data_6THK # _entry.id 6THK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6THK pdb_00006thk 10.2210/pdb6thk/pdb WWPDB D_1292102999 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-04 2 'Structure model' 1 1 2020-03-25 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' citation 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_ISSN' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 20 3 'Structure model' '_pdbx_struct_conn_angle.value' 21 3 'Structure model' '_struct_conn.pdbx_dist_value' 22 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6THK _pdbx_database_status.recvd_initial_deposition_date 2019-11-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Behrens, H.M.' 1 0000-0002-7406-7086 'Kleanthous, C.' 2 0000-0002-3273-0302 'Lowe, E.D.' 3 0000-0002-1757-0208 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Mbio ? ? 2150-7511 ? ? 11 ? ? ? 'Pyocin S5 Import into Pseudomonas aeruginosa Reveals a Generic Mode of Bacteriocin Transport.' 2020 ? 10.1128/mBio.03230-19 32156826 ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? 2692-8205 ? ? ? ? ? ? 'Pyocin S5 import into Pseudomonas aeruginosa reveals a generic mode of bacteriocin transport' 2019 ? 10.1101/856047 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Behrens, H.M.' 1 0000-0002-7406-7086 primary 'Lowe, E.D.' 2 0000-0002-1757-0208 primary 'Gault, J.' 3 0000-0001-7686-2983 primary 'Housden, N.G.' 4 0000-0002-4706-8278 primary 'Kaminska, R.' 5 ? primary 'Weber, T.M.' 6 ? primary 'Thompson, C.M.A.' 7 ? primary 'Mislin, G.L.A.' 8 ? primary 'Schalk, I.J.' 9 ? primary 'Walker, D.' 10 0000-0002-4206-2942 primary 'Robinson, C.V.' 11 0000-0001-7829-5505 primary 'Kleanthous, C.' 12 0000-0002-3273-0302 1 'Behrens, H.M.' 13 0000-0002-7406-7086 1 'Lowe, E.D.' 14 0000-0002-1757-0208 1 'Gault, J.' 15 0000-0001-7686-2983 1 'Housden, N.G.' 16 0000-0002-4706-8278 1 'Kaminska, R.' 17 ? 1 'Weber, T.M.' 18 ? 1 'Thompson, C.' 19 ? 1 'Mislin, G.L.A.' 20 ? 1 'Schalk, I.J.' 21 ? 1 'Walker, D.' 22 0000-0002-4206-2942 1 'Robinson, C.V.' 23 0000-0001-7829-5505 1 'Kleanthous, C.' 24 0000-0002-3273-0302 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Pyocin S5' 57223.105 1 ? E215Q ? ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 8 ? ? ? ? 4 water nat water 18.015 84 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNDNEVPGSMVIVAQGPDDQYAYEVPPIDSAAVAGNMFGDLIQREIYLQKNIYYPVRSIFEQGTKEKKEINKKVSDQVD GLLKQITQGKREATRQERVDVMSAVLHKMESDLEGYKKTFTKGPFIDYEKQSSLSIYEAWVKIWEKNSWEERKKYPFQQL VRDELERAVAYYKQDSLSEAVKVLRQELNKQKALKEKEDLSQLERDYRTRKANLQMKVQSELDQAGSALPPLVSPTPEQW LERATRLVTQAIADKKQLQTTNNTLIKNSPTPLEKQKAIYNGELLVDEIASLQARLVKLNAETTRRRTEAERKAAEEQAL QDAIKFTADFYKEVTEKFGARTSEMARQLAEGARGKNIRSSAEAIKSFEKHKDALNKKLSLKDRQAIAKAFDSLDKQMMA KSLEKFSKGFGVVGKAIDAASLYQEFKISTETGDWKPFFVKIETLAAGAAASWLVGIAFATATATPIGILGFALVMAVTG AMIDEDLLEKANNLVISILEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNDNEVPGSMVIVAQGPDDQYAYEVPPIDSAAVAGNMFGDLIQREIYLQKNIYYPVRSIFEQGTKEKKEINKKVSDQVD GLLKQITQGKREATRQERVDVMSAVLHKMESDLEGYKKTFTKGPFIDYEKQSSLSIYEAWVKIWEKNSWEERKKYPFQQL VRDELERAVAYYKQDSLSEAVKVLRQELNKQKALKEKEDLSQLERDYRTRKANLQMKVQSELDQAGSALPPLVSPTPEQW LERATRLVTQAIADKKQLQTTNNTLIKNSPTPLEKQKAIYNGELLVDEIASLQARLVKLNAETTRRRTEAERKAAEEQAL QDAIKFTADFYKEVTEKFGARTSEMARQLAEGARGKNIRSSAEAIKSFEKHKDALNKKLSLKDRQAIAKAFDSLDKQMMA KSLEKFSKGFGVVGKAIDAASLYQEFKISTETGDWKPFFVKIETLAAGAAASWLVGIAFATATATPIGILGFALVMAVTG AMIDEDLLEKANNLVISILEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'ZINC ION' ZN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 ASP n 1 5 ASN n 1 6 GLU n 1 7 VAL n 1 8 PRO n 1 9 GLY n 1 10 SER n 1 11 MET n 1 12 VAL n 1 13 ILE n 1 14 VAL n 1 15 ALA n 1 16 GLN n 1 17 GLY n 1 18 PRO n 1 19 ASP n 1 20 ASP n 1 21 GLN n 1 22 TYR n 1 23 ALA n 1 24 TYR n 1 25 GLU n 1 26 VAL n 1 27 PRO n 1 28 PRO n 1 29 ILE n 1 30 ASP n 1 31 SER n 1 32 ALA n 1 33 ALA n 1 34 VAL n 1 35 ALA n 1 36 GLY n 1 37 ASN n 1 38 MET n 1 39 PHE n 1 40 GLY n 1 41 ASP n 1 42 LEU n 1 43 ILE n 1 44 GLN n 1 45 ARG n 1 46 GLU n 1 47 ILE n 1 48 TYR n 1 49 LEU n 1 50 GLN n 1 51 LYS n 1 52 ASN n 1 53 ILE n 1 54 TYR n 1 55 TYR n 1 56 PRO n 1 57 VAL n 1 58 ARG n 1 59 SER n 1 60 ILE n 1 61 PHE n 1 62 GLU n 1 63 GLN n 1 64 GLY n 1 65 THR n 1 66 LYS n 1 67 GLU n 1 68 LYS n 1 69 LYS n 1 70 GLU n 1 71 ILE n 1 72 ASN n 1 73 LYS n 1 74 LYS n 1 75 VAL n 1 76 SER n 1 77 ASP n 1 78 GLN n 1 79 VAL n 1 80 ASP n 1 81 GLY n 1 82 LEU n 1 83 LEU n 1 84 LYS n 1 85 GLN n 1 86 ILE n 1 87 THR n 1 88 GLN n 1 89 GLY n 1 90 LYS n 1 91 ARG n 1 92 GLU n 1 93 ALA n 1 94 THR n 1 95 ARG n 1 96 GLN n 1 97 GLU n 1 98 ARG n 1 99 VAL n 1 100 ASP n 1 101 VAL n 1 102 MET n 1 103 SER n 1 104 ALA n 1 105 VAL n 1 106 LEU n 1 107 HIS n 1 108 LYS n 1 109 MET n 1 110 GLU n 1 111 SER n 1 112 ASP n 1 113 LEU n 1 114 GLU n 1 115 GLY n 1 116 TYR n 1 117 LYS n 1 118 LYS n 1 119 THR n 1 120 PHE n 1 121 THR n 1 122 LYS n 1 123 GLY n 1 124 PRO n 1 125 PHE n 1 126 ILE n 1 127 ASP n 1 128 TYR n 1 129 GLU n 1 130 LYS n 1 131 GLN n 1 132 SER n 1 133 SER n 1 134 LEU n 1 135 SER n 1 136 ILE n 1 137 TYR n 1 138 GLU n 1 139 ALA n 1 140 TRP n 1 141 VAL n 1 142 LYS n 1 143 ILE n 1 144 TRP n 1 145 GLU n 1 146 LYS n 1 147 ASN n 1 148 SER n 1 149 TRP n 1 150 GLU n 1 151 GLU n 1 152 ARG n 1 153 LYS n 1 154 LYS n 1 155 TYR n 1 156 PRO n 1 157 PHE n 1 158 GLN n 1 159 GLN n 1 160 LEU n 1 161 VAL n 1 162 ARG n 1 163 ASP n 1 164 GLU n 1 165 LEU n 1 166 GLU n 1 167 ARG n 1 168 ALA n 1 169 VAL n 1 170 ALA n 1 171 TYR n 1 172 TYR n 1 173 LYS n 1 174 GLN n 1 175 ASP n 1 176 SER n 1 177 LEU n 1 178 SER n 1 179 GLU n 1 180 ALA n 1 181 VAL n 1 182 LYS n 