP n 2 85 LEU n 2 86 TRP n 2 87 PHE n 2 88 TYR n 2 89 GLY n 2 90 GLY n 2 91 PHE n 2 92 LEU n 2 93 HIS n 2 94 ASP n 2 95 TRP n 2 96 ASN n 2 97 LYS n 2 98 LEU n 2 99 SER n 2 100 GLY n 2 101 LYS n 2 102 GLU n 2 103 GLU n 2 104 SER n 2 105 LEU n 2 106 GLU n 2 107 ASN n 2 108 LYS n 2 109 GLU n 2 110 GLU n 2 111 LEU n 2 112 THR n 2 113 LYS n 2 114 LYS n 2 115 ILE n 2 116 ILE n 2 117 ASP n 2 118 LYS n 2 119 LEU n 2 120 LYS n 2 121 LEU n 2 122 PRO n 2 123 ASN n 2 124 GLU n 2 125 PHE n 2 126 LEU n 2 127 HIS n 2 128 GLY n 2 129 ILE n 2 130 SER n 2 131 THR n 2 132 MSE n 2 133 ALA n 2 134 GLU n 2 135 GLY n 2 136 HIS n 2 137 LEU n 2 138 PRO n 2 139 ASP n 2 140 ASN n 2 141 LEU n 2 142 HIS n 2 143 LEU n 2 144 PRO n 2 145 LEU n 2 146 TRP n 2 147 VAL n 2 148 SER n 2 149 ILE n 2 150 LYS n 2 151 LEU n 2 152 ALA n 2 153 ASP n 2 154 MSE n 2 155 LEU n 2 156 LEU n 2 157 ILE n 2 158 SER n 2 159 ASP n 2 160 ILE n 2 161 GLY n 2 162 SER n 2 163 VAL n 2 164 ARG n 2 165 ASP n 2 166 VAL n 2 167 PHE n 2 168 TYR n 2 169 PHE n 2 170 ALA n 2 171 ASN n 2 172 SER n 2 173 ASP n 2 174 SER n 2 175 TYR n 2 176 ARG n 2 177 ASN n 2 178 ALA n 2 179 ILE n 2 180 GLU n 2 181 ALA n 2 182 LEU n 2 183 LYS n 2 184 GLU n 2 185 TYR n 2 186 ASN n 2 187 LEU n 2 188 GLU n 2 189 LEU n 2 190 ASN n 2 191 TYR n 2 192 VAL n 2 193 SER n 2 194 SER n 2 195 THR n 2 196 PHE n 2 197 ARG n 2 198 LEU n 2 199 PHE n 2 200 THR n 2 201 LEU n 2 202 ILE n 2 203 ALA n 2 204 SER n 2 205 LYS n 2 206 GLU n 2 207 LEU n 2 208 LEU n 2 209 ASN n 2 210 ASP n 2 211 VAL n 2 212 PHE n 2 213 ASN n 2 214 GLU n 2 215 LYS n 2 216 SER n 2 217 GLY n 2 218 TYR n 2 219 PHE n 2 220 PRO n 2 221 LEU n 2 222 ILE n 2 223 SER n 2 224 TYR n 2 225 ALA n 2 226 ASP n 2 227 GLY n 2 228 ILE n 2 229 VAL n 2 230 PHE n 2 231 LEU n 2 232 LYS n 2 233 ARG n 2 234 LYS n 2 235 ASN n 2 236 SER n 2 237 GLN n 2 238 PRO n 2 239 VAL n 2 240 LEU n 2 241 LEU n 2 242 SER n 2 243 LYS n 2 244 ILE n 2 245 VAL n 2 246 ASP n 2 247 LEU n 2 248 LEU n 2 249 SER n 2 250 ARG n 2 251 GLN n 2 252 VAL n 2 253 PHE n 2 254 SER n 2 255 SER n 2 256 SER n 2 257 SER n 2 258 GLU n 2 259 VAL n 2 260 ILE n 2 261 GLU n 2 262 GLU n 2 263 LYS n 2 264 ILE n 2 265 SER n 2 266 ASP n 2 267 ILE n 2 268 GLU n 2 269 LYS n 2 270 CYS n 2 271 ILE n 2 272 LYS n 2 273 ASN n 2 274 LYS n 2 275 GLU n 2 276 GLU n 2 277 LEU n 2 278 PHE n 2 279 ARG n 2 280 GLN n 2 281 MSE n 2 282 ASN n 2 283 ILE n 2 284 ASP n 2 285 VAL n 2 286 LYS n 2 287 SER n 2 288 ALA n 2 289 ILE n 2 290 TYR n 2 291 ASP n 2 292 GLU n 2 293 GLU n 2 294 GLY n 2 295 LYS n 2 296 VAL n 2 297 LYS n 2 298 GLN n 2 299 ILE n 2 300 ASN n 2 301 ALA n 2 302 PHE n 2 303 LEU n 2 304 PRO n 2 305 THR n 2 306 LYS n 2 307 VAL n 2 308 CYS n 2 309 LYS n 2 310 PRO n 2 311 PHE n 2 312 GLU n 2 313 ASP n 2 314 VAL n 2 315 VAL n 2 316 GLY n 2 317 ASN n 2 318 LEU n 2 319 ASP n 2 320 ASN n 2 321 LYS n 2 322 SER n 2 323 LYS n 2 324 LEU n 2 325 GLN n 2 326 VAL n 2 327 ALA n 2 328 ARG n 2 329 GLU n 2 330 VAL n 2 331 ILE n 2 332 GLU n 2 333 ARG n 2 334 ASN n 2 335 ARG n 2 336 LYS n 2 337 ASP n 2 338 ILE n 2 339 PRO n 2 340 PHE n 2 341 GLY n 2 342 LEU n 2 343 LEU n 2 344 ILE n 2 345 TYR n 2 346 PHE n 2 347 VAL n 2 348 ASN n 2 349 LYS n 2 350 PHE n 2 351 SER n 2 352 LYS n 2 353 ASN n 2 354 GLU n 2 355 GLU n 2 356 ASP n 2 357 TYR n 2 358 ILE n 2 359 ARG n 2 360 LYS n 2 361 GLY n 2 362 LEU n 2 363 GLY n 2 364 ILE n 2 365 ASN n 2 366 GLU n 2 367 LYS n 2 368 SER n 2 369 LEU n 2 370 LYS n 2 371 TYR n 2 372 LEU n 2 373 LEU n 2 374 ASN n 2 375 ILE n 2 376 GLY n 2 377 ASP n 2 378 VAL n 2 379 GLN n 2 380 LYS n 2 381 ALA n 2 382 LEU n 2 383 ASP n 2 384 LYS n 2 385 ILE n 2 386 LEU n 2 387 GLU n 2 388 LEU n 2 389 LEU n 2 390 GLU n 2 391 LYS n 2 392 ARG n 2 393 TYR n 2 394 ALA n 2 395 GLU n 2 396 GLN n 2 397 SER n 2 398 SER n 2 399 ASP n 2 400 LYS n 2 401 THR n 2 402 LEU n 2 403 LEU n 2 404 TYR n 2 405 TYR n 2 406 VAL n 2 407 LYS n 2 408 PHE n 2 409 SER n 2 410 SER n 2 411 SER n 2 412 GLY n 2 413 ASN n 2 414 ILE n 2 415 ILE n 2 416 ASP n 2 417 ASP n 2 418 LEU n 2 419 PRO n 2 420 LYS n 2 421 ILE n 2 422 THR n 2 423 ASP n 2 424 ARG n 2 425 PRO n 2 426 ASN n 2 427 ASP n 2 428 TYR n 2 429 CYS n 2 430 VAL n 2 431 VAL n 2 432 CYS n 2 433 GLY n 2 434 MSE n 2 435 PRO n 2 436 ILE n 2 437 TYR n 2 438 SER n 2 439 SER n 2 440 ASN n 2 441 PRO n 2 442 VAL n 2 443 ARG n 2 444 PHE n 2 445 VAL n 2 446 GLN n 2 447 TYR n 2 448 ALA n 2 449 SER n 2 450 GLU n 2 451 LEU n 2 452 GLY n 2 453 GLY n 2 454 ARG n 2 455 ALA n 2 456 GLU n 2 457 ILE n 2 458 TRP n 2 459 ILE n 2 460 PRO n 2 461 ARG n 2 462 GLU n 2 463 LYS n 2 464 ALA n 2 465 LEU n 2 466 ASP n 2 467 GLU n 2 468 ILE n 2 469 ASP n 2 470 ASN n 2 471 VAL n 2 472 ARG n 2 473 ASP n 2 474 ASP n 2 475 TRP n 2 476 LYS n 2 477 VAL n 2 478 CYS n 2 479 PRO n 2 480 ILE n 2 481 CYS n 2 482 ILE n 2 483 TYR n 2 484 GLU n 2 485 ALA n 2 486 ASN n 2 487 LEU n 2 488 MSE n 2 489 LYS n 2 490 ASP n 2 491 ARG n 2 492 VAL n 2 493 LYS n 2 494 PRO n 2 495 PRO n 2 496 TYR n 2 497 PHE n 2 498 ILE n 2 499 VAL n 2 500 THR n 2 501 PHE n 2 502 TYR n 2 503 PRO n 2 504 GLY n 2 505 VAL n 2 506 PRO n 2 507 ILE n 2 508 SER n 2 509 LEU n 2 510 LEU n 2 511 ASN n 2 512 ILE n 2 513 ILE n 2 514 ASP n 2 515 PHE n 2 516 ASP n 2 517 PHE n 2 518 SER n 2 519 GLN n 2 520 SER n 2 521 SER n 2 522 ILE n 2 523 LYS n 2 524 TYR n 2 525 TYR n 2 526 ILE n 2 527 ASP n 2 528 GLU n 2 529 GLU n 2 530 LYS n 2 531 ASP n 2 532 THR n 2 533 TYR n 2 534 PHE n 2 535 THR n 2 536 ALA n 2 537 PHE n 2 538 GLU n 2 539 LYS n 2 540 MSE n 2 541 GLY n 2 542 GLY n 2 543 ARG n 2 544 LEU n 2 545 GLU n 2 546 PRO n 2 547 TYR n 2 548 VAL n 2 549 LYS n 2 550 LYS n 2 551 VAL n 2 552 LEU n 2 553 PRO n 2 554 ALA n 2 555 TYR n 2 556 PHE n 2 557 SER n 2 558 SER n 2 559 LYS n 2 560 VAL n 2 561 ILE n 2 562 ILE n 2 563 LYS n 2 564 ALA n 2 565 SER n 2 566 GLU n 2 567 VAL n 2 568 SER n 2 569 ASN n 2 570 PHE n 2 571 SER n 2 572 LEU n 2 573 SER n 2 574 THR n 2 575 ARG n 2 576 LEU n 2 577 SER n 2 578 LYS n 2 579 SER n 2 580 GLU n 2 581 LEU n 2 582 ASN n 2 583 LYS n 2 584 LEU n 2 585 LEU n 2 586 PRO n 2 587 TYR n 2 588 ALA n 2 589 PRO n 2 590 MSE n 2 591 ILE n 2 592 SER n 2 593 MSE n 2 594 ILE n 2 595 PHE n 2 596 LEU n 2 597 THR n 2 598 SER n 2 599 PRO n 2 600 VAL n 2 601 LEU n 2 602 ILE n 2 603 SER n 2 604 SER n 2 605 ASN n 2 606 LEU n 2 607 TYR n 2 608 GLU n 2 609 MSE n 2 610 PRO n 2 611 ILE n 2 612 ALA n 2 613 HIS n 2 614 GLU n 2 615 ARG n 2 616 VAL n 2 617 ILE n 2 618 SER n 2 619 ILE n 2 620 THR n 2 621 SER n 2 622 THR n 2 623 TYR n 2 624 ASN n 2 625 TYR n 2 626 THR n 2 627 PHE n 2 628 MSE n 2 629 LYS n 2 630 SER n 2 631 LEU n 2 632 ASN n 2 633 SER n 2 634 ASN n 2 635 LEU n 2 636 LEU n 2 637 THR n 2 638 LEU n 2 639 TYR n 2 640 SER n 2 641 ILE n 2 642 PHE n 2 643 ALA n 2 644 TYR n 2 645 SER n 2 646 ALA n 2 647 LYS n 2 648 TYR n 2 649 ASP n 2 650 ALA n 2 651 MSE n 2 652 ARG n 2 653 LYS n 2 654 ILE n 2 655 CYS n 2 656 GLY n 2 657 ARG n 2 658 SER n 2 659 ASP n 2 660 LEU n 2 661 ASP n 2 662 ASN n 2 663 CYS n 2 664 LEU n 2 665 GLY n 2 666 TYR n 2 667 LEU n 2 668 THR n 2 669 GLU n 2 670 GLU n 2 671 MSE n 2 672 ASP n 2 673 LEU n 2 674 TYR n 2 675 SER n 2 676 SER n 2 677 VAL n 2 678 ASP n 2 679 PRO n 2 680 ALA n 2 681 LEU n 2 682 GLY n 2 683 VAL n 2 684 LEU n 2 685 SER n 2 686 ILE n 2 687 GLY n 2 688 MSE n 2 689 GLY n 2 690 VAL n 2 691 GLY n 2 692 THR n 2 693 PRO n 2 694 ILE n 2 695 ASP n 2 696 THR n 2 697 ASP n 2 698 GLU n 2 699 LYS n 2 700 PHE n 2 701 PHE n 2 702 SER n 2 703 ALA n 2 704 PHE n 2 705 LEU n 2 706 PRO n 2 707 VAL n 2 708 SER n 2 709 GLY n 2 710 TYR n 2 711 LEU n 2 712 LEU n 2 713 LYS n 2 714 VAL n 2 715 THR n 2 716 GLY n 2 717 LYS n 2 718 VAL n 2 719 SER n 2 720 LYS n 2 721 MSE n 2 722 GLY n 2 723 GLU n 2 724 THR n 2 725 LEU n 2 726 LYS n 2 727 SER n 2 728 SER n 2 729 ILE n 2 730 PHE n 2 731 SER n 2 732 ILE n 2 733 ALA n 2 734 TYR n 2 735 ALA n 2 736 LEU n 2 737 LYS n 2 738 ASP n 2 739 ILE n 2 740 ILE n 2 741 LYS n 2 742 SER n 2 743 GLN n 2 744 LYS n 2 745 VAL n 2 746 SER n 2 747 LYS n 2 748 TYR n 2 749 ASP n 2 750 VAL n 2 751 THR n 2 752 GLY n 2 753 PHE n 2 754 LEU n 2 755 ARG n 2 756 ASP n 2 757 GLY n 2 758 VAL n 2 759 ASP n 2 760 MSE n 2 761 PHE n 2 762 PHE n 2 763 LYS n 2 764 THR n 2 765 THR n 2 766 SER n 2 767 VAL n 2 768 ILE n 2 769 LYS n 2 770 ASP n 2 771 LYS n 2 772 GLU n 2 773 ASP n 2 774 ARG n 2 775 ILE n 2 776 GLY n 2 777 ILE n 2 778 SER n 2 779 VAL n 2 780 ASN n 2 781 ALA n 2 782 ALA n 2 783 ILE n 2 784 SER n 2 785 SER n 2 786 LEU n 2 787 GLU n 2 788 ASN n 2 789 LYS n 2 790 TYR n 2 791 ALA n 2 792 LEU n 2 793 ASP n 2 794 ASP n 2 795 GLN n 2 796 HIS n 2 797 ARG n 2 798 ALA n 2 799 GLN n 2 800 VAL n 2 801 TYR n 2 802 SER n 2 803 ALA n 2 804 LEU n 2 805 GLN n 2 806 ASP n 2 807 ILE n 2 808 PHE n 2 809 LYS n 2 810 THR n 2 811 LEU n 2 812 TYR n 2 813 SER n 2 814 ILE n 2 815 GLU n 2 816 GLU n 2 817 GLU n 2 818 SER n 2 819 ASP n 2 820 ARG n 2 821 SER n 2 822 LEU n 2 823 ALA n 2 824 ILE n 2 825 SER n 2 826 ILE n 2 827 ALA n 2 828 ASN n 2 829 THR n 2 830 LEU n 2 831 SER n 2 832 ASN n 2 833 TRP n 2 834 LEU n 2 835 TYR n 2 836 ILE n 2 837 ALA n 2 838 TYR n 2 839 LYS n 2 840 LEU n 2 841 VAL n 2 842 LEU n 2 843 GLN n 2 844 GLY n 2 845 ASP n 2 846 LYS n 2 847 SER n 2 848 LEU n 2 849 GLU n 2 850 HIS n 2 851 HIS n 2 852 HIS n 2 853 HIS n 2 854 HIS n 2 855 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 104 ? ? ? ? ? ? ? ? ? 