1 183 VAL n 1 184 LEU n 1 185 ARG n 1 186 GLN n 1 187 GLU n 1 188 LEU n 1 189 ASN n 1 190 LYS n 1 191 GLN n 1 192 LYS n 1 193 ALA n 1 194 LEU n 1 195 LYS n 1 196 GLU n 1 197 LYS n 1 198 GLU n 1 199 ASP n 1 200 LEU n 1 201 SER n 1 202 GLN n 1 203 LEU n 1 204 GLU n 1 205 ARG n 1 206 ASP n 1 207 TYR n 1 208 ARG n 1 209 THR n 1 210 ARG n 1 211 LYS n 1 212 ALA n 1 213 ASN n 1 214 LEU n 1 215 GLN n 1 216 MET n 1 217 LYS n 1 218 VAL n 1 219 GLN n 1 220 SER n 1 221 GLU n 1 222 LEU n 1 223 ASP n 1 224 GLN n 1 225 ALA n 1 226 GLY n 1 227 SER n 1 228 ALA n 1 229 LEU n 1 230 PRO n 1 231 PRO n 1 232 LEU n 1 233 VAL n 1 234 SER n 1 235 PRO n 1 236 THR n 1 237 PRO n 1 238 GLU n 1 239 GLN n 1 240 TRP n 1 241 LEU n 1 242 GLU n 1 243 ARG n 1 244 ALA n 1 245 THR n 1 246 ARG n 1 247 LEU n 1 248 VAL n 1 249 THR n 1 250 GLN n 1 251 ALA n 1 252 ILE n 1 253 ALA n 1 254 ASP n 1 255 LYS n 1 256 LYS n 1 257 GLN n 1 258 LEU n 1 259 GLN n 1 260 THR n 1 261 THR n 1 262 ASN n 1 263 ASN n 1 264 THR n 1 265 LEU n 1 266 ILE n 1 267 LYS n 1 268 ASN n 1 269 SER n 1 270 PRO n 1 271 THR n 1 272 PRO n 1 273 LEU n 1 274 GLU n 1 275 LYS n 1 276 GLN n 1 277 LYS n 1 278 ALA n 1 279 ILE n 1 280 TYR n 1 281 ASN n 1 282 GLY n 1 283 GLU n 1 284 LEU n 1 285 LEU n 1 286 VAL n 1 287 ASP n 1 288 GLU n 1 289 ILE n 1 290 ALA n 1 291 SER n 1 292 LEU n 1 293 GLN n 1 294 ALA n 1 295 ARG n 1 296 LEU n 1 297 VAL n 1 298 LYS n 1 299 LEU n 1 300 ASN n 1 301 ALA n 1 302 GLU n 1 303 THR n 1 304 THR n 1 305 ARG n 1 306 ARG n 1 307 ARG n 1 308 THR n 1 309 GLU n 1 310 ALA n 1 311 GLU n 1 312 ARG n 1 313 LYS n 1 314 ALA n 1 315 ALA n 1 316 GLU n 1 317 GLU n 1 318 GLN n 1 319 ALA n 1 320 LEU n 1 321 GLN n 1 322 ASP n 1 323 ALA n 1 324 ILE n 1 325 LYS n 1 326 PHE n 1 327 THR n 1 328 ALA n 1 329 ASP n 1 330 PHE n 1 331 TYR n 1 332 LYS n 1 333 GLU n 1 334 VAL n 1 335 THR n 1 336 GLU n 1 337 LYS n 1 338 PHE n 1 339 GLY n 1 340 ALA n 1 341 ARG n 1 342 THR n 1 343 SER n 1 344 GLU n 1 345 MET n 1 346 ALA n 1 347 ARG n 1 348 GLN n 1 349 LEU n 1 350 ALA n 1 351 GLU n 1 352 GLY n 1 353 ALA n 1 354 ARG n 1 355 GLY n 1 356 LYS n 1 357 ASN n 1 358 ILE n 1 359 ARG n 1 360 SER n 1 361 SER n 1 362 ALA n 1 363 GLU n 1 364 ALA n 1 365 ILE n 1 366 LYS n 1 367 SER n 1 368 PHE n 1 369 GLU n 1 370 LYS n 1 371 HIS n 1 372 LYS n 1 373 ASP n 1 374 ALA n 1 375 LEU n 1 376 ASN n 1 377 LYS n 1 378 LYS n 1 379 LEU n 1 380 SER n 1 381 LEU n 1 382 LYS n 1 383 ASP n 1 384 ARG n 1 385 GLN n 1 386 ALA n 1 387 ILE n 1 388 ALA n 1 389 LYS n 1 390 ALA n 1 391 PHE n 1 392 ASP n 1 393 SER n 1 394 LEU n 1 395 ASP n 1 396 LYS n 1 397 GLN n 1 398 MET n 1 399 MET n 1 400 ALA n 1 401 LYS n 1 402 SER n 1 403 LEU n 1 404 GLU n 1 405 LYS n 1 406 PHE n 1 407 SER n 1 408 LYS n 1 409 GLY n 1 410 PHE n 1 411 GLY n 1 412 VAL n 1 413 VAL n 1 414 GLY n 1 415 LYS n 1 416 ALA n 1 417 ILE n 1 418 ASP n 1 419 ALA n 1 420 ALA n 1 421 SER n 1 422 LEU n 1 423 TYR n 1 424 GLN n 1 425 GLU n 1 426 PHE n 1 427 LYS n 1 428 ILE n 1 429 SER n 1 430 THR n 1 431 GLU n 1 432 THR n 1 433 GLY n 1 434 ASP n 1 435 TRP n 1 436 LYS n 1 437 PRO n 1 438 PHE n 1 439 PHE n 1 440 VAL n 1 441 LYS n 1 442 ILE n 1 443 GLU n 1 444 THR n 1 445 LEU n 1 446 ALA n 1 447 ALA n 1 448 GLY n 1 449 ALA n 1 450 ALA n 1 451 ALA n 1 452 SER n 1 453 TRP n 1 454 LEU n 1 455 VAL n 1 456 GLY n 1 457 ILE n 1 458 ALA n 1 459 PHE n 1 460 ALA n 1 461 THR n 1 462 ALA n 1 463 THR n 1 464 ALA n 1 465 THR n 1 466 PRO n 1 467 ILE n 1 468 GLY n 1 469 ILE n 1 470 LEU n 1 471 GLY n 1 472 PHE n 1 473 ALA n 1 474 LEU n 1 475 VAL n 1 476 MET n 1 477 ALA n 1 478 VAL n 1 479 THR n 1 480 GLY n 1 481 ALA n 1 482 MET n 1 483 ILE n 1 484 ASP n 1 485 GLU n 1 486 ASP n 1 487 LEU n 1 488 LEU n 1 489 GLU n 1 490 LYS n 1 491 ALA n 1 492 ASN n 1 493 ASN n 1 494 LEU n 1 495 VAL n 1 496 ILE n 1 497 SER n 1 498 ILE n 1 499 LEU n 1 500 GLU n 1 501 HIS n 1 502 HIS n 1 503 HIS n 1 504 HIS n 1 505 HIS n 1 506 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 506 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pyoS5, PA0985' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa PAO1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 VAL 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 MET 11 11 ? ? ? A . n A 1 12 VAL 12 12 ? ? ? A . n A 1 13 ILE 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 GLN 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 ASP 19 19 ? ? ? A . n A 1 20 ASP 20 20 ? ? ? A . n A 1 21 GLN 21 21 ? ? ? A . n A 1 22 TYR 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 TYR 24 24 ? ? ? A . n A 1 25 GLU 25 25 ? ? ? A . n A 1 26 VAL 26 26 ? ? ? A . n A 1 27 PRO 27 27 ? ? ? A . n A 1 28 PRO 28 28 ? ? ? A . n A 1 29 ILE 29 29 ? ? ? A . n A 1 30 ASP 30 30 ? ? ? A . n A 1 31 SER 31 31 ? ? ? A . n A 1 32 ALA 32 32 ? ? ? A . n A 1 33 ALA 33 33 ? ? ? A . n A 1 34 VAL 34 34 ? ? ? A . n A 1 35 ALA 35 35 ? ? ? A . n A 1 36 GLY 36 36 ? ? ? A . n A 1 37 ASN 37 37 ? ? ? A . n A 1 38 MET 38 38 ? ? ? A . n A 1 39 PHE 39 39 ? ? ? A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 TRP 140 140 140 TRP TRP A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 TRP 144 144 144 TRP TRP A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 TRP 149 149 149 TRP TRP A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 TYR 171 171 171 TYR TYR A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 MET 216 216 216 MET MET A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 GLN 219 219 219 GLN GLN A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 GLN 224 224 224 GLN GLN A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 PRO 231 231 231 PRO PRO A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 SER 234 234 234 SER SER A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 GLN 239 239 239 GLN GLN A . n A 1 240 TRP 240 240 240 TRP TRP A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 THR 245 245 245 THR THR A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 GLN 250 250 250 GLN GLN A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 ASP 254 254 254 ASP ASP A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 GLN 257 257 257 GLN GLN A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 GLN 259 259 259 GLN GLN A . n A 1 260 THR 260 260 260 THR THR A . n A 1 261 THR 261 261 261 THR THR A . n A 1 262 ASN 262 262 262 ASN ASN A . n A 1 263 ASN 263 263 263 ASN ASN A . n A 1 264 THR 264 264 264 THR THR A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 PRO 270 270 270 PRO PRO A . n A 1 271 THR 271 271 271 THR THR A . n A 1 272 PRO 272 272 272 PRO PRO A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 LYS 275 275 275 LYS LYS A . n A 1 276 GLN 276 276 276 GLN GLN A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 ILE 279 279 279 ILE ILE A . n A 1 280 TYR 280 280 280 TYR TYR A . n A 1 281 ASN 281 281 281 ASN ASN A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 VAL 286 286 286 VAL VAL A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 SER 291 291 291 SER SER A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 GLN 293 293 293 GLN GLN A . n A 1 294 ALA 294 294 294 ALA ALA A . n A 1 295 ARG 295 295 295 ARG ARG A . n A 1 296 LEU 296 296 296 LEU LEU A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 LYS 298 298 298 LYS LYS A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 ASN 300 300 300 ASN ASN A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 GLU 302 302 302 GLU GLU A . n A 1 303 THR 303 303 303 THR THR A . n A 1 304 THR 304 304 304 THR THR A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 ARG 306 306 306 ARG ARG A . n A 1 307 ARG 307 307 307 ARG ARG A . n A 1 308 THR 308 308 308 THR THR A . n A 1 309 GLU 309 309 309 GLU GLU A . n A 1 310 ALA 310 310 310 ALA ALA A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 ARG 312 312 312 ARG ARG A . n A 1 313 LYS 313 313 313 LYS LYS A . n A 1 314 ALA 314 314 314 ALA ALA A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 GLU 316 316 316 GLU GLU A . n A 1 317 GLU 317 317 317 GLU GLU A . n A 1 318 GLN 318 318 318 GLN GLN A . n A 1 319 ALA 319 319 319 ALA ALA A . n A 1 320 LEU 320 320 320 LEU LEU A . n A 1 321 GLN 321 321 321 GLN GLN A . n A 1 322 ASP 322 322 322 ASP ASP A . n A 1 323 ALA 323 323 323 ALA ALA A . n A 1 324 ILE 324 324 324 ILE ILE A . n A 1 325 LYS 325 325 325 LYS LYS A . n A 1 326 PHE 326 326 326 PHE PHE A . n A 1 327 THR 327 327 327 THR THR A . n A 1 328 ALA 328 328 328 ALA ALA A . n A 1 329 ASP 329 329 329 ASP ASP A . n A 1 330 PHE 330 330 330 PHE PHE A . n A 1 331 TYR 331 331 331 TYR TYR A . n A 1 332 LYS 332 332 332 LYS LYS A . n A 1 333 GLU 333 333 333 GLU GLU A . n A 1 334 VAL 334 334 334 VAL VAL A . n A 1 335 THR 335 335 335 THR THR A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 LYS 337 337 337 LYS LYS A . n A 1 338 PHE 338 338 338 PHE PHE A . n A 1 339 GLY 339 339 339 GLY GLY A . n A 1 340 ALA 340 340 340 ALA ALA A . n A 1 341 ARG 341 341 341 ARG ARG A . n A 1 342 THR 342 342 342 THR THR A . n A 1 343 SER 343 343 343 SER SER A . n A 1 344 GLU 344 344 344 GLU GLU A . n A 1 345 MET 345 345 345 MET MET A . n A 1 346 ALA 346 346 346 ALA ALA A . n A 1 347 ARG 347 347 347 ARG ARG A . n A 1 348 GLN 348 348 348 GLN GLN A . n A 1 349 LEU 349 349 349 LEU LEU A . n A 1 350 ALA 350 350 350 ALA ALA A . n A 1 351 GLU 351 351 351 GLU GLU A . n A 1 352 GLY 352 352 352 GLY GLY A . n A 1 353 ALA 353 353 353 ALA ALA A . n A 1 354 ARG 354 354 354 ARG ARG A . n A 1 355 GLY 355 355 355 GLY GLY A . n A 1 356 LYS 356 356 356 LYS LYS A . n A 1 357 ASN 357 357 357 ASN ASN A . n A 1 358 ILE 358 358 358 ILE ILE A . n A 1 359 ARG 359 359 359 ARG ARG A . n A 1 360 SER 360 360 360 SER SER A . n A 1 361 SER 361 361 361 SER SER A . n A 1 362 ALA 362 362 362 ALA ALA A . n A 1 363 GLU 363 363 363 GLU GLU A . n A 1 364 ALA 364 364 364 ALA ALA A . n A 1 365 ILE 365 365 365 ILE ILE A . n A 1 366 LYS 366 366 366 LYS LYS A . n A 1 367 SER 367 367 367 SER SER A . n A 1 368 PHE 368 368 368 PHE PHE A . n A 1 369 GLU 369 369 369 GLU GLU A . n A 1 370 LYS 370 370 370 LYS LYS A . n A 1 371 HIS 371 371 371 HIS HIS A . n A 1 372 LYS 372 372 372 LYS LYS A . n A 1 373 ASP 373 373 373 ASP ASP A . n A 1 374 ALA 374 374 374 ALA ALA A . n A 1 375 LEU 375 375 375 LEU LEU A . n A 1 376 ASN 376 376 376 ASN ASN A . n A 1 377 LYS 377 377 377 LYS LYS A . n A 1 378 LYS 378 378 378 LYS LYS A . n A 1 379 LEU 379 379 379 LEU LEU A . n A 1 380 SER 380 380 380 SER SER A . n A 1 381 LEU 381 381 381 LEU LEU A . n A 1 382 LYS 382 382 382 LYS LYS A . n A 1 383 ASP 383 383 383 ASP ASP A . n A 1 384 ARG 384 384 384 ARG ARG A . n A 1 385 GLN 385 385 385 GLN GLN A . n A 1 386 ALA 386 386 386 ALA ALA A . n A 1 387 ILE 387 387 387 ILE ILE A . n A 1 388 ALA 388 388 388 ALA ALA A . n A 1 389 LYS 389 389 389 LYS LYS A . n A 1 390 ALA 390 390 390 ALA ALA A . n A 1 391 PHE 391 391 391 PHE PHE A . n A 1 392 ASP 392 392 392 ASP ASP A . n A 1 393 SER 393 393 393 SER SER A . n A 1 394 LEU 394 394 394 LEU LEU A . n A 1 395 ASP 395 395 395 ASP ASP A . n A 1 396 LYS 396 396 396 LYS LYS A . n A 1 397 GLN 397 397 397 GLN GLN A . n A 1 398 MET 398 398 398 MET MET A . n A 1 399 MET 399 399 399 MET MET A . n A 1 400 ALA 400 400 400 ALA ALA A . n