'Sulfolobus islandicus rudivirus 3' 1895333 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 855 ? ? SiL_0609 ? ? ? ? ? ? 'Sulfolobus islandicus LAL14/1' 1241935 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A0A1B3SN05_9VIRU A0A1B3SN05 ? 1 ;MNYKELEKMLDVIFENSEIKEIDLFFDPEVEISKQEFEDLVKNADPLQKVVGDNYITETFEWWEFENQYLEFELDYYVKD EKIFVLEMHFWRKIRK ; 1 2 UNP M9U4Y8_SULIS M9U4Y8 ? 2 ;MRNLKRIVMGENKLIGLVRTALDSITLGQGVNEAKIKSPQSYAFHTISVGTISLDICKAIYSSSEIGRKQLENLSKKYNM PFEDLWFYGGFLHDWNKLSGKEESLENKEELTKKIIDKLKLPNEFLHGISTMAEGHLPDNLHLPLWVSIKLADMLLISDI GSVRDVFYFANSDSYRNAIEALKEYNLELNYVSSTFRLFTLIASKELLNDVFNEKSGYFPLISYADGIVFLKRKNSQPVL LSKIVDLLSRQVFSSSSEVIEEKISDIEKCIKNKEELFRQMNIDVKSAIYDEEGKVKQINAFLPTKVCKPFEDVVGNLDN KSKLQVAREVIERNRKDIPFGLLIYFVNKFSKNEEDYIRKGLGINEKSLKYLLNIGDVQKALDKILELLEKRYAEQSSDK TLLYYVKFSSSGNIIDDLPKITDRPNDYCVVCGMPIYSSNPVRFVQYASELGGRAEIWIPREKALDEIDNVRDDWKVCPI CIYEANLMKDRVKPPYFIVTFYPGVPISLLNIIDFDFSQSSIKYYIDEEKDTYFTAFEKMGGRLEPYVKKVLPAYFSSKV IIKASEVSNFSLSTRLSKSELNKLLPYAPMISMIFLTSPVLISSNLYEMPIAHERVISITSTYNYTFMKSLNSNLLTLYS IFAYSAKYDAMRKICGRSDLDNCLGYLTEEMDLYSSVDPALGVLSIGMGVGTPIDTDEKFFSAFLPVSGYLLKVTGKVSK MGETLKSSIFSIAYALKDIIKSQKVSKYDVTGFLRDGVDMFFKTTSVIKDKEDRIGISVNAAISSLENKYALDDQHRAQV YSALQDIFKTLYSIEEESDRSLAISIANTLSNWLYIAYKLVLQGDKS ; 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6THH A 1 ? 96 ? A0A1B3SN05 1 ? 96 ? 1 96 2 1 6THH B 1 ? 96 ? A0A1B3SN05 1 ? 96 ? 1 96 3 2 6THH C 1 ? 847 ? M9U4Y8 1 ? 847 ? 1 847 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6THH LEU A 97 ? UNP A0A1B3SN05 ? ? 'expression tag' 97 1 1 6THH GLU A 98 ? UNP A0A1B3SN05 ? ? 'expression tag' 98 2 1 6THH HIS A 99 ? UNP A0A1B3SN05 ? ? 'expression tag' 99 3 1 6THH HIS A 100 ? UNP A0A1B3SN05 ? ? 'expression tag' 100 4 1 6THH HIS A 101 ? UNP A0A1B3SN05 ? ? 'expression tag' 101 5 1 6THH HIS A 102 ? UNP A0A1B3SN05 ? ? 'expression tag' 102 6 1 6THH HIS A 103 ? UNP A0A1B3SN05 ? ? 'expression tag' 103 7 1 6THH HIS A 104 ? UNP A0A1B3SN05 ? ? 'expression tag' 104 8 2 6THH LEU B 97 ? UNP A0A1B3SN05 ? ? 'expression tag' 97 9 2 6THH GLU B 98 ? UNP A0A1B3SN05 ? ? 'expression tag' 98 10 2 6THH HIS B 99 ? UNP A0A1B3SN05 ? ? 'expression tag' 99 11 2 6THH HIS B 100 ? UNP A0A1B3SN05 ? ? 'expression tag' 100 12 2 6THH HIS B 101 ? UNP A0A1B3SN05 ? ? 'expression tag' 101 13 2 6THH HIS B 102 ? UNP A0A1B3SN05 ? ? 'expression tag' 102 14 2 6THH HIS B 103 ? UNP A0A1B3SN05 ? ? 'expression tag' 103 15 2 6THH HIS B 104 ? UNP A0A1B3SN05 ? ? 'expression tag' 104 16 3 6THH LEU C 848 ? UNP M9U4Y8 ? ? 'expression tag' 848 17 3 6THH GLU C 849 ? UNP M9U4Y8 ? ? 'expression tag' 849 18 3 6THH HIS C 850 ? UNP M9U4Y8 ? ? 'expression tag' 850 19 3 6THH HIS C 851 ? UNP M9U4Y8 ? ? 'expression tag' 851 20 3 6THH HIS C 852 ? UNP M9U4Y8 ? ? 'expression tag' 852 21 3 6THH HIS C 853 ? UNP M9U4Y8 ? ? 'expression tag' 853 22 3 6THH HIS C 854 ? UNP M9U4Y8 ? ? 'expression tag' 854 23 3 6THH HIS C 855 ? UNP M9U4Y8 ? ? 'expression tag' 855 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6THH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Hepes 7.5, 2% (w/v) PEG 8000, 5% ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-09-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 137.1 _reflns.entry_id 6THH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.48 _reflns.d_resolution_low 67.5420 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21713 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.48 _reflns_shell.d_res_low 3.6 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2139 _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.68 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.6 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 282.810 _refine.B_iso_mean 137.0532 _refine.B_iso_min 61.230 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6THH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.4800 _refine.ls_d_res_low 67.5420 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21696 _refine.ls_number_reflns_R_free 1841 _refine.ls_number_reflns_R_work 19855 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8800 _refine.ls_percent_reflns_R_free 8.4900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2379 _refine.ls_R_factor_R_free 0.2538 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2364 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.7700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.4800 _refine_hist.d_res_low 67.5420 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 8244 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 1008 _refine_hist.pdbx_B_iso_mean_ligand 148.63 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 8238 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.4800 3.5741 . . 112 1512 100.0000 . . . 0.3546 0.0000 . . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5741 3.6792 . . 154 1496 100.0000 . . . 0.3086 0.0000 . . . . . . . . . . . . # _struct.entry_id 6THH _struct.title 'Crystal structure of type I-D CRISPR-Cas nuclease Cas10d in complex with the SIRV3 AcrID1 (gp02) anti-CRISPR protein' _struct.pdbx_descriptor 'Uncharacterized protein, CRISPR-associated protein, CscA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6THH _struct_keywords.text 'CRISPR, Cas, type I-D, Cas10, Cas10d, complex, anti-CRISPR, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 2 ? ASN A 16 ? ASN A 2 ASN A 16 1 ? 15 HELX_P HELX_P2 AA2 LYS A 34 ? LEU A 40 ? LYS A 34 LEU A 40 1 ? 7 HELX_P HELX_P3 AA3 ASN B 2 ? ASN B 16 ? ASN B 2 ASN B 16 1 ? 15 HELX_P HELX_P4 AA4 LYS B 34 ? LYS B 42 ? LYS B 34 LYS B 42 1 ? 9 HELX_P HELX_P5 AA5 ASN C 12 ? ILE C 25 ? ASN C 12 ILE C 25 1 ? 14 HELX_P HELX_P6 AA6 THR C 26 ? VAL C 31 ? THR C 26 VAL C 31 1 ? 6 HELX_P HELX_P7 AA7 SER C 41 ? SER C 64 ? SER C 41 SER C 64 1 ? 24 HELX_P HELX_P8 AA8 SER C 64 ? ASN C 79 ? SER C 64 ASN C 79 1 ? 16 HELX_P HELX_P9 AA9 PRO C 81 ? SER C 99 ? PRO C 81 SER C 99 1 ? 19 HELX_P HELX_P10 AB1 GLU C 110 ? LEU C 119 ? GLU C 110 LEU C 119 1 ? 10 HELX_P HELX_P11 AB2 PRO C 122 ? SER C 130 ? PRO C 122 SER C 130 1 ? 9 HELX_P HELX_P12 AB3 ASP C 139 ? LEU C 141 ? ASP C 139 LEU C 141 5 ? 3 HELX_P HELX_P13 AB4 HIS C 142 ? LEU C 156 ? HIS C 142 LEU C 156 1 ? 15 HELX_P HELX_P14 AB5 SER C 162 ? ASP C 173 ? SER C 162 ASP C 173 1 ? 12 HELX_P HELX_P15 AB6 TYR C 175 ? TYR C 185 ? TYR C 175 TYR C 185 1 ? 11 HELX_P HELX_P16 AB7 ARG C 197 ? VAL C 211 ? ARG C 197 VAL C 211 1 ? 15 HELX_P HELX_P17 AB8 LEU C 240 ? PHE C 253 ? LEU C 240 PHE C 253 1 ? 14 HELX_P HELX_P18 AB9 GLU C 258 ? LYS C 274 ? GLU C 258 LYS C 274 1 ? 17 HELX_P HELX_P19 AC1 LYS C 274 ? MSE C 281 ? LYS C 274 MSE C 281 1 ? 8 HELX_P HELX_P20 AC2 ASP C 284 ? TYR C 290 ? ASP C 284 TYR C 290 1 ? 7 HELX_P HELX_P21 AC3 GLN C 298 ? PHE C 302 ? GLN C 298 PHE C 302 5 ? 5 HELX_P HELX_P22 AC4 PRO C 310 ? VAL C 315 ? PRO C 310 VAL C 315 1 ? 6 HELX_P HELX_P23 AC5 GLY C 316 ? LEU C 318 ? GLY C 316 LEU C 318 5 ? 3 HELX_P HELX_P24 AC6 ASP C 319 ? ARG C 335 ? ASP C 319 ARG C 335 1 ? 17 HELX_P HELX_P25 AC7 ILE C 338 ? LYS C 349 ? ILE C 338 LYS C 349 1 ? 12 HELX_P HELX_P26 AC8 GLU C 366 ? LEU C 372 ? GLU C 366 LEU C 372 5 ? 7 HELX_P HELX_P27 AC9 ASN C 374 ? ASP C 377 ? ASN C 374 ASP C 377 5 ? 4 HELX_P HELX_P28 AD1 VAL C 378 ? LEU C 402 ? VAL C 378 LEU C 402 1 ? 25 HELX_P HELX_P29 AD2 LEU C 402 ? LYS C 407 ? LEU C 402 LYS C 407 1 ? 6 HELX_P HELX_P30 AD3 ILE C 480 ? LYS C 489 ? ILE C 480 LYS C 489 1 ? 10 HELX_P HELX_P31 AD4 ILE C 507 ? ASN C 511 ? ILE C 507 ASN C 511 1 ? 5 HELX_P HELX_P32 AD5 THR C 532 ? MSE C 540 ? THR C 532 MSE C 540 1 ? 9 HELX_P HELX_P33 AD6 TYR C 555 ? SER C 557 ? TYR C 555 SER C 557 5 ? 3 HELX_P HELX_P34 AD7 SER C 565 ? VAL C 567 ? SER C 565 VAL C 567 5 ? 3 HELX_P HELX_P35 AD8 SER C 577 ? LEU C 585 ? SER C 577 LEU C 585 1 ? 