A 1 401 LYS 401 401 401 LYS LYS A . n A 1 402 SER 402 402 402 SER SER A . n A 1 403 LEU 403 403 403 LEU LEU A . n A 1 404 GLU 404 404 404 GLU GLU A . n A 1 405 LYS 405 405 405 LYS LYS A . n A 1 406 PHE 406 406 406 PHE PHE A . n A 1 407 SER 407 407 407 SER SER A . n A 1 408 LYS 408 408 408 LYS LYS A . n A 1 409 GLY 409 409 409 GLY GLY A . n A 1 410 PHE 410 410 410 PHE PHE A . n A 1 411 GLY 411 411 411 GLY GLY A . n A 1 412 VAL 412 412 412 VAL VAL A . n A 1 413 VAL 413 413 413 VAL VAL A . n A 1 414 GLY 414 414 414 GLY GLY A . n A 1 415 LYS 415 415 415 LYS LYS A . n A 1 416 ALA 416 416 416 ALA ALA A . n A 1 417 ILE 417 417 417 ILE ILE A . n A 1 418 ASP 418 418 418 ASP ASP A . n A 1 419 ALA 419 419 419 ALA ALA A . n A 1 420 ALA 420 420 420 ALA ALA A . n A 1 421 SER 421 421 421 SER SER A . n A 1 422 LEU 422 422 422 LEU LEU A . n A 1 423 TYR 423 423 423 TYR TYR A . n A 1 424 GLN 424 424 424 GLN GLN A . n A 1 425 GLU 425 425 425 GLU GLU A . n A 1 426 PHE 426 426 426 PHE PHE A . n A 1 427 LYS 427 427 427 LYS LYS A . n A 1 428 ILE 428 428 428 ILE ILE A . n A 1 429 SER 429 429 429 SER SER A . n A 1 430 THR 430 430 430 THR THR A . n A 1 431 GLU 431 431 431 GLU GLU A . n A 1 432 THR 432 432 432 THR THR A . n A 1 433 GLY 433 433 433 GLY GLY A . n A 1 434 ASP 434 434 434 ASP ASP A . n A 1 435 TRP 435 435 435 TRP TRP A . n A 1 436 LYS 436 436 436 LYS LYS A . n A 1 437 PRO 437 437 437 PRO PRO A . n A 1 438 PHE 438 438 438 PHE PHE A . n A 1 439 PHE 439 439 439 PHE PHE A . n A 1 440 VAL 440 440 440 VAL VAL A . n A 1 441 LYS 441 441 441 LYS LYS A . n A 1 442 ILE 442 442 442 ILE ILE A . n A 1 443 GLU 443 443 443 GLU GLU A . n A 1 444 THR 444 444 444 THR THR A . n A 1 445 LEU 445 445 445 LEU LEU A . n A 1 446 ALA 446 446 446 ALA ALA A . n A 1 447 ALA 447 447 447 ALA ALA A . n A 1 448 GLY 448 448 448 GLY GLY A . n A 1 449 ALA 449 449 449 ALA ALA A . n A 1 450 ALA 450 450 450 ALA ALA A . n A 1 451 ALA 451 451 451 ALA ALA A . n A 1 452 SER 452 452 452 SER SER A . n A 1 453 TRP 453 453 453 TRP TRP A . n A 1 454 LEU 454 454 454 LEU LEU A . n A 1 455 VAL 455 455 455 VAL VAL A . n A 1 456 GLY 456 456 456 GLY GLY A . n A 1 457 ILE 457 457 457 ILE ILE A . n A 1 458 ALA 458 458 458 ALA ALA A . n A 1 459 PHE 459 459 459 PHE PHE A . n A 1 460 ALA 460 460 460 ALA ALA A . n A 1 461 THR 461 461 461 THR THR A . n A 1 462 ALA 462 462 462 ALA ALA A . n A 1 463 THR 463 463 463 THR THR A . n A 1 464 ALA 464 464 464 ALA ALA A . n A 1 465 THR 465 465 465 THR THR A . n A 1 466 PRO 466 466 466 PRO PRO A . n A 1 467 ILE 467 467 467 ILE ILE A . n A 1 468 GLY 468 468 468 GLY GLY A . n A 1 469 ILE 469 469 469 ILE ILE A . n A 1 470 LEU 470 470 470 LEU LEU A . n A 1 471 GLY 471 471 471 GLY GLY A . n A 1 472 PHE 472 472 472 PHE PHE A . n A 1 473 ALA 473 473 473 ALA ALA A . n A 1 474 LEU 474 474 474 LEU LEU A . n A 1 475 VAL 475 475 475 VAL VAL A . n A 1 476 MET 476 476 476 MET MET A . n A 1 477 ALA 477 477 477 ALA ALA A . n A 1 478 VAL 478 478 478 VAL VAL A . n A 1 479 THR 479 479 479 THR THR A . n A 1 480 GLY 480 480 480 GLY GLY A . n A 1 481 ALA 481 481 481 ALA ALA A . n A 1 482 MET 482 482 482 MET MET A . n A 1 483 ILE 483 483 483 ILE ILE A . n A 1 484 ASP 484 484 484 ASP ASP A . n A 1 485 GLU 485 485 485 GLU GLU A . n A 1 486 ASP 486 486 486 ASP ASP A . n A 1 487 LEU 487 487 487 LEU LEU A . n A 1 488 LEU 488 488 488 LEU LEU A . n A 1 489 GLU 489 489 489 GLU GLU A . n A 1 490 LYS 490 490 490 LYS LYS A . n A 1 491 ALA 491 491 491 ALA ALA A . n A 1 492 ASN 492 492 492 ASN ASN A . n A 1 493 ASN 493 493 493 ASN ASN A . n A 1 494 LEU 494 494 494 LEU LEU A . n A 1 495 VAL 495 495 495 VAL VAL A . n A 1 496 ILE 496 496 496 ILE ILE A . n A 1 497 SER 497 497 497 SER SER A . n A 1 498 ILE 498 498 498 ILE ILE A . n A 1 499 LEU 499 499 499 LEU LEU A . n A 1 500 GLU 500 500 500 GLU GLU A . n A 1 501 HIS 501 501 501 HIS HIS A . n A 1 502 HIS 502 502 502 HIS HIS A . n A 1 503 HIS 503 503 503 HIS HIS A . n A 1 504 HIS 504 504 504 HIS HIS A . n A 1 505 HIS 505 505 505 HIS HIS A . n A 1 506 HIS 506 506 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 601 1 GOL GOL A . C 3 ZN 1 602 1 ZN ZN A . D 3 ZN 1 603 2 ZN ZN A . E 3 ZN 1 604 3 ZN ZN A . F 3 ZN 1 605 4 ZN ZN A . G 3 ZN 1 606 5 ZN ZN A . H 3 ZN 1 607 6 ZN ZN A . I 3 ZN 1 608 7 ZN ZN A . J 3 ZN 1 609 8 ZN ZN A . K 4 HOH 1 701 4 HOH HOH A . K 4 HOH 2 702 41 HOH HOH A . K 4 HOH 3 703 7 HOH HOH A . K 4 HOH 4 704 25 HOH HOH A . K 4 HOH 5 705 18 HOH HOH A . K 4 HOH 6 706 50 HOH HOH A . K 4 HOH 7 707 39 HOH HOH A . K 4 HOH 8 708 10 HOH HOH A . K 4 HOH 9 709 17 HOH HOH A . K 4 HOH 10 710 51 HOH HOH A . K 4 HOH 11 711 28 HOH HOH A . K 4 HOH 12 712 5 HOH HOH A . K 4 HOH 13 713 24 HOH HOH A . K 4 HOH 14 714 15 HOH HOH A . K 4 HOH 15 715 12 HOH HOH A . K 4 HOH 16 716 109 HOH HOH A . K 4 HOH 17 717 16 HOH HOH A . K 4 HOH 18 718 8 HOH HOH A . K 4 HOH 19 719 30 HOH HOH A . K 4 HOH 20 720 58 HOH HOH A . K 4 HOH 21 721 60 HOH HOH A . K 4 HOH 22 722 49 HOH HOH A . K 4 HOH 23 723 40 HOH HOH A . K 4 HOH 24 724 3 HOH HOH A . K 4 HOH 25 725 88 HOH HOH A . K 4 HOH 26 726 35 HOH HOH A . K 4 HOH 27 727 33 HOH HOH A . K 4 HOH 28 728 27 HOH HOH A . K 4 HOH 29 729 23 HOH HOH A . K 4 HOH 30 730 44 HOH HOH A . K 4 HOH 31 731 1 HOH HOH A . K 4 HOH 32 732 9 HOH HOH A . K 4 HOH 33 733 95 HOH HOH A . K 4 HOH 34 734 19 HOH HOH A . K 4 HOH 35 735 59 HOH HOH A . K 4 HOH 36 736 43 HOH HOH A . K 4 HOH 37 737 56 HOH HOH A . K 4 HOH 38 738 57 HOH HOH A . K 4 HOH 39 739 14 HOH HOH A . K 4 HOH 40 740 10 HOH HOH A . K 4 HOH 41 741 38 HOH HOH A . K 4 HOH 42 742 5 HOH HOH A . K 4 HOH 43 743 46 HOH HOH A . K 4 HOH 44 744 26 HOH HOH A . K 4 HOH 45 745 37 HOH HOH A . K 4 HOH 46 746 34 HOH HOH A . K 4 HOH 47 747 93 HOH HOH A . K 4 HOH 48 748 20 HOH HOH A . K 4 HOH 49 749 19 HOH HOH A . K 4 HOH 50 750 2 HOH HOH A . K 4 HOH 51 751 13 HOH HOH A . K 4 HOH 52 752 29 HOH HOH A . K 4 HOH 53 753 14 HOH HOH A . K 4 HOH 54 754 15 HOH HOH A . K 4 HOH 55 755 2 HOH HOH A . K 4 HOH 56 756 78 HOH HOH A . K 4 HOH 57 757 45 HOH HOH A . K 4 HOH 58 758 86 HOH HOH A . K 4 HOH 59 759 12 HOH HOH A . K 4 HOH 60 760 31 HOH HOH A . K 4 HOH 61 761 21 HOH HOH A . K 4 HOH 62 762 16 HOH HOH A . K 4 HOH 63 763 54 HOH HOH A . K 4 HOH 64 764 69 HOH HOH A . K 4 HOH 65 765 47 HOH HOH A . K 4 HOH 66 766 55 HOH HOH A . K 4 HOH 67 767 100 HOH HOH A . K 4 HOH 68 768 52 HOH HOH A . K 4 HOH 69 769 74 HOH HOH A . K 4 HOH 70 770 8 HOH HOH A . K 4 HOH 71 771 32 HOH HOH A . K 4 HOH 72 772 98 HOH HOH A . K 4 HOH 73 773 11 HOH HOH A . K 4 HOH 74 774 6 HOH HOH A . K 4 HOH 75 775 77 HOH HOH A . K 4 HOH 76 776 97 HOH HOH A . K 4 HOH 77 777 3 HOH HOH A . K 4 HOH 78 778 18 HOH HOH A . K 4 HOH 79 779 105 HOH HOH A . K 4 HOH 80 780 48 HOH HOH A . K 4 HOH 81 781 17 HOH HOH A . K 4 HOH 82 782 22 HOH HOH A . K 4 HOH 83 783 42 HOH HOH A . K 4 HOH 84 784 53 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 63 ? CG ? A GLN 63 CG 2 1 Y 1 A GLN 63 ? CD ? A GLN 63 CD 3 1 Y 1 A GLN 63 ? OE1 ? A GLN 63 OE1 4 1 Y 1 A GLN 63 ? NE2 ? A GLN 63 NE2 5 1 Y 1 A LYS 66 ? CG ? A LYS 66 CG 6 1 Y 1 A LYS 66 ? CD ? A LYS 66 CD 7 1 Y 1 A LYS 66 ? CE ? A LYS 66 CE 8 1 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 9 1 Y 1 A LYS 69 ? CG ? A LYS 69 CG 10 1 Y 1 A LYS 69 ? CD ? A LYS 69 CD 11 1 Y 1 A LYS 69 ? CE ? A LYS 69 CE 12 1 Y 1 A LYS 69 ? NZ ? A LYS 69 NZ 13 1 Y 1 A LYS 73 ? CG ? A LYS 73 CG 14 1 Y 1 A LYS 73 ? CD ? A LYS 73 CD 15 1 Y 1 A LYS 73 ? CE ? A LYS 73 CE 16 1 Y 1 A LYS 73 ? NZ ? A LYS 73 NZ 17 1 Y 1 A LYS 74 ? CG ? A LYS 74 CG 18 1 Y 1 A LYS 74 ? CD ? A LYS 74 CD 19 1 Y 1 A LYS 74 ? CE ? A LYS 74 CE 20 1 Y 1 A LYS 74 ? NZ ? A LYS 74 NZ 21 1 Y 1 A LYS 84 ? CG ? A LYS 84 CG 22 1 Y 1 A LYS 84 ? CD ? A LYS 84 CD 23 1 Y 1 A LYS 84 ? CE ? A LYS 84 CE 24 1 Y 1 A LYS 84 ? NZ ? A LYS 84 NZ 25 1 Y 1 A GLU 114 ? CG ? A GLU 114 CG 26 1 Y 1 A GLU 114 ? CD ? A GLU 114 CD 27 1 Y 1 A GLU 114 ? OE1 ? A GLU 114 OE1 28 1 Y 1 A GLU 114 ? OE2 ? A GLU 114 OE2 29 1 Y 1 A LYS 117 ? CG ? A LYS 117 CG 30 1 Y 1 A LYS 117 ? CD ? A LYS 117 CD 31 1 Y 1 A LYS 117 ? CE ? A LYS 117 CE 32 1 Y 1 A LYS 117 ? NZ ? A LYS 117 NZ 33 1 Y 1 A LYS 118 ? CG ? A LYS 118 CG 34 1 Y 1 A LYS 118 ? CD ? A LYS 118 CD 35 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 36 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 37 1 Y 1 A LYS 142 ? CG ? A LYS 142 CG 38 1 Y 1 A LYS 142 ? CD ? A LYS 142 CD 39 1 Y 1 A LYS 142 ? CE ? A LYS 142 CE 40 1 Y 1 A LYS 142 ? NZ ? A LYS 142 NZ 41 1 Y 1 A GLU 150 ? CG ? A GLU 150 CG 42 1 Y 1 A GLU 150 ? CD ? A GLU 150 CD 43 1 Y 1 A GLU 150 ? OE1 ? A GLU 150 OE1 44 1 Y 1 A GLU 150 ? OE2 ? A GLU 150 OE2 45 1 Y 1 A LYS 153 ? CG ? A LYS 153 CG 46 1 Y 1 A LYS 153 ? CD ? A LYS 153 CD 47 1 Y 1 A LYS 153 ? CE ? A LYS 153 CE 48 1 Y 1 A LYS 153 ? NZ ? A LYS 153 NZ 49 1 Y 1 A LYS 154 ? CG ? A LYS 154 CG 50 1 Y 1 A LYS 154 ? CD ? A LYS 154 CD 51 1 Y 1 A LYS 154 ? CE ? A LYS 154 CE 52 1 Y 1 A LYS 154 ? NZ ? A LYS 154 NZ 53 1 Y 1 A GLU 187 ? CG ? A GLU 187 CG 54 1 Y 1 A GLU 187 ? CD ? A GLU 187 CD 55 1 Y 1 A GLU 187 ? OE1 ? A GLU 187 OE1 56 1 Y 1 A GLU 187 ? OE2 ? A GLU 187 OE2 57 1 Y 1 A LYS 197 ? CG ? A LYS 197 CG 58 1 Y 1 A LYS 197 ? CD ? A LYS 197 CD 59 1 Y 1 A LYS 197 ? CE ? A LYS 197 CE 60 1 Y 1 A LYS 197 ? NZ ? A LYS 197 NZ 61 1 Y 1 A LYS 267 ? CG ? A LYS 267 CG 62 1 Y 1 A LYS 267 ? CD ? A LYS 267 CD 63 1 Y 1 A LYS 267 ? CE ? A LYS 267 CE 64 1 Y 1 A LYS 267 ? NZ ? A LYS 267 NZ 65 1 Y 1 A LYS 313 ? CG ? A LYS 313 CG 66 1 Y 1 A LYS 313 ? CD ? A LYS 313 CD 67 1 Y 1 A LYS 313 ? CE ? A LYS 313 CE 68 1 Y 1 A LYS 313 ? NZ ? A LYS 313 NZ 69 1 Y 1 A LYS 366 ? CG ? A LYS 366 CG 70 1 Y 1 A LYS 366 ? CD ? A LYS 366 CD 71 1 Y 1 A LYS 366 ? CE ? A LYS 366 CE 72 1 Y 1 A LYS 366 ? NZ ? A LYS 366 NZ 73 1 Y 1 A GLU 369 ? CG ? A GLU 369 CG 74 1 Y 1 A GLU 369 ? CD ? A GLU 369 CD 75 1 Y 1 A GLU 369 ? OE1 ? A GLU 369 OE1 76 1 Y 1 A GLU 369 ? OE2 ? A GLU 369 OE2 77 1 Y 1 A ASP 373 ? CG ? A ASP 373 CG 78 1 Y 1 A ASP 373 ? OD1 ? A ASP 373 OD1 79 1 Y 1 A ASP 373 ? OD2 ? A ASP 373 OD2 80 1 Y 1 A LYS 377 ? CG ? A LYS 377 CG 81 1 Y 1 A LYS 377 ? CD ? A LYS 377 CD 82 1 Y 1 A LYS 377 ? CE ? A LYS 377 CE 83 1 Y 1 A LYS 377 ? NZ ? A LYS 377 NZ 84 1 Y 1 A LYS 389 ? CG ? A LYS 389 CG 85 1 Y 1 A LYS 389 ? CD ? A LYS 389 CD 86 1 Y 1 A LYS 389 ? CE ? A LYS 389 CE 87 1 Y 1 A LYS 389 ? NZ ? A LYS 389 NZ 88 1 Y 1 A LYS 396 ? CG ? A LYS 396 CG 89 1 Y 1 A LYS 396 ? CD ? A LYS 396 CD 90 1 Y 1 A LYS 396 ? CE ? A LYS 396 CE 91 1 Y 1 A LYS 396 ? NZ ? A LYS 396 NZ 92 1 Y 1 A GLN 397 ? CG ? A GLN 397 CG 93 1 Y 1 A GLN 397 ? CD ? A GLN 397 CD 94 1 Y 1 A GLN 397 ? OE1 ? A GLN 397 OE1 95 1 Y 1 A GLN 397 ? NE2 ? A GLN 397 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 95.150 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6THK _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.240 _cell.length_a_esd ? _cell.length_b 53.870 _cell.length_b_esd ? _cell.length_c 104.800 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6THK _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6THK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.47 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;10% w/v PEG 3000, 0.1 M sodium acetate, 0.1 M zinc acetate, pH 4.5 protein buffer: 25 mL Tris-HCl pH 7.5, 150 mM NaCl ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-05-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9679 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9679 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 41.76 _reflns.entry_id 6THK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 53.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 28285 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.4 _reflns.pdbx_Rmerge_I_obs 0.138 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.01 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.179 _reflns.pdbx_Rpim_I_all 0.113 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2467 _reflns_shell.percent_possible_all 99.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.946 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 1.11 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.52 _reflns_shell.pdbx_Rpim_I_all 1.594 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.728 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 22.1836 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 14.0936 _refine.aniso_B[2][2] 2.9421 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -25.1257 _refine.B_iso_max 134.410 _refine.B_iso_mean 63.9100 _refine.B_iso_min 30.000 _refine.correlation_coeff_Fo_to_Fc 0.8970 _refine.correlation_coeff_Fo_to_Fc_free 0.8560 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6THK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2000 _refine.ls_d_res_low 52.1900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 28161 _refine.ls_number_reflns_R_free 1301 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.3000 _refine.ls_percent_reflns_R_free 4.6200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2270 _refine.ls_R_factor_R_free 0.2750 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2250 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.2210 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.2160 _refine.pdbx_overall_SU_R_Blow_DPI 0.2560 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.2650 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2000 _refine_hist.d_res_low 52.1900 _refine_hist.number_atoms_solvent 84 _refine_hist.number_atoms_total 3731 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 466 _refine_hist.pdbx_B_iso_mean_ligand 66.87 _refine_hist.pdbx_B_iso_mean_solvent 60.53 _refine_hist.pdbx_number_atoms_protein 3633 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 1335 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 104 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 534 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 3712 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1 ? t_nbd 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 499 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 4362 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 3712 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.080 ? 5014 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.510 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 21.000 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2000 _refine_ls_shell.d_res_low 2.2800 _refine_ls_shell.number_reflns_all 2986 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 138 _refine_ls_shell.number_reflns_R_work 2848 _refine_ls_shell.percent_reflns_obs 98.7400 _refine_ls_shell.percent_reflns_R_free 4.6200 _refine_ls_shell.R_factor_all 0.2600 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3093 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2573 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 14 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6THK _struct.title 'Structural mechanism of pyocin S5 import into Pseudomonas aeruginosa' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6THK _struct_keywords.text 'Bacteriocin, Pyocin, Antibiotic, Ionophore, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? K N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9I4Y4_PSEAE _struct_ref.pdbx_db_accession Q9I4Y4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSNDNEVPGSMVIVAQGPDDQYAYEVPPIDSAAVAGNMFGDLIQREIYLQKNIYYPVRSIFEQGTKEKKEINKKVSDQVD GLLKQITQGKREATRQERVDVMSAVLHKMESDLEGYKKTFTKGPFIDYEKQSSLSIYEAWVKIWEKNSWEERKKYPFQQL VRDELERAVAYYKQDSLSEAVKVLRQELNKQKALKEKEDLSQLERDYRTRKANLEMKVQSELDQAGSALPPLVSPTPEQW LERATRLVTQAIADKKQLQTTNNTLIKNSPTPLEKQKAIYNGELLVDEIASLQARLVKLNAETTRRRTEAERKAAEEQAL QDAIKFTADFYKEVTEKFGARTSEMARQLAEGARGKNIRSSAEAIKSFEKHKDALNKKLSLKDRQAIAKAFDSLDKQMMA KSLEKFSKGFGVVGKAIDAASLYQEFKISTETGDWKPFFVKIETLAAGAAASWLVGIAFATATATPIGILGFALVMAVTG AMIDEDLLEKANNLVISI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6THK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 498 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9I4Y4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 498 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 498 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6THK GLN A 215 ? UNP Q9I4Y4 GLU 215 'engineered mutation' 215 1 1 6THK LEU A 499 ? UNP Q9I4Y4 ? ? 'expression tag' 499 2 1 6THK GLU A 500 ? UNP Q9I4Y4 ? ? 'expression tag' 500 3 1 6THK HIS A 501 ? UNP Q9I4Y4 ? ? 'expression tag' 501 4 1 6THK HIS A 502 ? UNP Q9I4Y4 ? ? 'expression tag' 502 5 1 6THK HIS A 503 ? UNP Q9I4Y4 ? ? 'expression tag' 503 6 1 6THK HIS A 504 ? UNP Q9I4Y4 ? ? 'expression tag' 504 7 1 6THK HIS A 505 ? UNP Q9I4Y4 ? ? 'expression tag' 505 8 1 6THK HIS A 506 ? UNP Q9I4Y4 ? ? 'expression tag' 506 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 870 ? 1 MORE -184 ? 