9 HELX_P HELX_P36 AD9 TYR C 587 ? PHE C 595 ? TYR C 587 PHE C 595 1 ? 9 HELX_P HELX_P37 AE1 TYR C 625 ? LYS C 629 ? TYR C 625 LYS C 629 5 ? 5 HELX_P HELX_P38 AE2 SER C 633 ? CYS C 655 ? SER C 633 CYS C 655 1 ? 23 HELX_P HELX_P39 AE3 ASP C 659 ? SER C 675 ? ASP C 659 SER C 675 1 ? 17 HELX_P HELX_P40 AE4 ASP C 678 ? LEU C 684 ? ASP C 678 LEU C 684 1 ? 7 HELX_P HELX_P41 AE5 PHE C 704 ? SER C 719 ? PHE C 704 SER C 719 1 ? 16 HELX_P HELX_P42 AE6 SER C 719 ? ILE C 740 ? SER C 719 ILE C 740 1 ? 22 HELX_P HELX_P43 AE7 SER C 746 ? LYS C 763 ? SER C 746 LYS C 763 1 ? 18 HELX_P HELX_P44 AE8 LYS C 763 ? ILE C 768 ? LYS C 763 ILE C 768 1 ? 6 HELX_P HELX_P45 AE9 ASP C 770 ? ASN C 788 ? ASP C 770 ASN C 788 1 ? 19 HELX_P HELX_P46 AF1 HIS C 796 ? GLU C 817 ? HIS C 796 GLU C 817 1 ? 22 HELX_P HELX_P47 AF2 ASP C 819 ? LEU C 842 ? ASP C 819 LEU C 842 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? C CYS 270 SG ? ? ? 1_555 C CYS 308 SG ? ? C CYS 270 C CYS 308 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? C CYS 655 SG ? ? ? 1_555 C CYS 663 SG ? ? C CYS 655 C CYS 663 1_555 ? ? ? ? ? ? ? 2.032 ? ? covale1 covale both ? C MSE 1 C ? ? ? 1_555 C ARG 2 N ? ? C MSE 1 C ARG 2 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? C VAL 8 C ? ? ? 1_555 C MSE 9 N ? ? C VAL 8 C MSE 9 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? C MSE 9 C ? ? ? 1_555 C GLY 10 N ? ? C MSE 9 C GLY 10 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale4 covale both ? C ASN 79 C ? ? ? 1_555 C MSE 80 N ? ? C ASN 79 C MSE 80 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale5 covale both ? C MSE 80 C ? ? ? 1_555 C PRO 81 N ? ? C MSE 80 C PRO 81 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale6 covale both ? C THR 131 C ? ? ? 1_555 C MSE 132 N ? ? C THR 131 C MSE 132 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale7 covale both ? C MSE 132 C ? ? ? 1_555 C ALA 133 N ? ? C MSE 132 C ALA 133 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale8 covale both ? C ASP 153 C ? ? ? 1_555 C MSE 154 N ? ? C ASP 153 C MSE 154 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale9 covale both ? C MSE 154 C ? ? ? 1_555 C LEU 155 N ? ? C MSE 154 C LEU 155 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale10 covale both ? C GLN 280 C ? ? ? 1_555 C MSE 281 N ? ? C GLN 280 C MSE 281 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale11 covale both ? C MSE 281 C ? ? ? 1_555 C ASN 282 N ? ? C MSE 281 C ASN 282 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale12 covale both ? C GLY 433 C ? ? ? 1_555 C MSE 434 N ? ? C GLY 433 C MSE 434 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale13 covale both ? C MSE 434 C ? ? ? 1_555 C PRO 435 N ? ? C MSE 434 C PRO 435 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale14 covale both ? C LEU 487 C ? ? ? 1_555 C MSE 488 N ? ? C LEU 487 C MSE 488 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale15 covale both ? C MSE 488 C ? ? ? 1_555 C LYS 489 N ? ? C MSE 488 C LYS 489 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale16 covale both ? C LYS 539 C ? ? ? 1_555 C MSE 540 N ? ? C LYS 539 C MSE 540 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale17 covale both ? C MSE 540 C ? ? ? 1_555 C GLY 541 N ? ? C MSE 540 C GLY 541 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale18 covale both ? C PRO 589 C ? ? ? 1_555 C MSE 590 N ? ? C PRO 589 C MSE 590 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale19 covale both ? C MSE 590 C ? ? ? 1_555 C ILE 591 N ? ? C MSE 590 C ILE 591 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale20 covale both ? C SER 592 C ? ? ? 1_555 C MSE 593 N ? ? C SER 592 C MSE 593 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale21 covale both ? C MSE 593 C ? ? ? 1_555 C ILE 594 N ? ? C MSE 593 C ILE 594 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale22 covale both ? C GLU 608 C ? ? ? 1_555 C MSE 609 N ? ? C GLU 608 C MSE 609 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale23 covale both ? C MSE 609 C ? ? ? 1_555 C PRO 610 N ? ? C MSE 609 C PRO 610 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale24 covale both ? C PHE 627 C ? ? ? 1_555 C MSE 628 N ? ? C PHE 627 C MSE 628 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale25 covale both ? C MSE 628 C ? ? ? 1_555 C LYS 629 N ? ? C MSE 628 C LYS 629 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale26 covale both ? C ALA 650 C ? ? ? 1_555 C MSE 651 N ? ? C ALA 650 C MSE 651 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale27 covale both ? C MSE 651 C ? ? ? 1_555 C ARG 652 N ? ? C MSE 651 C ARG 652 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale28 covale both ? C GLU 670 C ? ? ? 1_555 C MSE 671 N ? ? C GLU 670 C MSE 671 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale29 covale both ? C MSE 671 C ? ? ? 1_555 C ASP 672 N ? ? C MSE 671 C ASP 672 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale30 covale both ? C GLY 687 C ? ? ? 1_555 C MSE 688 N ? ? C GLY 687 C MSE 688 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale31 covale both ? C MSE 688 C ? ? ? 1_555 C GLY 689 N ? ? C MSE 688 C GLY 689 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale32 covale both ? C LYS 720 C ? ? ? 1_555 C MSE 721 N ? ? C LYS 720 C MSE 721 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale33 covale both ? C MSE 721 C ? ? ? 1_555 C GLY 722 N ? ? C MSE 721 C GLY 722 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale34 covale both ? C ASP 759 C ? ? ? 1_555 C MSE 760 N ? ? C ASP 759 C MSE 760 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale35 covale both ? C MSE 760 C ? ? ? 1_555 C PHE 761 N ? ? C MSE 760 C PHE 761 1_555 ? ? ? ? ? ? ? 1.334 ? ? metalc1 metalc ? ? C CYS 429 SG ? ? ? 1_555 E ZN . ZN ? ? C CYS 429 C ZN 902 1_555 ? ? ? ? ? ? ? 2.473 ? ? metalc2 metalc ? ? C CYS 432 SG ? ? ? 1_555 E ZN . ZN ? ? C CYS 432 C ZN 902 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc3 metalc ? ? C CYS 478 SG ? ? ? 1_555 E ZN . ZN ? ? C CYS 478 C ZN 902 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc4 metalc ? ? C CYS 481 SG ? ? ? 1_555 E ZN . ZN ? ? C CYS 481 C ZN 902 1_555 ? ? ? ? ? ? ? 2.306 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 27 A . ? ASP 27 A PRO 28 A ? PRO 28 A 1 0.71 2 ASP 27 B . ? ASP 27 B PRO 28 B ? PRO 28 B 1 1.32 3 PRO 494 C . ? PRO 494 C PRO 495 C ? PRO 495 C 1 -2.05 4 TYR 502 C . ? TYR 502 C PRO 503 C ? PRO 503 C 1 -1.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 10 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 5 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 45 ? VAL A 51 ? ASP A 45 VAL A 51 AA1 2 ILE A 56 ? PHE A 65 ? ILE A 56 PHE A 65 AA1 3 GLN A 68 ? LYS A 79 ? GLN A 68 LYS A 79 AA1 4 LYS A 82 ? ILE A 94 ? LYS A 82 ILE A 94 AA1 5 ILE A 19 ? SER A 33 ? ILE A 19 SER A 33 AA1 6 ILE B 19 ? SER B 33 ? ILE B 19 SER B 33 AA1 7 LYS B 82 ? ILE B 94 ? LYS B 82 ILE B 94 AA1 8 GLN B 68 ? LYS B 79 ? GLN B 68 LYS B 79 AA1 9 ILE B 56 ? GLU B 64 ? ILE B 56 GLU B 64 AA1 10 ASP B 45 ? VAL B 51 ? ASP B 45 VAL B 51 AA2 1 LEU C 187 ? VAL C 192 ? LEU C 187 VAL C 192 AA2 2 ILE C 228 ? ARG C 233 ? ILE C 228 ARG C 233 AA2 3 ILE C 222 ? SER C 223 ? ILE C 222 SER C 223 AA2 4 VAL C 505 ? PRO C 506 ? VAL C 505 PRO C 506 AA3 1 ASP C 427 ? TYR C 428 ? ASP C 427 TYR C 428 AA3 2 PRO C 435 ? ILE C 436 ? PRO C 435 ILE C 436 AA4 1 LEU C 552 ? ALA C 554 ? LEU C 552 ALA C 554 AA4 2 LYS C 559 ? LYS C 563 ? LYS C 559 LYS C 563 AA4 3 TYR C 496 ? THR C 500 ? TYR C 496 THR C 500 AA4 4 VAL C 600 ? SER C 603 ? VAL C 600 SER C 603 AA4 5 ILE C 619 ? THR C 620 ? ILE C 619 THR C 620 AA5 1 ILE C 513 ? PHE C 515 ? ILE C 513 PHE C 515 AA5 2 GLY C 542 ? LEU C 544 ? GLY C 542 LEU C 544 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 45 ? N ASP A 45 O GLU A 61 ? O GLU A 61 AA1 2 3 N PHE A 60 ? N PHE A 60 O PHE A 72 ? O PHE A 72 AA1 3 4 N ASP A 75 ? N ASP A 75 O LEU A 86 ? O LEU A 86 AA1 4 5 O MET A 88 ? O MET A 88 N LEU A 24 ? N LEU A 24 AA1 5 6 N GLU A 21 ? N GLU A 21 O PHE B 25 ? O PHE B 25 AA1 6 7 N ILE B 32 ? N ILE B 32 O ILE B 83 ? O ILE B 83 AA1 7 8 O LYS B 93 ? O LYS B 93 N TYR B 69 ? N TYR B 69 AA1 8 9 O TYR B 76 ? O TYR B 76 N ILE B 56 ? N ILE B 56 AA1 9 10 O THR B 57 ? O THR B 57 N VAL B 50 ? N VAL B 50 AA2 1 2 N GLU C 188 ? N GLU C 188 O LYS C 232 ? O LYS C 232 AA2 2 3 O VAL C 229 ? O VAL C 229 N ILE C 222 ? N ILE C 222 AA2 3 4 N SER C 223 ? N SER C 223 O VAL C 505 ? O VAL C 505 AA3 1 2 N ASP C 427 ? N ASP C 427 O ILE C 436 ? O ILE C 436 AA4 1 2 N LEU C 552 ? N LEU C 552 O ILE C 561 ? O ILE C 561 AA4 2 3 O ILE C 562 ? O ILE C 562 N PHE C 497 ? N PHE C 497 AA4 3 4 N ILE C 498 ? N ILE C 498 O LEU C 601 ? O LEU C 601 AA4 4 5 N ILE C 602 ? N ILE C 602 O THR C 620 ? O THR C 620 AA5 1 2 N ASP C 514 ? N ASP C 514 O ARG C 543 ? O ARG C 543 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software C PO4 901 ? 4 'binding site for residue PO4 C 901' AC2 Software C ZN 902 ? 4 'binding site for residue ZN C 902' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 SER C 64 ? SER C 64 . ? 1_555 ? 2 AC1 4 GLU C 65 ? GLU C 65 . ? 1_555 ? 3 AC1 4 ILE C 66 ? ILE C 66 . ? 1_555 ? 4 AC1 4 ASN C 186 ? ASN C 186 . ? 1_555 ? 5 AC2 4 CYS C 429 ? CYS C 429 . ? 1_555 ? 6 AC2 4 CYS C 432 ? CYS C 432 . ? 1_555 ? 7 AC2 4 CYS C 478 ? CYS C 478 . ? 1_555 ? 8 AC2 4 CYS C 481 ? CYS C 481 . ? 1_555 ? # _atom_sites.entry_id 6THH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006330 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006330 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007678 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 ? ? ? A . n A 1 98 GLU 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 HIS 100 100 ? ? ? A . n A 1 101 HIS 101 101 ? ? ? A . n A 1 102 HIS 102 102 ? ? ? A . n A 1 103 HIS 103 103 ? ? ? A . n A 1 104 HIS 104 104 ? ? ? A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ASN 2 2 2 ASN ASN B . n B 1 3 TYR 3 3 3 TYR TYR B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 MET 9 9 9 MET MET B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 VAL 12 12 12 VAL VAL B . n B 1 13 ILE 13 13 13 ILE ILE B . n B 1 14 PHE 14 14 14 PHE PHE B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 ASN 16 16 16 ASN ASN B . n B 1 17 SER 17 17 17 SER SER B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 ILE 22 22 22 ILE ILE B . n B 1 23 ASP 23 23 23 ASP ASP B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 PHE 25 25 25 PHE PHE B . n B 1 26 PHE 26 26 26 PHE PHE B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 VAL 30 30 30 VAL VAL B . n B 1 31 GLU 31 31 31 GLU GLU B . n B 1 32 ILE 32 32 32 ILE ILE B . n B 1 33 SER 33 33 33 SER SER B . n B 1 34 LYS 34 34 34 LYS LYS B . n B 1 35 GLN 35 35 35 GLN GLN B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 PHE 37 37 37 PHE PHE B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 ASP 39 39 39 ASP ASP B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 ASN 43 43 43 ASN ASN B . n B 1 44 ALA 44 44 44 ALA ALA B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 PRO 46 46 46 PRO PRO B . n B 1 47 LEU 47 47 47 LEU LEU B . n B 1 48 GLN 48 48 48 GLN GLN B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 VAL 50 50 50 VAL VAL B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 ASP 53 53 53 ASP ASP B . n B 1 54 ASN 54 54 54 ASN ASN B . n B 1 55 TYR 55 55 55 TYR TYR B . n B 1 56 ILE 56 56 56 ILE ILE B . n B 1 57 THR 57 57 57 THR THR B . n B 1 58 GLU 58 58 58 GLU GLU B . n B 1 59 THR 59 59 59 THR THR B . n B 1 60 PHE 60 60 60 PHE PHE B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 TRP 62 62 62 TRP TRP B . n B 1 63 TRP 63 63 63 TRP TRP B . n B 1 64 GLU 64 64 64 GLU GLU B . n B 1 65 PHE 65 65 65 PHE PHE B . n B 1 66 GLU 66 66 66 GLU GLU B . n B 1 67 ASN 67 67 67 ASN ASN B . n B 1 68 GLN 68 68 68 GLN GLN B . n B 1 69 TYR 69 69 69 TYR TYR B . n B 1 70 LEU 70 70 70 LEU LEU B . n B 1 71 GLU 71 71 71 GLU GLU B . n B 1 72 PHE 72 72 72 PHE PHE B . n B 1 73 GLU 73 73 73 GLU GLU B . n B 1 74 LEU 74 74 74 LEU LEU B . n B 1 75 ASP 75 75 75 ASP ASP B . n B 1 76 TYR 76 76 76 TYR TYR B . n B 1 77 TYR 77 77 77 TYR TYR B . n B 1 78 VAL 78 78 78 VAL VAL B . n B 1 79 LYS 79 79 79 LYS LYS B . n B 1 80 ASP 80 80 80 ASP ASP B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 LYS 82 82 82 LYS LYS B . n B 1 83 ILE 83 83 83 ILE ILE B . n B 1 84 PHE 84 84 84 PHE PHE B . n B 1 85 VAL 85 85 85 VAL VAL B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 GLU 87 87 87 GLU GLU B . n B 1 88 MET 88 88 88 MET MET B . n B 1 89 HIS 89 89 89 HIS HIS B . n B 1 90 PHE 90 90 90 PHE PHE B . n B 1 91 TRP 91 91 91 TRP TRP B . n B 1 92 ARG 92 92 92 ARG ARG B . n B 1 93 LYS 93 93 93 LYS LYS B . n B 1 94 ILE 94 94 94 ILE ILE B . n B 1 95 ARG 95 95 95 ARG ARG B . n B 1 96 LYS 96 96 96 LYS LYS B . n B 1 97 LEU 97 97 ? ? ? B . n B 1 98 GLU 98 98 ? ? ? B . n B 1 99 HIS 99 99 ? ? ? B . n B 1 100 HIS 100 100 ? ? ? B . n B 1 101 HIS 101 101 ? ? ? B . n B 1 102 HIS 102 102 ? ? ? B . n B 1 103 HIS 103 103 ? ? ? B . n B 1 104 HIS 104 104 ? ? ? B . n C 2 1 MSE 1 1 1 MSE MSE C . n C 2 2 ARG 2 2 2 ARG ARG C . n C 2 3 ASN 3 3 3 ASN ASN C . n C 2 4 LEU 4 4 4 LEU LEU C . n C 2 5 LYS 5 5 5 LYS LYS C . n C 2 6 ARG 6 6 6 ARG ARG C . n C 2 7 ILE 7 7 7 ILE ILE C . n C 2 8 VAL 8 8 8 VAL VAL C . n C 2 9 MSE 9 9 9 MSE MSE C . n C 2 10 GLY 10 10 10 GLY GLY C . n C 2 11 GLU 11 11 11 GLU GLU C . n C 2 12 ASN 12 12 12 ASN ASN C . n C 2 13 LYS 13 13 13 LYS LYS C . n C 2 14 LEU 14 14 14 LEU LEU C . n C 2 15 ILE 15 15 15 ILE ILE C . n C 2 16 GLY 16 16 16 GLY GLY C . n C 2 17 LEU 17 17 17 LEU LEU C . n C 2 18 VAL 18 18 18 VAL VAL C . n C 2 19 ARG 19 19 19 ARG ARG C . n C 2 20 THR 20 20 20 THR THR C . n C 2 21 ALA 21 21 21 ALA ALA C . n C 2 22 LEU 22 22 22 LEU LEU C . n C 2 23 ASP 23 23 23 ASP ASP C . n C 2 24 SER 24 24 24 SER SER C . n C 2 25 ILE 25 25 25 ILE ILE C . n C 2 26 THR 26 26 26 THR THR C . n C 2 27 LEU 27 27 27 LEU LEU C . n C 2 28 GLY 28 28 28 GLY GLY C . n C 2 29 GLN 29 29 29 GLN GLN C . n C 2 30 GLY 30 30 30 GLY GLY C . n C 2 31 VAL 31 31 31 VAL VAL C . n C 2 32 ASN 32 32 32 ASN ASN C . n C 2 33 GLU 33 33 33 GLU GLU C . n C 2 34 ALA 34 34 34 ALA ALA C . n C 2 35 LYS 35 35 35 LYS LYS C . n C 2 36 ILE 36 36 36 ILE ILE C . n C 2 37 LYS 37 37 37 LYS LYS C . n C 2 38 SER 38 38 38 SER SER C . n C 2 39 PRO 39 39 39 PRO PRO C . n C 2 40 GLN 40 40 40 GLN GLN C . n C 2 41 SER 41 41 41 SER SER C . n C 2 42 TYR 42 42 42 TYR TYR C . n C 2 43 ALA 43 43 43 ALA ALA C . n C 2 44 PHE 44 44 44 PHE PHE C . n C 2 45 HIS 45 45 45 HIS HIS C . n C 2 46 THR 46 46 46 THR THR C . n C 2 47 ILE 47 47 47 ILE ILE C . n C 2 48 SER 48 48 48 SER SER C . n C 2 49 VAL 49 49 49 VAL VAL C . n C 2 50 GLY 50 50 50 GLY GLY C . n C 2 51 THR 51 51 51 THR THR C . n C 2 52 ILE 52 52 52 ILE ILE C . n C 2 53 SER 53 53 53 SER SER C . n C 2 54 LEU 54 54 54 LEU LEU C . n C 2 55 ASP 55 55 55 ASP ASP C . n C 2 56 ILE 56 56 56 ILE ILE C . n C 2 57 CYS 57 57 57 CYS CYS C . n C 2 58 LYS 58 58 58 LYS LYS C . n C 2 59 ALA 59 59 59 ALA ALA C . n C 2 60 ILE 60 60 60 ILE ILE C . n C 2 61 TYR 61 61 61 TYR TYR C . n C 2 62 SER 62 62 62 SER SER C . n C 2 63 SER 63 63 63 SER SER C . n C 2 64 SER 64 64 64 SER SER C . n C 2 65 GLU 65 65 65 GLU GLU C . n C 2 66 ILE 66 66 66 ILE ILE C . n C 2 67 GLY 67 67 67 GLY GLY C . n C 2 68 ARG 68 68 68 ARG ARG C . n C 2 69 LYS 69 69 69 LYS LYS C . n C 2 70 GLN 70 70 70 GLN GLN C . n C 2 71 LEU 71 71 71 LEU LEU C . n C 2 72 GLU 72 72 72 GLU GLU C . n C 2 73 ASN 73 73 73 ASN ASN C . n C 2 74 LEU 74 74 74 LEU LEU C . n C 2 75 SER 75 75 75 SER SER C . n C 2 76 LYS 76 76 76 LYS LYS C . n C 2 77 LYS 77 77 77 LYS LYS C . n C 2 78 TYR 78 78 78 TYR TYR C . n C 2 79 ASN 79 79 79 ASN ASN C . n C 2 80 MSE 80 80 80 MSE MSE C . n C 2 81 PRO 81 81 81 PRO PRO C . n C 2 82 PHE 82 82 82 PHE PHE C . n C 2 83 GLU 83 83 83 GLU GLU C . n C 2 84 ASP 84 84 84 ASP ASP C . n C 2 85 LEU 85 85 85 LEU LEU C . n C 2 86 TRP 86 86 86 TRP TRP C . n C 2 87 PHE 87 87 87 PHE PHE C . n C 2 88 TYR 88 88 88 TYR TYR C . n C 2 89 GLY 89 89 89 GLY GLY C . n C 2 90 GLY 90 90 90 GLY GLY C . n C 2 91 PHE 91 91 91 PHE PHE C . n C 2 92 LEU 92 92 92 LEU LEU C . n C 2 93 HIS 93 93 93 HIS HIS C . n C 2 94 ASP 94 94 94 ASP ASP C . n C 2 95 TRP 95 95 95 TRP TRP C . n C 2 96 ASN 96 96 96 ASN ASN C . n C 2 97 LYS 97 97 97 LYS LYS C . n C 2 98 LEU 98 98 98 LEU LEU C . n C 2 99 SER 99 99 99 SER SER C . n C 2 100 GLY 100 100 100 GLY GLY C . n C 2 101 LYS 101 101 101 LYS LYS C . n C 2 102 GLU 102 102 102 GLU GLU C . n C 2 103 GLU 103 103 103 GLU GLU C . n C 2 104 SER 104 104 ? ? ? C . n C 2 105 LEU 105 105 ? ? ? C . n C 2 106 GLU 106 106 ? ? ? C . n C 2 107 ASN 107 107 107 ASN ASN C . n C 2 108 LYS 108 108 108 LYS LYS C . n C 2 109 GLU 109 109 109 GLU GLU C . n C 2 110 GLU 110 110 110 GLU GLU C . n C 2 111 LEU 111 111 111 LEU LEU C . n C 2 112 THR 112 112 112 THR THR C . n C 2 113 LYS 113 113 113 LYS LYS C . n C 2 114 LYS 114 114 114 LYS LYS C . n C 2 115 ILE 115 115 115 ILE ILE C . n C 2 116 ILE 116 116 116 ILE ILE C . n C 2 117 ASP 117 117 117 ASP ASP C . n C 2 118 LYS 118 118 118 LYS LYS C . n C 2 119 LEU 119 119 119 LEU LEU C . n