1 'SSA (A^2)' 26890 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 41 ? ILE A 53 ? ASP A 41 ILE A 53 1 ? 13 HELX_P HELX_P2 AA2 ILE A 53 ? GLN A 88 ? ILE A 53 GLN A 88 1 ? 36 HELX_P HELX_P3 AA3 THR A 94 ? LYS A 122 ? THR A 94 LYS A 122 1 ? 29 HELX_P HELX_P4 AA4 ASP A 127 ? GLN A 131 ? ASP A 127 GLN A 131 5 ? 5 HELX_P HELX_P5 AA5 SER A 132 ? LYS A 146 ? SER A 132 LYS A 146 1 ? 15 HELX_P HELX_P6 AA6 SER A 148 ? TYR A 155 ? SER A 148 TYR A 155 1 ? 8 HELX_P HELX_P7 AA7 PRO A 156 ? ASN A 213 ? PRO A 156 ASN A 213 1 ? 58 HELX_P HELX_P8 AA8 ASN A 213 ? ALA A 228 ? ASN A 213 ALA A 228 1 ? 16 HELX_P HELX_P9 AA9 THR A 236 ? ASN A 268 ? THR A 236 ASN A 268 1 ? 33 HELX_P HELX_P10 AB1 THR A 271 ? GLY A 339 ? THR A 271 GLY A 339 1 ? 69 HELX_P HELX_P11 AB2 GLY A 339 ? ARG A 354 ? GLY A 339 ARG A 354 1 ? 16 HELX_P HELX_P12 AB3 SER A 360 ? LEU A 379 ? SER A 360 LEU A 379 1 ? 20 HELX_P HELX_P13 AB4 SER A 380 ? SER A 393 ? SER A 380 SER A 393 1 ? 14 HELX_P HELX_P14 AB5 ASP A 395 ? PHE A 410 ? ASP A 395 PHE A 410 1 ? 16 HELX_P HELX_P15 AB6 ASP A 418 ? THR A 432 ? ASP A 418 THR A 432 1 ? 15 HELX_P HELX_P16 AB7 TRP A 435 ? ALA A 447 ? TRP A 435 ALA A 447 1 ? 13 HELX_P HELX_P17 AB8 ALA A 450 ? THR A 465 ? ALA A 450 THR A 465 1 ? 16 HELX_P HELX_P18 AB9 ILE A 467 ? MET A 482 ? ILE A 467 MET A 482 1 ? 16 HELX_P HELX_P19 AC1 ASP A 484 ? LEU A 499 ? ASP A 484 LEU A 499 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 41 OD2 ? ? ? 1_555 G ZN . ZN ? ? A ASP 41 A ZN 606 2_856 ? ? ? ? ? ? ? 1.891 ? ? metalc2 metalc ? ? A ASP 127 OD1 ? ? ? 1_555 F ZN . ZN ? ? A ASP 127 A ZN 605 1_555 ? ? ? ? ? ? ? 2.147 ? ? metalc3 metalc ? ? A ASP 127 OD2 ? ? ? 1_555 F ZN . ZN ? ? A ASP 127 A ZN 605 1_555 ? ? ? ? ? ? ? 2.639 ? ? metalc4 metalc ? ? A GLU 129 OE1 ? ? ? 1_555 F ZN . ZN ? ? A GLU 129 A ZN 605 1_555 ? ? ? ? ? ? ? 2.054 ? ? metalc5 metalc ? ? A GLU 129 OE2 ? ? ? 1_555 F ZN . ZN ? ? A GLU 129 A ZN 605 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc6 metalc ? ? A GLU 145 OE2 ? ? ? 1_555 I ZN . ZN ? ? A GLU 145 A ZN 608 2_756 ? ? ? ? ? ? ? 1.830 ? ? metalc7 metalc ? ? A GLU 221 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 221 A ZN 606 1_555 ? ? ? ? ? ? ? 2.339 ? ? metalc8 metalc ? ? A GLU 288 OE2 ? ? ? 1_555 G ZN . ZN ? ? A GLU 288 A ZN 606 1_555 ? ? ? ? ? ? ? 2.148 ? ? metalc9 metalc ? ? A GLU 333 OE1 ? ? ? 1_555 J ZN . ZN ? ? A GLU 333 A ZN 609 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc10 metalc ? ? A GLU 336 OE2 ? ? ? 1_555 J ZN . ZN ? ? A GLU 336 A ZN 609 1_555 ? ? ? ? ? ? ? 2.172 ? ? metalc11 metalc ? ? A HIS 371 NE2 ? ? ? 1_555 H ZN . ZN ? ? A HIS 371 A ZN 607 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc12 metalc ? ? A ASP 383 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 383 A ZN 602 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc13 metalc ? ? A ASP 418 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 418 A ZN 604 2_355 ? ? ? ? ? ? ? 2.138 ? ? metalc14 metalc ? ? A GLU 425 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 425 A ZN 603 2_355 ? ? ? ? ? ? ? 2.064 ? ? metalc15 metalc ? ? A GLU 485 OE2 ? ? ? 1_555 H ZN . ZN ? ? A GLU 485 A ZN 607 1_555 ? ? ? ? ? ? ? 2.239 ? ? metalc16 metalc ? ? A GLU 489 OE1 ? ? ? 1_555 H ZN . ZN ? ? A GLU 489 A ZN 607 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc17 metalc ? ? A HIS 501 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 501 A ZN 602 1_555 ? ? ? ? ? ? ? 2.233 ? ? metalc18 metalc ? ? A HIS 502 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 502 A ZN 603 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc19 metalc ? ? A HIS 503 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 503 A ZN 602 1_555 ? ? ? ? ? ? ? 2.285 ? ? metalc20 metalc ? ? A HIS 504 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 504 A ZN 603 1_555 ? ? ? ? ? ? ? 2.267 ? ? metalc21 metalc ? ? A HIS 505 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 505 A ZN 604 1_555 ? ? ? ? ? ? ? 2.206 ? ? metalc22 metalc ? ? E ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 604 A HOH 777 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc23 metalc ? ? G ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 606 A HOH 770 2_846 ? ? ? ? ? ? ? 2.408 ? ? metalc24 metalc ? ? I ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 608 A HOH 781 2_746 ? ? ? ? ? ? ? 2.690 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 ZN ? G ZN . ? A ZN 606 ? 2_856 OE2 ? A GLU 221 ? A GLU 221 ? 1_555 66.1 ? 2 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 ZN ? G ZN . ? A ZN 606 ? 2_856 OE2 ? A GLU 288 ? A GLU 288 ? 1_555 67.6 ? 3 OE2 ? A GLU 221 ? A GLU 221 ? 1_555 ZN ? G ZN . ? A ZN 606 ? 2_856 OE2 ? A GLU 288 ? A GLU 288 ? 1_555 1.7 ? 4 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 ZN ? G ZN . ? A ZN 606 ? 2_856 O ? K HOH . ? A HOH 770 ? 2_846 66.7 ? 5 OE2 ? A GLU 221 ? A GLU 221 ? 1_555 ZN ? G ZN . ? A ZN 606 ? 2_856 O ? K HOH . ? A HOH 770 ? 2_846 0.7 ? 6 OE2 ? A GLU 288 ? A GLU 288 ? 1_555 ZN ? G ZN . ? A ZN 606 ? 2_856 O ? K HOH . ? A HOH 770 ? 2_846 1.6 ? 7 OD1 ? A ASP 127 ? A ASP 127 ? 1_555 ZN ? F ZN . ? A ZN 605 ? 1_555 OD2 ? A ASP 127 ? A ASP 127 ? 1_555 53.6 ? 8 OD1 ? A ASP 127 ? A ASP 127 ? 1_555 ZN ? F ZN . ? A ZN 605 ? 1_555 OE1 ? A GLU 129 ? A GLU 129 ? 1_555 115.4 ? 9 OD2 ? A ASP 127 ? A ASP 127 ? 1_555 ZN ? F ZN . ? A ZN 605 ? 1_555 OE1 ? A GLU 129 ? A GLU 129 ? 1_555 123.4 ? 10 OD1 ? A ASP 127 ? A ASP 127 ? 1_555 ZN ? F ZN . ? A ZN 605 ? 1_555 OE2 ? A GLU 129 ? A GLU 129 ? 1_555 146.3 ? 11 OD2 ? A ASP 127 ? A ASP 127 ? 1_555 ZN ? F ZN . ? A ZN 605 ? 1_555 OE2 ? A GLU 129 ? A GLU 129 ? 