C 2 120 LYS 120 120 120 LYS LYS C . n C 2 121 LEU 121 121 121 LEU LEU C . n C 2 122 PRO 122 122 122 PRO PRO C . n C 2 123 ASN 123 123 123 ASN ASN C . n C 2 124 GLU 124 124 124 GLU GLU C . n C 2 125 PHE 125 125 125 PHE PHE C . n C 2 126 LEU 126 126 126 LEU LEU C . n C 2 127 HIS 127 127 127 HIS HIS C . n C 2 128 GLY 128 128 128 GLY GLY C . n C 2 129 ILE 129 129 129 ILE ILE C . n C 2 130 SER 130 130 130 SER SER C . n C 2 131 THR 131 131 131 THR THR C . n C 2 132 MSE 132 132 132 MSE MSE C . n C 2 133 ALA 133 133 133 ALA ALA C . n C 2 134 GLU 134 134 134 GLU GLU C . n C 2 135 GLY 135 135 135 GLY GLY C . n C 2 136 HIS 136 136 136 HIS HIS C . n C 2 137 LEU 137 137 137 LEU LEU C . n C 2 138 PRO 138 138 138 PRO PRO C . n C 2 139 ASP 139 139 139 ASP ASP C . n C 2 140 ASN 140 140 140 ASN ASN C . n C 2 141 LEU 141 141 141 LEU LEU C . n C 2 142 HIS 142 142 142 HIS HIS C . n C 2 143 LEU 143 143 143 LEU LEU C . n C 2 144 PRO 144 144 144 PRO PRO C . n C 2 145 LEU 145 145 145 LEU LEU C . n C 2 146 TRP 146 146 146 TRP TRP C . n C 2 147 VAL 147 147 147 VAL VAL C . n C 2 148 SER 148 148 148 SER SER C . n C 2 149 ILE 149 149 149 ILE ILE C . n C 2 150 LYS 150 150 150 LYS LYS C . n C 2 151 LEU 151 151 151 LEU LEU C . n C 2 152 ALA 152 152 152 ALA ALA C . n C 2 153 ASP 153 153 153 ASP ASP C . n C 2 154 MSE 154 154 154 MSE MSE C . n C 2 155 LEU 155 155 155 LEU LEU C . n C 2 156 LEU 156 156 156 LEU LEU C . n C 2 157 ILE 157 157 157 ILE ILE C . n C 2 158 SER 158 158 158 SER SER C . n C 2 159 ASP 159 159 159 ASP ASP C . n C 2 160 ILE 160 160 160 ILE ILE C . n C 2 161 GLY 161 161 161 GLY GLY C . n C 2 162 SER 162 162 162 SER SER C . n C 2 163 VAL 163 163 163 VAL VAL C . n C 2 164 ARG 164 164 164 ARG ARG C . n C 2 165 ASP 165 165 165 ASP ASP C . n C 2 166 VAL 166 166 166 VAL VAL C . n C 2 167 PHE 167 167 167 PHE PHE C . n C 2 168 TYR 168 168 168 TYR TYR C . n C 2 169 PHE 169 169 169 PHE PHE C . n C 2 170 ALA 170 170 170 ALA ALA C . n C 2 171 ASN 171 171 171 ASN ASN C . n C 2 172 SER 172 172 172 SER SER C . n C 2 173 ASP 173 173 173 ASP ASP C . n C 2 174 SER 174 174 174 SER SER C . n C 2 175 TYR 175 175 175 TYR TYR C . n C 2 176 ARG 176 176 176 ARG ARG C . n C 2 177 ASN 177 177 177 ASN ASN C . n C 2 178 ALA 178 178 178 ALA ALA C . n C 2 179 ILE 179 179 179 ILE ILE C . n C 2 180 GLU 180 180 180 GLU GLU C . n C 2 181 ALA 181 181 181 ALA ALA C . n C 2 182 LEU 182 182 182 LEU LEU C . n C 2 183 LYS 183 183 183 LYS LYS C . n C 2 184 GLU 184 184 184 GLU GLU C . n C 2 185 TYR 185 185 185 TYR TYR C . n C 2 186 ASN 186 186 186 ASN ASN C . n C 2 187 LEU 187 187 187 LEU LEU C . n C 2 188 GLU 188 188 188 GLU GLU C . n C 2 189 LEU 189 189 189 LEU LEU C . n C 2 190 ASN 190 190 190 ASN ASN C . n C 2 191 TYR 191 191 191 TYR TYR C . n C 2 192 VAL 192 192 192 VAL VAL C . n C 2 193 SER 193 193 193 SER SER C . n C 2 194 SER 194 194 194 SER SER C . n C 2 195 THR 195 195 195 THR THR C . n C 2 196 PHE 196 196 196 PHE PHE C . n C 2 197 ARG 197 197 197 ARG ARG C . n C 2 198 LEU 198 198 198 LEU LEU C . n C 2 199 PHE 199 199 199 PHE PHE C . n C 2 200 THR 200 200 200 THR THR C . n C 2 201 LEU 201 201 201 LEU LEU C . n C 2 202 ILE 202 202 202 ILE ILE C . n C 2 203 ALA 203 203 203 ALA ALA C . n C 2 204 SER 204 204 204 SER SER C . n C 2 205 LYS 205 205 205 LYS LYS C . n C 2 206 GLU 206 206 206 GLU GLU C . n C 2 207 LEU 207 207 207 LEU LEU C . n C 2 208 LEU 208 208 208 LEU LEU C . n C 2 209 ASN 209 209 209 ASN ASN C . n C 2 210 ASP 210 210 210 ASP ASP C . n C 2 211 VAL 211 211 211 VAL VAL C . n C 2 212 PHE 212 212 212 PHE PHE C . n C 2 213 ASN 213 213 213 ASN ASN C . n C 2 214 GLU 214 214 214 GLU GLU C . n C 2 215 LYS 215 215 215 LYS LYS C . n C 2 216 SER 216 216 216 SER SER C . n C 2 217 GLY 217 217 217 GLY GLY C . n C 2 218 TYR 218 218 218 TYR TYR C . n C 2 219 PHE 219 219 219 PHE PHE C . n C 2 220 PRO 220 220 220 PRO PRO C . n C 2 221 LEU 221 221 221 LEU LEU C . n C 2 222 ILE 222 222 222 ILE ILE C . n C 2 223 SER 223 223 223 SER SER C . n C 2 224 TYR 224 224 224 TYR TYR C . n C 2 225 ALA 225 225 225 ALA ALA C . n C 2 226 ASP 226 226 226 ASP ASP C . n C 2 227 GLY 227 227 227 GLY GLY C . n C 2 228 ILE 228 228 228 ILE ILE C . n C 2 229 VAL 229 229 229 VAL VAL C . n C 2 230 PHE 230 230 230 PHE PHE C . n C 2 231 LEU 231 231 231 LEU LEU C . n C 2 232 LYS 232 232 232 LYS LYS C . n C 2 233 ARG 233 233 233 ARG ARG C . n C 2 234 LYS 234 234 234 LYS LYS C . n C 2 235 ASN 235 235 235 ASN ASN C . n C 2 236 SER 236 236 236 SER SER C . n C 2 237 GLN 237 237 237 GLN GLN C . n C 2 238 PRO 238 238 238 PRO PRO C . n C 2 239 VAL 239 239 239 VAL VAL C . n C 2 240 LEU 240 240 240 LEU LEU C . n C 2 241 LEU 241 241 241 LEU LEU C . n C 2 242 SER 242 242 242 SER SER C . n C 2 243 LYS 243 243 243 LYS LYS C . n C 2 244 ILE 244 244 244 ILE ILE C . n C 2 245 VAL 245 245 245 VAL VAL C . n C 2 246 ASP 246 246 246 ASP ASP C . n C 2 247 LEU 247 247 247 LEU LEU C . n C 2 248 LEU 248 248 248 LEU LEU C . n C 2 249 SER 249 249 249 SER SER C . n C 2 250 ARG 250 250 250 ARG ARG C . n C 2 251 GLN 251 251 251 GLN GLN C . n C 2 252 VAL 252 252 252 VAL VAL C . n C 2 253 PHE 253 253 253 PHE PHE C . n C 2 254 SER 254 254 254 SER SER C . n C 2 255 SER 255 255 255 SER SER C . n C 2 256 SER 256 256 256 SER SER C . n C 2 257 SER 257 257 257 SER SER C . n C 2 258 GLU 258 258 258 GLU GLU C . n C 2 259 VAL 259 259 259 VAL VAL C . n C 2 260 ILE 260 260 260 ILE ILE C . n C 2 261 GLU 261 261 261 GLU GLU C . n C 2 262 GLU 262 262 262 GLU GLU C . n C 2 263 LYS 263 263 263 LYS LYS C . n C 2 264 ILE 264 264 264 ILE ILE C . n C 2 265 SER 265 265 265 SER SER C . n C 2 266 ASP 266 266 266 ASP ASP C . n C 2 267 ILE 267 267 267 ILE ILE C . n C 2 268 GLU 268 268 268 GLU GLU C . n C 2 269 LYS 269 269 269 LYS LYS C . n C 2 270 CYS 270 270 270 CYS CYS C . n C 2 271 ILE 271 271 271 ILE ILE C . n C 2 272 LYS 272 272 272 LYS LYS C . n C 2 273 ASN 273 273 273 ASN ASN C . n C 2 274 LYS 274 274 274 LYS LYS C . n C 2 275 GLU 275 275 275 GLU GLU C . n C 2 276 GLU 276 276 276 GLU GLU C . n C 2 277 LEU 277 277 277 LEU LEU C . n C 2 278 PHE 278 278 278 PHE PHE C . n C 2 279 ARG 279 279 279 ARG ARG C . n C 2 280 GLN 280 280 280 GLN GLN C . n C 2 281 MSE 281 281 281 MSE MSE C . n C 2 282 ASN 282 282 282 ASN ASN C . n C 2 283 ILE 283 283 283 ILE ILE C . n C 2 284 ASP 284 284 284 ASP ASP C . n C 2 285 VAL 285 285 285 VAL VAL C . n C 2 286 LYS 286 286 286 LYS LYS C . n C 2 287 SER 287 287 287 SER SER C . n C 2 288 ALA 288 288 288 ALA ALA C . n C 2 289 ILE 289 289 289 ILE ILE C . n C 2 290 TYR 290 290 290 TYR TYR C . n C 2 291 ASP 291 291 291 ASP ASP C . n C 2 292 GLU 292 292 292 GLU GLU C . n C 2 293 GLU 293 293 293 GLU GLU C . n C 2 294 GLY 294 294 294 GLY GLY C . n C 2 295 LYS 295 295 295 LYS LYS C . n C 2 296 VAL 296 296 296 VAL VAL C . n C 2 297 LYS 297 297 297 LYS LYS C . n C 2 298 GLN 298 298 298 GLN GLN C . n C 2 299 ILE 299 299 299 ILE ILE C . n C 2 300 ASN 300 300 300 ASN ASN C . n C 2 301 ALA 301 301 301 ALA ALA C . n C 2 302 PHE 302 302 302 PHE PHE C . n C 2 303 LEU 303 303 303 LEU LEU C . n C 2 304 PRO 304 304 304 PRO PRO C . n C 2 305 THR 305 305 305 THR THR C . n C 2 306 LYS 306 306 306 LYS LYS C . n C 2 307 VAL 307 307 307 VAL VAL C . n C 2 308 CYS 308 308 308 CYS CYS C . n C 2 309 LYS 309 309 309 LYS LYS C . n C 2 310 PRO 310 310 310 PRO PRO C . n C 2 311 PHE 311 311 311 PHE PHE C . n C 2 312 GLU 312 312 312 GLU GLU C . n C 2 313 ASP 313 313 313 ASP ASP C . n C 2 314 VAL 314 314 314 VAL VAL C . n C 2 315 VAL 315 315 315 VAL VAL C . n C 2 316 GLY 316 316 316 GLY GLY C . n C 2 317 ASN 317 317 317 ASN ASN C . n C 2 318 LEU 318 318 318 LEU LEU C . n C 2 319 ASP 319 319 319 ASP ASP C . n C 2 320 ASN 320 320 320 ASN ASN C . n C 2 321 LYS 321 321 321 LYS LYS C . n C 2 322 SER 322 322 322 SER SER C . n C 2 323 LYS 323 323 323 LYS LYS C . n C 2 324 LEU 324 324 324 LEU LEU C . n C 2 325 GLN 325 325 325 GLN GLN C . n C 2 326 VAL 326 326 326 VAL VAL C . n C 2 327 ALA 327 327 327 ALA ALA C . n C 2 328 ARG 328 328 328 ARG ARG C . n C 2 329 GLU 329 329 329 GLU GLU C . n C 2 330 VAL 330 330 330 VAL VAL C . n C 2 331 ILE 331 331 331 ILE ILE C . n C 2 332 GLU 332 332 332 GLU GLU C . n C 2 333 ARG 333 333 333 ARG ARG C . n C 2 334 ASN 334 334 334 ASN ASN C . n C 2 335 ARG 335 335 335 ARG ARG C . n C 2 336 LYS 336 336 336 LYS LYS C . n C 2 337 ASP 337 337 337 ASP ASP C . n C 2 338 ILE 338 338 338 ILE ILE C . n C 2 339 PRO 339 339 339 PRO PRO C . n C 2 340 PHE 340 340 340 PHE PHE C . n C 2 341 GLY 341 341 341 GLY GLY C . n C 2 342 LEU 342 342 342 LEU LEU C . n C 2 343 LEU 343 343 343 LEU LEU C . n C 2 344 ILE 344 344 344 ILE ILE C . n C 2 345 TYR 345 345 345 TYR TYR C . n C 2 346 PHE 346 346 346 PHE PHE C . n C 2 347 VAL 347 347 347 VAL VAL C . n C 2 348 ASN 348 348 348 ASN ASN C . n C 2 349 LYS 349 349 349 LYS LYS C . n C 2 350 PHE 350 350 350 PHE PHE C . n C 2 351 SER 351 351 351 SER SER C . n C 2 352 LYS 352 352 352 LYS LYS C . n C 2 353 ASN 353 353 353 ASN ASN C . n C 2 354 GLU 354 354 354 GLU GLU C . n C 2 355 GLU 355 355 355 GLU GLU C . n C 2 356 ASP 356 356 356 ASP ASP C . n C 2 357 TYR 357 357 357 TYR TYR C . n C 2 358 ILE 358 358 358 ILE ILE C . n C 2 359 ARG 359 359 359 ARG ARG C . n C 2 360 LYS 360 360 360 LYS LYS C . n C 2 361 GLY 361 361 361 GLY GLY C . n C 2 362 LEU 362 362 362 LEU LEU C . n C 2 363 GLY 363 363 363 GLY GLY C . n C 2 364 ILE 364 364 364 ILE ILE C . n C 2 365 ASN 365 365 365 ASN ASN C . n C 2 366 GLU 366 366 366 GLU GLU C . n C 2 367 LYS 367 367 367 LYS LYS C . n C 2 368 SER 368 368 368 SER SER C . n C 2 369 LEU 369 369 369 LEU LEU C . n C 2 370 LYS 370 370 370 LYS LYS C . n C 2 371 TYR 371 371 371 TYR TYR C . n C 2 372 LEU 372 372 372 LEU LEU C . n C 2 373 LEU 373 373 373 LEU LEU C . n C 2 374 ASN 374 374 374 ASN ASN C . n C 2 375 ILE 375 375 375 ILE ILE C . n C 2 376 GLY 376 376 376 GLY GLY C . n C 2 377 ASP 377 377 377 ASP ASP C . n C 2 378 VAL 378 378 378 VAL VAL C . n C 2 379 GLN 379 379 379 GLN GLN C . n C 2 380 LYS 380 380 380 LYS LYS C . n C 2 381 ALA 381 381 381 ALA ALA C . n C 2 382 LEU 382 382 382 LEU LEU C . n C 2 383 ASP 383 383 383 ASP ASP C . n C 2 384 LYS 384 384 384 LYS LYS C . n C 2 385 ILE 385 385 385 ILE ILE C . n C 2 386 LEU 386 386 386 LEU LEU C . n C 2 387 GLU 387 387 387 GLU GLU C . n C 2 388 LEU 388 388 388 LEU LEU C . n C 2 389 LEU 389 389 389 LEU LEU C . n C 2 390 GLU 390 390 390 GLU GLU C . n C 2 391 LYS 391 391 391 LYS LYS C . n C 2 392 ARG 392 392 392 ARG ARG C . n C 2 393 TYR 393 393 393 TYR TYR C . n C 2 394 ALA 394 394 394 ALA ALA C . n C 2 395 GLU 395 395 395 GLU GLU C . n C 2 396 GLN 396 396 396 GLN GLN C . n C 2 397 SER 397 397 397 SER SER C . n C 2 398 SER 398 398 398 SER SER C . n C 2 399 ASP 399 399 399 ASP ASP C . n C 2 400 LYS 400 400 400 LYS LYS C . n C 2 401 THR 401 401 401 THR THR C . n C 2 402 LEU 402 402 402 LEU LEU C . n C 2 403 LEU 403 403 403 LEU LEU C . n C 2 404 TYR 404 404 404 TYR TYR C . n C 2 405 TYR 405 405 405 TYR TYR C . n C 2 406 VAL 406 406 406 VAL VAL C . n C 2 407 LYS 407 407 407 LYS LYS C . n C 2 408 PHE 408 408 408 PHE PHE C . n C 2 409 SER 409 409 409 SER SER C . n C 2 410 SER 410 410 410 SER SER C . n C 2 411 SER 411 411 411 SER SER C . n C 2 412 GLY 412 412 412 GLY GLY C . n C 2 413 ASN 413 413 413 ASN ASN C . n C 2 414 ILE 414 414 414 ILE ILE C . n C 2 415 ILE 415 415 415 ILE ILE C . n C 2 416 ASP 416 416 416 ASP ASP C . n C 2 417 ASP 417 417 417 ASP ASP C . n C 2 418 LEU 418 418 418 LEU LEU C . n C 2 419 PRO 419 419 419 PRO PRO C . n C 2 420 LYS 420 420 420 LYS LYS C . n C 2 421 ILE 421 421 421 ILE ILE C . n C 2 422 THR 422 422 422 THR THR C . n C 2 423 ASP 423 423 423 ASP ASP C . n C 2 424 ARG 424 424 424 ARG ARG C . n C 2 425 PRO 425 425 425 PRO PRO C . n C 2 426 ASN 426 426 426 ASN ASN C . n C 2 427 ASP 427 427 427 ASP ASP C . n C 2 428 TYR 428 428 428 TYR TYR C . n C 2 429 CYS 429 429 429 CYS CYS C . n C 2 430 VAL 430 430 430 VAL VAL C . n C 2 431 VAL 431 431 431 VAL VAL C . n C 2 432 CYS 432 432 432 CYS CYS C . n C 2 433 GLY 433 433 433 GLY GLY C . n C 2 434 MSE 434 434 434 MSE MSE C . n C 2 435 PRO 435 435 435 PRO PRO C . n C 2 436 ILE 436 436 436 ILE ILE C . n C 2 437 TYR 437 437 437 TYR TYR C . n C 2 438 SER 438 438 438 SER SER C . n C 2 439 SER 439 439 439 SER SER C . n C 2 440 ASN 440 440 440 ASN ASN C . n C 2 441 PRO 441 441 441 PRO PRO C . n C 2 442 VAL 442 442 442 VAL VAL C . n C 2 443 ARG 443 443 443 ARG ARG C . n C 2 444 PHE 444 444 444 PHE PHE C . n C 2 445 VAL 445 445 445 VAL VAL C . n C 2 446 GLN 446 446 446 GLN GLN C . n C 2 447 TYR 447 447 ? ? ? C . n C 2 448 ALA 448 448 ? ? ? C . n C 2 449 SER 449 449 ? ? ? C . n C 2 450 GLU 450 450 ? ? ? C . n C 2 451 LEU 451 451 ? ? ? C . n C 2 452 GLY 452 452 ? ? ? C . n C 2 453 GLY 453 453 ? ? ? C . n C 2 454 ARG 454 454 ? ? ? C . n C 2 455 ALA 455 455 ? ? ? C . n C 2 456 GLU 456 456 ? ? ? C . n C 2 457 ILE 457 457 ? ? ? C . n C 2 458 TRP 458 458 ? ? ? C . n C 2 459 ILE 459 459 ? ? ? C . n C 2 460 PRO 460 460 ? ? ? C . n C 2 461 ARG 461 461 ? ? ? C . n C 2 462 GLU 462 462 ? ? ? C . n C 2 463 LYS 463 463 ? ? ? C . n C 2 464 ALA 464 464 ? ? ? C . n C 2 465 LEU 465 465 ? ? ? C . n C 2 466 ASP 466 466 ? ? ? C . n C 2 467 GLU 467 467 ? ? ? C . n C 2 468 ILE 468 468 ? ? ? C . n C 2 469 ASP 469 469 ? ? ? C . n C 2 470 ASN 470 470 ? ? ? C . n C 2 471 VAL 471 471 471 VAL VAL C . n C 2 472 ARG 472 472 472 ARG ARG C . n C 2 473 ASP 473 473 473 ASP ASP C . n C 2 474 ASP 474 474 474 ASP ASP C . n C 2 475 TRP 475 475 475 TRP TRP C . n C 2 476 LYS 476 476 476 LYS LYS C . n C 2 477 VAL 477 477 477 VAL VAL C . n C 2 478 CYS 478 478 478 CYS CYS C . n C 2 479 PRO 479 479 479 PRO PRO C . n C 2 480 ILE 480 480 480 ILE ILE C . n C 2 481 CYS 481 481 481 CYS CYS C . n C 2 482 ILE 482 482 482 ILE ILE C . n C 2 483 TYR 483 483 483 TYR TYR C . n C 2 484 GLU 484 484 484 GLU GLU C . n C 2 485 ALA 485 485 485 ALA ALA C . n C 2 486 ASN 486 486 486 ASN ASN C . n C 2 487 LEU 487 487 487 LEU LEU C . n C 2 488 MSE 488 488 488 MSE MSE C . n C 2 489 LYS 489 489 489 LYS LYS C . n C 2 490 ASP 490 490 490 ASP ASP C . n C 2 491 ARG 491 491 491 ARG ARG C . n C 2 492 VAL 492 492 492 VAL VAL C . n C 2 493 LYS 493 493 493 LYS LYS C . n C 2 494 PRO 494 494 494 PRO PRO C . n C 2 495 PRO 495 495 495 PRO PRO C . n C 2 496 TYR 496 496 496 TYR TYR C . n C 2 497 PHE 497 497 497 PHE PHE C . n C 2 498 ILE 498 498 498 ILE ILE C . n C 2 499 VAL 499 499 499 VAL VAL C . n C 2 500 THR 500 500 500 THR THR C . n C 2 501 PHE 501 501 501 PHE PHE C . n C 2 502 TYR 502 502 502 TYR TYR C . n C 2 503 PRO 503 503 503 PRO PRO C . n C 2 504 GLY 504 504 504 GLY GLY C . n C 2 505 VAL 505 505 505 VAL VAL C . n C 2 506 PRO 506 506 506 PRO PRO C . n C 2 507 ILE 507 507 507 ILE ILE C . n C 2 508 SER 508 508 508 SER SER C . n C 2 509 LEU 509 509 509 LEU LEU C . n C 2 510 LEU 510 510 510 LEU LEU C . n C 2 511 ASN 511 511 511 ASN ASN C . n C 2 512 ILE 512 512 512 ILE ILE C . n C 2 513 ILE 513 513 513 ILE ILE C . n C 2 514 ASP 514 514 514 ASP ASP C . n C 2 515 PHE 515 515 515 PHE PHE C . n C 2 516 ASP 516 516 516 ASP ASP C . n C 2 517 PHE 517 517 517 PHE PHE C . n C 2 518 SER 518 518 518 SER SER C . n C 2 519 GLN 519 519 519 GLN GLN C . n C 2 520 SER 520 520 520 SER SER C . n C 2 521 SER 521 521 521 SER SER C . n C 2 522 ILE 522 522 522 ILE ILE C . n C 2 523 LYS 523 523 523 LYS LYS C . n C 2 524 TYR 524 524 524 TYR TYR C . n C 2 525 TYR 525 525 525 TYR TYR C . n C 2 526 ILE 526 526 526 ILE ILE C . n C 2 527 ASP 527 527 527 ASP ASP C . n C 2 528 GLU 528 528 528 GLU GLU C . n C 2 529 GLU 529 529 529 GLU GLU C . n C 2 530 LYS 530 530 530 LYS LYS C . n C 2 531 ASP 531 531 531 ASP ASP C . n C 2 532 THR 532 532 532 THR THR C . n C 2 533 TYR 533 533 533 TYR TYR C . n C 2 534 PHE 534 534 534 PHE PHE C . n C 2 535 THR 535 535 535 THR THR C . n C 2 536 ALA 536 536 536 ALA ALA C . n C 2 537 PHE 537 537 537 PHE PHE C . n C 2 538 GLU 538 538 538 GLU GLU C . n C 2 539 LYS 539 539 539 LYS LYS C . n C 2 540 MSE 540 540 540 MSE MSE C . n C 2 541 GLY 541 541 541 GLY GLY C . n C 2 542 GLY 542 542 542 GLY GLY C . n C 2 543 ARG 543 543 543 ARG ARG C . n C 2 544 LEU 544 544 544 LEU LEU C . n C 2 545 GLU 545 545 545 GLU GLU C . n C 2 546 PRO 546 546 546 PRO PRO C . n C 2 547 TYR 547 547 547 TYR TYR C . n C 2 548 VAL 548 548 548 VAL VAL C . n C 2 549 LYS 549 549 549 LYS LYS C . n C 2 550 LYS 550 550 550 LYS LYS C . n C 2 551 VAL 551 551 551 VAL VAL C . n C 2 552 LEU 552 552 552 LEU LEU C . n C 2 553 PRO 553 553 553 PRO PRO C . n C 2 554 ALA 554 554 554 ALA ALA C . n C 2 555 TYR 555 555 555 TYR TYR C . n C 2 556 PHE 556 556 556 PHE PHE C . n C 2 557 SER 557 557 557 SER SER C . n C 2 558 SER 558 558 558 SER SER C . n C 2 559 LYS 559 559 559 LYS LYS C . n C 2 560 VAL 560 560 560 VAL VAL C . n C 2 561 ILE 561 561 561 ILE ILE C . n C 2 562 ILE 562 562 562 ILE ILE C . n C 2 563 LYS 563 563 563 LYS LYS C . n C 2 564 ALA 564 564 564 ALA ALA C . n C 2 565 SER 565 565 565 SER SER C . n C 2 566 GLU 566 566 566 GLU GLU C . n C 2 567 VAL 567 567 567 VAL VAL C . n C 2 568 SER 568 568 568 SER SER C . n C 2 569 ASN 569 569 569 ASN ASN C . n C 2 570 PHE 570 570 570 PHE PHE C . n C 2 571 SER 571 