1_555 96.5 ? 12 OE1 ? A GLU 129 ? A GLU 129 ? 1_555 ZN ? F ZN . ? A ZN 605 ? 1_555 OE2 ? A GLU 129 ? A GLU 129 ? 1_555 65.1 ? 13 OE2 ? A GLU 145 ? A GLU 145 ? 1_555 ZN ? I ZN . ? A ZN 608 ? 2_756 O ? K HOH . ? A HOH 781 ? 2_746 31.7 ? 14 OE1 ? A GLU 333 ? A GLU 333 ? 1_555 ZN ? J ZN . ? A ZN 609 ? 1_555 OE2 ? A GLU 336 ? A GLU 336 ? 1_555 116.2 ? 15 NE2 ? A HIS 371 ? A HIS 371 ? 1_555 ZN ? H ZN . ? A ZN 607 ? 1_555 OE2 ? A GLU 485 ? A GLU 485 ? 1_555 154.3 ? 16 NE2 ? A HIS 371 ? A HIS 371 ? 1_555 ZN ? H ZN . ? A ZN 607 ? 1_555 OE1 ? A GLU 489 ? A GLU 489 ? 1_555 86.1 ? 17 OE2 ? A GLU 485 ? A GLU 485 ? 1_555 ZN ? H ZN . ? A ZN 607 ? 1_555 OE1 ? A GLU 489 ? A GLU 489 ? 1_555 118.8 ? 18 OD1 ? A ASP 383 ? A ASP 383 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 ND1 ? A HIS 501 ? A HIS 501 ? 1_555 92.4 ? 19 OD1 ? A ASP 383 ? A ASP 383 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 503 ? A HIS 503 ? 1_555 122.7 ? 20 ND1 ? A HIS 501 ? A HIS 501 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 503 ? A HIS 503 ? 1_555 117.7 ? 21 OD2 ? A ASP 418 ? A ASP 418 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 2_355 ND1 ? A HIS 505 ? A HIS 505 ? 1_555 93.9 ? 22 OD2 ? A ASP 418 ? A ASP 418 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 2_355 O ? K HOH . ? A HOH 777 ? 1_555 91.1 ? 23 ND1 ? A HIS 505 ? A HIS 505 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 2_355 O ? K HOH . ? A HOH 777 ? 1_555 3.6 ? 24 OE1 ? A GLU 425 ? A GLU 425 ? 1_555 ZN ? D ZN . ? A ZN 603 ? 2_355 ND1 ? A HIS 502 ? A HIS 502 ? 1_555 15.9 ? 25 OE1 ? A GLU 425 ? A GLU 425 ? 1_555 ZN ? D ZN . ? A ZN 603 ? 2_355 NE2 ? A HIS 504 ? A HIS 504 ? 1_555 21.6 ? 26 ND1 ? A HIS 502 ? A HIS 502 ? 1_555 ZN ? D ZN . ? A ZN 603 ? 2_355 NE2 ? A HIS 504 ? A HIS 504 ? 1_555 6.2 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 601 ? 9 'binding site for residue GOL A 601' AC2 Software A ZN 602 ? 5 'binding site for residue ZN A 602' AC3 Software A ZN 603 ? 3 'binding site for residue ZN A 603' AC4 Software A ZN 604 ? 2 'binding site for residue ZN A 604' AC5 Software A ZN 605 ? 5 'binding site for residue ZN A 605' AC6 Software A ZN 606 ? 3 'binding site for residue ZN A 606' AC7 Software A ZN 607 ? 4 'binding site for residue ZN A 607' AC8 Software A ZN 608 ? 1 'binding site for residue ZN A 608' AC9 Software A ZN 609 ? 2 'binding site for residue ZN A 609' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 SER A 380 ? SER A 380 . ? 1_555 ? 2 AC1 9 LYS A 382 ? LYS A 382 . ? 1_555 ? 3 AC1 9 ASP A 383 ? ASP A 383 . ? 1_555 ? 4 AC1 9 HIS A 501 ? HIS A 501 . ? 1_555 ? 5 AC1 9 HIS A 502 ? HIS A 502 . ? 1_555 ? 6 AC1 9 HIS A 503 ? HIS A 503 . ? 1_555 ? 7 AC1 9 ZN C . ? ZN A 602 . ? 1_555 ? 8 AC1 9 HOH K . ? HOH A 717 . ? 1_555 ? 9 AC1 9 HOH K . ? HOH A 721 . ? 1_555 ? 10 AC2 5 SER A 380 ? SER A 380 . ? 1_555 ? 11 AC2 5 ASP A 383 ? ASP A 383 . ? 1_555 ? 12 AC2 5 HIS A 501 ? HIS A 501 . ? 1_555 ? 13 AC2 5 HIS A 503 ? HIS A 503 . ? 1_555 ? 14 AC2 5 GOL B . ? GOL A 601 . ? 1_555 ? 15 AC3 3 HIS A 502 ? HIS A 502 . ? 1_555 ? 16 AC3 3 HIS A 504 ? HIS A 504 . ? 1_555 ? 17 AC3 3 HOH K . ? HOH A 782 . ? 1_555 ? 18 AC4 2 HIS A 505 ? HIS A 505 . ? 1_555 ? 19 AC4 2 HOH K . ? HOH A 777 . ? 1_555 ? 20 AC5 5 ASP A 127 ? ASP A 127 . ? 1_555 ? 21 AC5 5 GLU A 129 ? GLU A 129 . ? 1_555 ? 22 AC5 5 TYR A 171 ? TYR A 171 . ? 1_555 ? 23 AC5 5 HOH K . ? HOH A 734 . ? 1_555 ? 24 AC5 5 HOH K . ? HOH A 755 . ? 1_555 ? 25 AC6 3 LYS A 217 ? LYS A 217 . ? 1_555 ? 26 AC6 3 GLU A 221 ? GLU A 221 . ? 1_555 ? 27 AC6 3 GLU A 288 ? GLU A 288 . ? 1_555 ? 28 AC7 4 LYS A 370 ? LYS A 370 . ? 1_555 ? 29 AC7 4 HIS A 371 ? HIS A 371 . ? 1_555 ? 30 AC7 4 GLU A 485 ? GLU A 485 . ? 1_555 ? 31 AC7 4 GLU A 489 ? GLU A 489 . ? 1_555 ? 32 AC8 1 GLU A 311 ? GLU A 311 . ? 1_555 ? 33 AC9 2 GLU A 333 ? GLU A 333 . ? 1_555 ? 34 AC9 2 GLU A 336 ? GLU A 336 . ? 1_555 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 503 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -105.10 _pdbx_validate_torsion.psi 76.58 # _pdbx_entry_details.entry_id 6THK _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A VAL 7 ? A VAL 7 8 1 Y 1 A PRO 8 ? A PRO 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A MET 11 ? A MET 11 12 1 Y 1 A VAL 12 ? A VAL 12 13 1 Y 1 A ILE 13 ? A ILE 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A GLN 16 ? A GLN 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A ASP 19 ? A ASP 19 20 1 Y 1 A ASP 20 ? A ASP 20 21 1 Y 1 A GLN 21 ? A GLN 21 22 1 Y 1 A TYR 22 ? A TYR 22 23 1 Y 1 A ALA 23 ? A ALA 23 24 1 Y 1 A TYR 24 ? A TYR 24 25 1 Y 1 A GLU 25 ? A GLU 25 26 1 Y 1 A VAL 26 ? A VAL 26 27 1 Y 1 A PRO 27 ? A PRO 27 28 1 Y 1 A PRO 28 ? A PRO 28 29 1 Y 1 A ILE 29 ? A ILE 29 30 1 Y 1 A ASP 30 ? A ASP 30 31 1 Y 1 A SER 31 ? A SER 31 32 1 Y 1 A ALA 32 ? A ALA 32 33 1 Y 1 A ALA 33 ? A ALA 33 34 1 Y 1 A VAL 34 ? A VAL 34 35 1 Y 1 A ALA 35 ? A ALA 35 36 1 Y 1 A GLY 36 ? A GLY 36 37 1 Y 1 A ASN 37 ? A ASN 37 38 1 Y 1 A MET 38 ? A MET 38 39 1 Y 1 A PHE 39 ? A PHE 39 40 1 Y 1 A HIS 506 ? A HIS 506 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Wellcome Trust' 'United Kingdom' 'Infection, Immunology and Translational Medicine studentship' 1 'Wellcome Trust' 'United Kingdom' 201505/Z/16/Z 2 # _atom_sites.entry_id 6THK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019904 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001794 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018563 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009581 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_