571 571 SER SER C . n C 2 572 LEU 572 572 572 LEU LEU C . n C 2 573 SER 573 573 573 SER SER C . n C 2 574 THR 574 574 574 THR THR C . n C 2 575 ARG 575 575 575 ARG ARG C . n C 2 576 LEU 576 576 576 LEU LEU C . n C 2 577 SER 577 577 577 SER SER C . n C 2 578 LYS 578 578 578 LYS LYS C . n C 2 579 SER 579 579 579 SER SER C . n C 2 580 GLU 580 580 580 GLU GLU C . n C 2 581 LEU 581 581 581 LEU LEU C . n C 2 582 ASN 582 582 582 ASN ASN C . n C 2 583 LYS 583 583 583 LYS LYS C . n C 2 584 LEU 584 584 584 LEU LEU C . n C 2 585 LEU 585 585 585 LEU LEU C . n C 2 586 PRO 586 586 586 PRO PRO C . n C 2 587 TYR 587 587 587 TYR TYR C . n C 2 588 ALA 588 588 588 ALA ALA C . n C 2 589 PRO 589 589 589 PRO PRO C . n C 2 590 MSE 590 590 590 MSE MSE C . n C 2 591 ILE 591 591 591 ILE ILE C . n C 2 592 SER 592 592 592 SER SER C . n C 2 593 MSE 593 593 593 MSE MSE C . n C 2 594 ILE 594 594 594 ILE ILE C . n C 2 595 PHE 595 595 595 PHE PHE C . n C 2 596 LEU 596 596 596 LEU LEU C . n C 2 597 THR 597 597 597 THR THR C . n C 2 598 SER 598 598 598 SER SER C . n C 2 599 PRO 599 599 599 PRO PRO C . n C 2 600 VAL 600 600 600 VAL VAL C . n C 2 601 LEU 601 601 601 LEU LEU C . n C 2 602 ILE 602 602 602 ILE ILE C . n C 2 603 SER 603 603 603 SER SER C . n C 2 604 SER 604 604 604 SER SER C . n C 2 605 ASN 605 605 605 ASN ASN C . n C 2 606 LEU 606 606 606 LEU LEU C . n C 2 607 TYR 607 607 607 TYR TYR C . n C 2 608 GLU 608 608 608 GLU GLU C . n C 2 609 MSE 609 609 609 MSE MSE C . n C 2 610 PRO 610 610 610 PRO PRO C . n C 2 611 ILE 611 611 611 ILE ILE C . n C 2 612 ALA 612 612 ? ? ? C . n C 2 613 HIS 613 613 613 HIS HIS C . n C 2 614 GLU 614 614 614 GLU GLU C . n C 2 615 ARG 615 615 615 ARG ARG C . n C 2 616 VAL 616 616 616 VAL VAL C . n C 2 617 ILE 617 617 617 ILE ILE C . n C 2 618 SER 618 618 618 SER SER C . n C 2 619 ILE 619 619 619 ILE ILE C . n C 2 620 THR 620 620 620 THR THR C . n C 2 621 SER 621 621 621 SER SER C . n C 2 622 THR 622 622 622 THR THR C . n C 2 623 TYR 623 623 623 TYR TYR C . n C 2 624 ASN 624 624 624 ASN ASN C . n C 2 625 TYR 625 625 625 TYR TYR C . n C 2 626 THR 626 626 626 THR THR C . n C 2 627 PHE 627 627 627 PHE PHE C . n C 2 628 MSE 628 628 628 MSE MSE C . n C 2 629 LYS 629 629 629 LYS LYS C . n C 2 630 SER 630 630 630 SER SER C . n C 2 631 LEU 631 631 631 LEU LEU C . n C 2 632 ASN 632 632 632 ASN ASN C . n C 2 633 SER 633 633 633 SER SER C . n C 2 634 ASN 634 634 634 ASN ASN C . n C 2 635 LEU 635 635 635 LEU LEU C . n C 2 636 LEU 636 636 636 LEU LEU C . n C 2 637 THR 637 637 637 THR THR C . n C 2 638 LEU 638 638 638 LEU LEU C . n C 2 639 TYR 639 639 639 TYR TYR C . n C 2 640 SER 640 640 640 SER SER C . n C 2 641 ILE 641 641 641 ILE ILE C . n C 2 642 PHE 642 642 642 PHE PHE C . n C 2 643 ALA 643 643 643 ALA ALA C . n C 2 644 TYR 644 644 644 TYR TYR C . n C 2 645 SER 645 645 645 SER SER C . n C 2 646 ALA 646 646 646 ALA ALA C . n C 2 647 LYS 647 647 647 LYS LYS C . n C 2 648 TYR 648 648 648 TYR TYR C . n C 2 649 ASP 649 649 649 ASP ASP C . n C 2 650 ALA 650 650 650 ALA ALA C . n C 2 651 MSE 651 651 651 MSE MSE C . n C 2 652 ARG 652 652 652 ARG ARG C . n C 2 653 LYS 653 653 653 LYS LYS C . n C 2 654 ILE 654 654 654 ILE ILE C . n C 2 655 CYS 655 655 655 CYS CYS C . n C 2 656 GLY 656 656 656 GLY GLY C . n C 2 657 ARG 657 657 657 ARG ARG C . n C 2 658 SER 658 658 658 SER SER C . n C 2 659 ASP 659 659 659 ASP ASP C . n C 2 660 LEU 660 660 660 LEU LEU C . n C 2 661 ASP 661 661 661 ASP ASP C . n C 2 662 ASN 662 662 662 ASN ASN C . n C 2 663 CYS 663 663 663 CYS CYS C . n C 2 664 LEU 664 664 664 LEU LEU C . n C 2 665 GLY 665 665 665 GLY GLY C . n C 2 666 TYR 666 666 666 TYR TYR C . n C 2 667 LEU 667 667 667 LEU LEU C . n C 2 668 THR 668 668 668 THR THR C . n C 2 669 GLU 669 669 669 GLU GLU C . n C 2 670 GLU 670 670 670 GLU GLU C . n C 2 671 MSE 671 671 671 MSE MSE C . n C 2 672 ASP 672 672 672 ASP ASP C . n C 2 673 LEU 673 673 673 LEU LEU C . n C 2 674 TYR 674 674 674 TYR TYR C . n C 2 675 SER 675 675 675 SER SER C . n C 2 676 SER 676 676 676 SER SER C . n C 2 677 VAL 677 677 677 VAL VAL C . n C 2 678 ASP 678 678 678 ASP ASP C . n C 2 679 PRO 679 679 679 PRO PRO C . n C 2 680 ALA 680 680 680 ALA ALA C . n C 2 681 LEU 681 681 681 LEU LEU C . n C 2 682 GLY 682 682 682 GLY GLY C . n C 2 683 VAL 683 683 683 VAL VAL C . n C 2 684 LEU 684 684 684 LEU LEU C . n C 2 685 SER 685 685 685 SER SER C . n C 2 686 ILE 686 686 686 ILE ILE C . n C 2 687 GLY 687 687 687 GLY GLY C . n C 2 688 MSE 688 688 688 MSE MSE C . n C 2 689 GLY 689 689 689 GLY GLY C . n C 2 690 VAL 690 690 690 VAL VAL C . n C 2 691 GLY 691 691 691 GLY GLY C . n C 2 692 THR 692 692 692 THR THR C . n C 2 693 PRO 693 693 693 PRO PRO C . n C 2 694 ILE 694 694 694 ILE ILE C . n C 2 695 ASP 695 695 695 ASP ASP C . n C 2 696 THR 696 696 696 THR THR C . n C 2 697 ASP 697 697 697 ASP ASP C . n C 2 698 GLU 698 698 698 GLU GLU C . n C 2 699 LYS 699 699 699 LYS LYS C . n C 2 700 PHE 700 700 700 PHE PHE C . n C 2 701 PHE 701 701 701 PHE PHE C . n C 2 702 SER 702 702 702 SER SER C . n C 2 703 ALA 703 703 703 ALA ALA C . n C 2 704 PHE 704 704 704 PHE PHE C . n C 2 705 LEU 705 705 705 LEU LEU C . n C 2 706 PRO 706 706 706 PRO PRO C . n C 2 707 VAL 707 707 707 VAL VAL C . n C 2 708 SER 708 708 708 SER SER C . n C 2 709 GLY 709 709 709 GLY GLY C . n C 2 710 TYR 710 710 710 TYR TYR C . n C 2 711 LEU 711 711 711 LEU LEU C . n C 2 712 LEU 712 712 712 LEU LEU C . n C 2 713 LYS 713 713 713 LYS LYS C . n C 2 714 VAL 714 714 714 VAL VAL C . n C 2 715 THR 715 715 715 THR THR C . n C 2 716 GLY 716 716 716 GLY GLY C . n C 2 717 LYS 717 717 717 LYS LYS C . n C 2 718 VAL 718 718 718 VAL VAL C . n C 2 719 SER 719 719 719 SER SER C . n C 2 720 LYS 720 720 720 LYS LYS C . n C 2 721 MSE 721 721 721 MSE MSE C . n C 2 722 GLY 722 722 722 GLY GLY C . n C 2 723 GLU 723 723 723 GLU GLU C . n C 2 724 THR 724 724 724 THR THR C . n C 2 725 LEU 725 725 725 LEU LEU C . n C 2 726 LYS 726 726 726 LYS LYS C . n C 2 727 SER 727 727 727 SER SER C . n C 2 728 SER 728 728 728 SER SER C . n C 2 729 ILE 729 729 729 ILE ILE C . n C 2 730 PHE 730 730 730 PHE PHE C . n C 2 731 SER 731 731 731 SER SER C . n C 2 732 ILE 732 732 732 ILE ILE C . n C 2 733 ALA 733 733 733 ALA ALA C . n C 2 734 TYR 734 734 734 TYR TYR C . n C 2 735 ALA 735 735 735 ALA ALA C . n C 2 736 LEU 736 736 736 LEU LEU C . n C 2 737 LYS 737 737 737 LYS LYS C . n C 2 738 ASP 738 738 738 ASP ASP C . n C 2 739 ILE 739 739 739 ILE ILE C . n C 2 740 ILE 740 740 740 ILE ILE C . n C 2 741 LYS 741 741 741 LYS LYS C . n C 2 742 SER 742 742 742 SER SER C . n C 2 743 GLN 743 743 743 GLN GLN C . n C 2 744 LYS 744 744 744 LYS LYS C . n C 2 745 VAL 745 745 745 VAL VAL C . n C 2 746 SER 746 746 746 SER SER C . n C 2 747 LYS 747 747 747 LYS LYS C . n C 2 748 TYR 748 748 748 TYR TYR C . n C 2 749 ASP 749 749 749 ASP ASP C . n C 2 750 VAL 750 750 750 VAL VAL C . n C 2 751 THR 751 751 751 THR THR C . n C 2 752 GLY 752 752 752 GLY GLY C . n C 2 753 PHE 753 753 753 PHE PHE C . n C 2 754 LEU 754 754 754 LEU LEU C . n C 2 755 ARG 755 755 755 ARG ARG C . n C 2 756 ASP 756 756 756 ASP ASP C . n C 2 757 GLY 757 757 757 GLY GLY C . n C 2 758 VAL 758 758 758 VAL VAL C . n C 2 759 ASP 759 759 759 ASP ASP C . n C 2 760 MSE 760 760 760 MSE MSE C . n C 2 761 PHE 761 761 761 PHE PHE C . n C 2 762 PHE 762 762 762 PHE PHE C . n C 2 763 LYS 763 763 763 LYS LYS C . n C 2 764 THR 764 764 764 THR THR C . n C 2 765 THR 765 765 765 THR THR C . n C 2 766 SER 766 766 766 SER SER C . n C 2 767 VAL 767 767 767 VAL VAL C . n C 2 768 ILE 768 768 768 ILE ILE C . n C 2 769 LYS 769 769 769 LYS LYS C . n C 2 770 ASP 770 770 770 ASP ASP C . n C 2 771 LYS 771 771 771 LYS LYS C . n C 2 772 GLU 772 772 772 GLU GLU C . n C 2 773 ASP 773 773 773 ASP ASP C . n C 2 774 ARG 774 774 774 ARG ARG C . n C 2 775 ILE 775 775 775 ILE ILE C . n C 2 776 GLY 776 776 776 GLY GLY C . n C 2 777 ILE 777 777 777 ILE ILE C . n C 2 778 SER 778 778 778 SER SER C . n C 2 779 VAL 779 779 779 VAL VAL C . n C 2 780 ASN 780 780 780 ASN ASN C . n C 2 781 ALA 781 781 781 ALA ALA C . n C 2 782 ALA 782 782 782 ALA ALA C . n C 2 783 ILE 783 783 783 ILE ILE C . n C 2 784 SER 784 784 784 SER SER C . n C 2 785 SER 785 785 785 SER SER C . n C 2 786 LEU 786 786 786 LEU LEU C . n C 2 787 GLU 787 787 787 GLU GLU C . n C 2 788 ASN 788 788 788 ASN ASN C . n C 2 789 LYS 789 789 789 LYS LYS C . n C 2 790 TYR 790 790 790 TYR TYR C . n C 2 791 ALA 791 791 791 ALA ALA C . n C 2 792 LEU 792 792 792 LEU LEU C . n C 2 793 ASP 793 793 793 ASP ASP C . n C 2 794 ASP 794 794 794 ASP ASP C . n C 2 795 GLN 795 795 795 GLN GLN C . n C 2 796 HIS 796 796 796 HIS HIS C . n C 2 797 ARG 797 797 797 ARG ARG C . n C 2 798 ALA 798 798 798 ALA ALA C . n C 2 799 GLN 799 799 799 GLN GLN C . n C 2 800 VAL 800 800 800 VAL VAL C . n C 2 801 TYR 801 801 801 TYR TYR C . n C 2 802 SER 802 802 802 SER SER C . n C 2 803 ALA 803 803 803 ALA ALA C . n C 2 804 LEU 804 804 804 LEU LEU C . n C 2 805 GLN 805 805 805 GLN GLN C . n C 2 806 ASP 806 806 806 ASP ASP C . n C 2 807 ILE 807 807 807 ILE ILE C . n C 2 808 PHE 808 808 808 PHE PHE C . n C 2 809 LYS 809 809 809 LYS LYS C . n C 2 810 THR 810 810 810 THR THR C . n C 2 811 LEU 811 811 811 LEU LEU C . n C 2 812 TYR 812 812 812 TYR TYR C . n C 2 813 SER 813 813 813 SER SER C . n C 2 814 ILE 814 814 814 ILE ILE C . n C 2 815 GLU 815 815 815 GLU GLU C . n C 2 816 GLU 816 816 816 GLU GLU C . n C 2 817 GLU 817 817 817 GLU GLU C . n C 2 818 SER 818 818 818 SER SER C . n C 2 819 ASP 819 819 819 ASP ASP C . n C 2 820 ARG 820 820 820 ARG ARG C . n C 2 821 SER 821 821 821 SER SER C . n C 2 822 LEU 822 822 822 LEU LEU C . n C 2 823 ALA 823 823 823 ALA ALA C . n C 2 824 ILE 824 824 824 ILE ILE C . n C 2 825 SER 825 825 825 SER SER C . n C 2 826 ILE 826 826 826 ILE ILE C . n C 2 827 ALA 827 827 827 ALA ALA C . n C 2 828 ASN 828 828 828 ASN ASN C . n C 2 829 THR 829 829 829 THR THR C . n C 2 830 LEU 830 830 830 LEU LEU C . n C 2 831 SER 831 831 831 SER SER C . n C 2 832 ASN 832 832 832 ASN ASN C . n C 2 833 TRP 833 833 833 TRP TRP C . n C 2 834 LEU 834 834 834 LEU LEU C . n C 2 835 TYR 835 835 835 TYR TYR C . n C 2 836 ILE 836 836 836 ILE ILE C . n C 2 837 ALA 837 837 837 ALA ALA C . n C 2 838 TYR 838 838 838 TYR TYR C . n C 2 839 LYS 839 839 839 LYS LYS C . n C 2 840 LEU 840 840 840 LEU LEU C . n C 2 841 VAL 841 841 841 VAL VAL C . n C 2 842 LEU 842 842 842 LEU LEU C . n C 2 843 GLN 843 843 843 GLN GLN C . n C 2 844 GLY 844 844 844 GLY ALA C . n C 2 845 ASP 845 845 ? ? ? C . n C 2 846 LYS 846 846 ? ? ? C . n C 2 847 SER 847 847 ? ? ? C . n C 2 848 LEU 848 848 ? ? ? C . n C 2 849 GLU 849 849 ? ? ? C . n C 2 850 HIS 850 850 ? ? ? C . n C 2 851 HIS 851 851 ? ? ? C . n C 2 852 HIS 852 852 ? ? ? C . n C 2 853 HIS 853 853 ? ? ? C . n C 2 854 HIS 854 854 ? ? ? C . n C 2 855 HIS 855 855 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 PO4 1 901 901 PO4 PO4 C . E 4 ZN 1 902 1 ZN ZN C . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 C MSE 1 C MSE 1 ? MET 'modified residue' 2 C MSE 9 C MSE 9 ? MET 'modified residue' 3 C MSE 80 C MSE 80 ? MET 'modified residue' 4 C MSE 132 C MSE 132 ? MET 'modified residue' 5 C MSE 154 C MSE 154 ? MET 'modified residue' 6 C MSE 281 C MSE 281 ? MET 'modified residue' 7 C MSE 434 C MSE 434 ? MET 'modified residue' 8 C MSE 488 C MSE 488 ? MET 'modified residue' 9 C MSE 540 C MSE 540 ? MET 'modified residue' 10 C MSE 590 C MSE 590 ? MET 'modified residue' 11 C MSE 593 C MSE 593 ? MET 'modified residue' 12 C MSE 609 C MSE 609 ? MET 'modified residue' 13 C MSE 628 C MSE 628 ? MET 'modified residue' 14 C MSE 651 C MSE 651 ? MET 'modified residue' 15 C MSE 671 C MSE 671 ? MET 'modified residue' 16 C MSE 688 C MSE 688 ? MET 'modified residue' 17 C MSE 721 C MSE 721 ? MET 'modified residue' 18 C MSE 760 C MSE 760 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E 1 2 A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? C CYS 429 ? C CYS 429 ? 1_555 ZN ? E ZN . ? C ZN 902 ? 1_555 SG ? C CYS 432 ? C CYS 432 ? 1_555 95.1 ? 2 SG ? C CYS 429 ? C CYS 429 ? 1_555 ZN ? E ZN . ? C ZN 902 ? 1_555 SG ? C CYS 478 ? C CYS 478 ? 1_555 106.2 ? 3 SG ? C CYS 432 ? C CYS 432 ? 1_555 ZN ? E ZN . ? C ZN 902 ? 1_555 SG ? C CYS 478 ? C CYS 478 ? 1_555 104.2 ? 4 SG ? C CYS 429 ? C CYS 429 ? 1_555 ZN ? E ZN . ? C ZN 902 ? 1_555 SG ? C CYS 481 ? C CYS 481 ? 1_555 104.6 ? 5 SG ? C CYS 432 ? C CYS 432 ? 1_555 ZN ? E ZN . ? C ZN 902 ? 1_555 SG ? C CYS 481 ? C CYS 481 ? 1_555 140.3 ? 6 SG ? C CYS 478 ? C CYS 478 ? 1_555 ZN ? E ZN . ? C ZN 902 ? 1_555 SG ? C CYS 481 ? C CYS 481 ? 1_555 102.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-28 2 'Structure model' 1 1 2020-12-02 3 'Structure model' 1 2 2020-12-09 4 'Structure model' 1 3 2021-06-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Source and taxonomy' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' entity 5 4 'Structure model' entity_src_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.page_first' 9 3 'Structure model' '_citation.page_last' 10 3 'Structure model' '_citation.title' 11 3 'Structure model' '_citation_author.identifier_ORCID' 12 4 'Structure model' '_entity.pdbx_description' 13 4 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 14 4 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' # _phasing.method SAD # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXDE ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 5 # _pdbx_entry_details.entry_id 6THH _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 27 ? ? -161.10 102.93 2 1 ASN A 54 ? ? -148.82 29.73 3 1 GLU A 64 ? ? -92.01 -64.55 4 1 GLU A 66 ? ? 53.85 -111.40 5 1 GLU A 81 ? ? 59.38 7.76 6 1 ASN B 54 ? ? -149.61 39.95 7 1 PHE B 65 ? ? 36.48 -52.50 8 1 GLU B 66 ? ? -127.01 -132.01 9 1 HIS C 136 ? ? -109.81 -149.83 10 1 SER C 158 ? ? -27.29 -42.90 11 1 ASP C 159 ? ? -158.19 76.35 12 1 ALA C 170 ? ? -57.33 -72.23 13 1 VAL C 211 ? ? -121.14 -73.95 14 1 PHE C 212 ? ? -82.56 37.65 15 1 PHE C 219 ? ? 52.94 77.78 16 1 ALA C 225 ? ? 66.04 -14.93 17 1 PHE C 253 ? ? -87.97 46.72 18 1 LYS C 274 ? ? -119.59 52.55 19 1 LYS C 295 ? ? -93.26 -88.12 20 1 ASP C 337 ? ? -101.80 -60.32 21 1 SER C 351 ? ? 66.36 -133.29 22 1 GLU C 366 ? ? -149.04 -23.60 23 1 ASN C 374 ? ? -80.42 -154.48 24 1 PHE C 408 ? ? -65.98 84.68 25 1 PRO C 419 ? ? -62.05 -178.20 26 1 ILE C 421 ? ? -63.59 79.24 27 1 ARG C 424 ? ? 57.60 72.19 28 1 ASP C 473 ? ? -99.39 -83.01 29 1 PRO C 479 ? ? -69.22 1.84 30 1 ASP C 490 ? ? -158.87 -52.39 31 1 SER C 521 ? ? 57.61 -129.70 32 1 TYR C 524 ? ? -145.99 -6.32 33 1 ARG C 575 ? ? -96.46 -141.45 34 1 PHE C 595 ? ? -93.16 38.85 35 1 THR C 597 ? ? 52.26 76.07 36 1 ASN C 632 ? ? -68.98 2.86 37 1 ILE C 654 ? ? -78.16 -74.95 38 1 ASP C 678 ? ? -171.81 135.34 39 1 ILE C 686 ? ? -137.45 -31.58 40 1 VAL C 690 ? ? -131.16 -98.34 41 1 PRO C 693 ? ? -30.43 119.34 42 1 ALA C 703 ? ? -151.35 -38.77 43 1 LYS C 717 ? ? -143.80 -7.96 44 1 LYS C 741 ? ? -73.74 22.76 45 1 SER C 818 ? ? 64.14 -147.52 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 97 ? A LEU 97 2 1 Y 1 A GLU 98 ? A GLU 98 3 1 Y 1 A HIS 99 ? A HIS 99 4 1 Y 1 A HIS 100 ? A HIS 100 5 1 Y 1 A HIS 101 ? A HIS 101 6 1 Y 1 A HIS 102 ? A HIS 102 7 1 Y 1 A HIS 103 ? A HIS 103 8 1 Y 1 A HIS 104 ? A HIS 104 9 1 Y 1 B LEU 97 ? B LEU 97 10 1 Y 1 B GLU 98 ? B GLU 98 11 1 Y 1 B HIS 99 ? B HIS 99 12 1 Y 1 B HIS 100 ? B HIS 100 13 1 Y 1 B HIS 101 ? B HIS 101 14 1 Y 1 B HIS 102 ? B HIS 102 15 1 Y 1 B HIS 103 ? B HIS 103 16 1 Y 1 B HIS 104 ? B HIS 104 17 1 Y 1 C SER 104 ? C SER 104 18 1 Y 1 C LEU 105 ? C LEU 105 19 1 Y 1 C GLU 106 ? C GLU 106 20 1 Y 1 C TYR 447 ? C TYR 447 21 1 Y 1 C ALA 448 ? C ALA 448 22 1 Y 1 C SER 449 ? C SER 449 23 1 Y 1 C GLU 450 ? C GLU 450 24 1 Y 1 C LEU 451 ? C LEU 451 25 1 Y 1 C GLY 452 ? C GLY 452 26 1 Y 1 C GLY 453 ? C GLY 453 27 1 Y 1 C ARG 454 ? C ARG 454 28 1 Y 1 C ALA 455 ? C ALA 455 29 1 Y 1 C GLU 456 ? C GLU 456 30 1 Y 1 C ILE 457 ? C ILE 457 31 1 Y 1 C TRP 458 ? C TRP 458 32 1 Y 1 C ILE 459 ? C ILE 459 33 1 Y 1 C PRO 460 ? C PRO 460 34 1 Y 1 C ARG 461 ? C ARG 461 35 1 Y 1 C GLU 462 ? C GLU 462 36 1 Y 1 C LYS 463 ? C LYS 463 37 1 Y 1 C ALA 464 ? C ALA 464 38 1 Y 1 C LEU 465 ? C LEU 465 39 1 Y 1 C ASP 466 ? C ASP 466 40 1 Y 1 C GLU 467 ? C GLU 467 41 1 Y 1 C ILE 468 ? C ILE 468 42 1 Y 1 C ASP 469 ? C ASP 469 43 1 Y 1 C ASN 470 ? C ASN 470 44 1 Y 1 C ALA 612 ? C ALA 612 45 1 Y 1 C ASP 845 ? C ASP 845 46 1 Y 1 C LYS 846 ? C LYS 846 47 1 Y 1 C SER 847 ? C SER 847 48 1 Y 1 C LEU 848 ? C LEU 848 49 1 Y 1 C GLU 849 ? C GLU 849 50 1 Y 1 C HIS 850 ? C HIS 850 51 1 Y 1 C HIS 851 ? C HIS 851 52 1 Y 1 C HIS 852 ? C HIS 852 53 1 Y 1 C HIS 853 ? C HIS 853 54 1 Y 1 C HIS 854 ? C HIS 854 55 1 Y 1 C HIS 855 ? C HIS 855 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal Lundbeckfonden Denmark R87-2018-1555 1 'Novo Nordisk Foundation' Denmark ? 2 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MSE ? ? MSE ? ? 'SUBJECT OF INVESTIGATION' ? 2 PO4 ? ? PO4 ? ? 'SUBJECT OF INVESTIGATION' ? 3 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'PHOSPHATE ION' PO4 4 'ZINC ION' ZN # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #