data_6TUQ # _entry.id 6TUQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TUQ pdb_00006tuq 10.2210/pdb6tuq/pdb WWPDB D_1292106093 ? ? EMDB EMD-10594 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-02-26 2 'Structure model' 1 1 2020-03-04 3 'Structure model' 1 2 2020-03-11 4 'Structure model' 1 3 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' em_imaging_optics 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_em_imaging_optics.phase_plate' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' 11 4 'Structure model' '_pdbx_struct_oper_list.name' 12 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6TUQ _pdbx_database_status.recvd_initial_deposition_date 2020-01-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type EMDB 'map with ssDNA' EMD-10593 'other EM volume' PDB 'structure with ssDNA' 6TUP unspecified EMDB 'Cryo-EM structure of Pf4 bacteriophage coat protein without ssDNA' EMD-10594 'associated EM volume' # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tarafder, A.K.' 1 0000-0002-0368-6111 'von Kugelgen, A.' 2 0000-0002-0017-2414 'Bharat, T.A.M.' 3 0000-0002-0168-0277 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 117 _citation.language ? _citation.page_first 4724 _citation.page_last 4731 _citation.title 'Phage liquid crystalline droplets form occlusive sheaths that encapsulate and protect infectious rod-shaped bacteria.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1917726117 _citation.pdbx_database_id_PubMed 32071243 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tarafder, A.K.' 1 ? primary 'von Kugelgen, A.' 2 ? primary 'Mellul, A.J.' 3 ? primary 'Schulze, U.' 4 ? primary 'Aarts, D.G.A.L.' 5 ? primary 'Bharat, T.A.M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Coat protein B of bacteriophage Pf1' _entity.formula_weight 4612.393 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Phage coat protein B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA _entity_poly.pdbx_seq_one_letter_code_can GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 ILE n 1 4 ASP n 1 5 THR n 1 6 SER n 1 7 ALA n 1 8 VAL n 1 9 GLU n 1 10 SER n 1 11 ALA n 1 12 ILE n 1 13 THR n 1 14 ASP n 1 15 GLY n 1 16 GLN n 1 17 GLY n 1 18 ASP n 1 19 MET n 1 20 LYS n 1 21 ALA n 1 22 ILE n 1 23 GLY n 1 24 GLY n 1 25 TYR n 1 26 ILE n 1 27 VAL n 1 28 GLY n 1 29 ALA n 1 30 LEU n 1 31 VAL n 1 32 ILE n 1 33 LEU n 1 34 ALA n 1 35 VAL n 1 36 ALA n 1 37 GLY n 1 38 LEU n 1 39 ILE n 1 40 TYR n 1 41 SER n 1 42 MET n 1 43 LEU n 1 44 ARG n 1 45 LYS n 1 46 ALA n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 46 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Pseudomonas virus Pf1' _entity_src_nat.pdbx_ncbi_taxonomy_id 2011081 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6TUQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6TUQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TUQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 6TUQ _struct.title 'Cryo-EM structure of Pf4 bacteriophage coat protein without ssDNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TUQ _struct_keywords.text 'Bacteriophage, helical, filamentous, VIRUS' _struct_keywords.pdbx_keywords VIRUS # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9I5K5_PSEAE _struct_ref.pdbx_db_accession Q9I5K5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA _struct_ref.pdbx_align_begin 37 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6TUQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9I5K5 _struct_ref_seq.db_align_beg 37 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 51-meric _pdbx_struct_assembly.oligomeric_count 51 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression ;1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50 ; _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'point symmetry operation' ? ? 0.9972129900 -0.0746054500 0.0005301000 21.00403697 0.0746067900 0.9972076200 -0.0032839200 -19.19776647 -0.0002836200 0.0033143100 0.9999944700 33.6233774600 3 'point symmetry operation' ? ? 0.8434041000 0.5372796000 -0.0003986400 -105.66560839 -0.5372624100 0.8433706900 -0.0086597300 193.56479883 -0.0043165000 0.0075178300 0.9999624200 14.6375906900 4 'point symmetry operation' ? ? 0.8929056700 0.4502435400 0.0004772100 -95.34308169 -0.4502348600 0.8928941300 -0.0053521300 155.06973129 -0.0028358600 0.0045640900 0.9999855600 49.6671408900 5 'point symmetry operation' ? ? 0.4613068300 0.8872345500 -0.0032958900 -95.90391391 -0.8872310200 0.4612813000 -0.0063781700 395.40939469 -0.0041386000 0.0058665100 0.9999742300 30.7568435600 6 'point symmetry operation' ? ? -0.3048520400 0.9505953100 -0.0585985300 111.36816466 -0.9519501300 -0.3060211300 -0.0119170300 629.18147264 -0.0292606600 0.0521499400 0.9982105000 5.6855232100 7 'point symmetry operation' ? ? -0.1918951200 0.9802746900 -0.0473053500 69.02427896 -0.9811773300 -0.1926872700 -0.0127536400 605.54533483 -0.0216172100 0.0439675700 0.9987990500 40.4360303100 8 'point symmetry operation' ? ? -0.7371638700 0.6738866800 -0.0496605400 306.29184970 -0.6753224600 -0.7372459400 0.0201989600 663.65839827 -0.0230002200 0.0484268200 0.9985618800 20.7865982700 9 'point symmetry operation' ? ? -0.9975924800 0.0579435700 -0.0381023400 547.67339898 -0.0602906400 -0.9961497800 0.0636448000 554.23154070 -0.0342678300 0.0657887800 0.9972449800 0.2374831000 10 'point symmetry operation' ? ? -0.9875871300 0.1512537300 -0.0423551800 519.92219564 -0.1535578100 -0.9864483000 0.0577906600 578.89618460 -0.0330401400 0.0635772800 0.9974298400 35.0549516200 11 'point symmetry operation' ? ? -0.8979265600 -0.4401448000 -0.0006630600 648.93061643 0.4391623100 -0.8960208000 0.0654460300 386.66683995 -0.0293998400 0.0584745300 0.9978558900 16.6183058700 12 'point symmetry operation' ? ? -0.4981706100 -0.8664321200 0.0334878600 647.25091924 0.8666299300 -0.4962982100 0.0513872300 159.76936389 -0.0279035800 0.0546211900 0.9981171900 -1.5853067300 13 'point symmetry operation' ? ? -0.5939147900 -0.8041233800 0.0255109100 658.17067950 0.8041988100 -0.5924663500 0.0474120600 204.89896912 -0.0230107900 0.0486745700 0.9985495900 33.2978717600 14 'point symmetry operation' ? ? -0.1125110100 -0.9934425800 0.0203251600 577.14263734 0.9935770800 -0.1122305500 0.0144528000 28.04577571 -0.0120769300 0.0218207100 0.9996889500 18.9349585000 15 'point symmetry operation' ? ? 0.3936825700 -0.9192206300 -0.0068901900 422.82867062 0.9192452500 0.3936831100 0.0013345700 -86.59138510 0.0014857900 -0.0068591700 0.9999753700 4.6762155100 16 'point symmetry operation' ? ? 0.3256355600 -0.9454948400 -0.0009949500 447.36956589 0.9454871600 0.3256281700 0.0045079400 -76.24275521 -0.0039382500 -0.0024086600 0.9999893400 39.3691771500 17 'point symmetry operation' ? ? 0.8126145100 -0.5827917500 0.0033816900 211.55105431 0.5827905600 0.8126211400 0.0014280700 -109.55666935 -0.0035803000 0.0008103500 0.9999932600 19.4709307700 18 'point symmetry operation' ? ? 0.7410076300 -0.6714660600 -0.0064052300 258.45405834 0.6714956500 0.7409889300 0.0053848500 -114.87103782 0.0011304600 -0.0082913000 0.9999649900 55.4284769800 19 'point symmetry operation' ? ? -0.8523796400 -0.5228042700 0.0111646700 656.16543146 0.5220238000 -0.8494673300 0.0767880700 347.40447224 -0.0306611100 0.0712808100 0.9969849300 -21.0534949100 20 'point symmetry operation' ? ? -0.4756456900 -0.8792692300 0.0254322800 645.74346143 0.8794022900 -0.4746522100 0.0368359200 154.05418865 -0.0203172100 0.0398860500 0.9989976500 -34.1422461500 21 'point symmetry operation' ? ? 0.0137410200 -0.9998358400 0.0118104000 545.51070045 0.9998826800 0.0138197000 0.0066060500 -6.02574337 -0.0067681800 0.0117182400 0.9999084300 -48.6824326900 22 'point symmetry operation' ? ? 0.4857026400 -0.8741224500 0.0017006400 382.74319949 0.8741166100 0.4857056100 0.0031953400 -100.50673041 -0.0036191300 -0.0000654200 0.9999934500 -30.5052490900 23 'point symmetry operation' ? ? 0.9056640400 -0.4239503800 0.0062221200 141.18991369 0.4239479900 0.9056848200 0.0017644300 -91.70822931 -0.0063833100 0.0010398800 0.9999790900 -48.9666549700 24 'point symmetry operation' ? ? 0.8606184300 -0.5092337200 0.0041156100 177.80311267 0.5092268300 0.8606282500 0.0026559900 -102.96020573 -0.0048945300 -0.0001900100 0.9999880000 -14.4261682000 25 'point symmetry operation' ? ? 0.9973580100 0.0726118000 -0.0021255300 -18.64948250 -0.0726058200 0.9973568800 0.0027671100 20.09518562 0.0023208400 -0.0026054700 0.9999939100 -34.4496893700 26 'point symmetry operation' ? ? 0.7986242900 0.6018214900 0.0031855600 -112.07007496 -0.6017804900 0.7986153500 -0.0085889400 223.87138121 -0.0077130400 0.0049423200 0.9999580400 -18.2937655400 27 'point symmetry operation' ? ? 0.2419461100 0.9700903700 -0.0196661000 -54.75995193 -0.9702159000 0.2416280600 -0.0172331900 482.37120998 -0.0119658700 0.0232498600 0.9996580700 -41.1900519300 28 'point symmetry operation' ? ? 0.3337938700 0.9424958100 -0.0168316400 -73.18600451 -0.9426084800 0.3335678400 -0.0148911300 448.53456684 -0.0084203400 0.0208362100 0.9997474400 -6.8885736600 29 'point symmetry operation' ? ? -0.3787760600 0.9239622600 -0.0531266000 137.85739661 -0.9251275400 -0.3796068200 -0.0061403000 640.57902527 -0.0258406300 0.0468230900 0.9985689100 -28.3125142100 30 'point symmetry operation' ? ? -0.8301011900 0.5560784900 -0.0413368000 362.80889058 -0.5572476100 -0.8299574500 0.0254112400 655.10259454 -0.0201771400 0.0441287400 0.9988220800 -47.9132793700 31 'point symmetry operation' ? ? -0.7850271000 0.6177017200 -0.0466586500 334.52802400 -0.6190405700 -0.7850412400 0.0223388000 660.63124329 -0.0228302500 0.0464201600 0.9986610800 -13.2650730800 32 'point symmetry operation' ? ? -0.9987449800 -0.0379521500 -0.0326818000 573.44151313 0.0354917300 -0.9967126800 0.0728297000 525.38463927 -0.0353384100 0.0715783600 0.9968087800 -35.5372649000 33 'point symmetry operation' ? ? -0.8215118600 -0.5699904500 0.0151376300 659.26647007 0.5695321100 -0.8189964000 0.0698432200 327.27376309 -0.0274123100 0.0659984000 0.9974431200 -55.0268652500 34 'point symmetry operation' ? ? 0.7693638600 0.6388006000 0.0036111000 -113.58426652 -0.6388107100 0.7693546700 0.0037788800 239.01489526 -0.0003642700 -0.0052141400 0.9999863400 -51.8305441700 35 'point symmetry operation' ? ? -0.4098060700 -0.9118376300 0.0247210400 636.45203886 0.9120160000 -0.4090829000 0.0296311300 128.78854484 -0.0169058200 0.0346890000 0.9992551600 -68.1853362800 36 'point symmetry operation' ? ? 0.0701130400 -0.9975389000 0.0005437400 532.06754134 0.9975288100 0.0701147800 0.0044941100 -20.20586019 -0.0045211800 0.0002273000 0.9999897500 -80.6250354500 37 'point symmetry operation' ? ? 0.6268046000 -0.7791738600 0.0020234100 317.43263638 0.7791599300 0.6268060900 0.0048919200 -113.61237636 -0.0050799400 -0.0014897200 0.9999859900 -98.8297012100 38 'point symmetry operation' ? ? 0.5685036600 -0.8226739600 0.0033386300 345.33254839 0.8226727000 0.5685113700 0.0021124300 -108.97179938 -0.0036358900 0.0015456700 0.9999922000 -65.5051983600 39 'point symmetry operation' ? ? 0.9315047800 -0.3637266400 0.0013314700 118.81161369 0.3637189300 0.9314998900 0.0040617000 -82.57981750 -0.0027176100 -0.0032992200 0.9999908600 -83.2003811900 40 'point symmetry operation' ? ? 0.9666525900 0.2560879900 0.0013076500 -62.01340901 -0.2560865900 0.9666531700 -0.0011463900 80.16064187 -0.0015576200 0.0007732900 0.9999984900 -103.5273355200 41 'point symmetry operation' ? ? 0.9857295700 0.1683242000 0.0020422600 -43.24207564 -0.1683234200 0.9857316700 -0.0005512700 50.54109343 -0.0021059200 0.0001996400 0.9999977600 -68.6598155600 42 'point symmetry operation' ? ? 0.6959540300 0.7180685500 0.0050549200 -116.08837241 -0.7180666600 0.6959698300 -0.0025036600 282.79938592 -0.0053158700 -0.0018873400 0.9999840900 -86.0663632000 43 'point symmetry operation' ? ? 0.1827136800 0.9830869900 -0.0124774600 -43.57131338 -0.9831277000 0.1825795700 -0.0111632400 500.51450267 -0.0086963000 0.0143066100 0.9998598400 -74.0845848200 44 'point symmetry operation' ? ? -0.5087042500 0.8590609600 -0.0568704600 193.61037319 -0.8606049400 -0.5092412500 0.0056993300 655.21089899 -0.0240647100 0.0518422800 0.9983653000 -99.2259182900 45 'point symmetry operation' ? ? -0.4566051200 0.8870879000 -0.0677260600 173.97762971 -0.8892808000 -0.4573312300 0.0052735600 649.17783430 -0.0262951400 0.0626354200 0.9976900200 -66.9773994000 46 'point symmetry operation' ? ? -0.8976234600 0.4381272400 -0.0481316400 416.23184258 -0.4399104200 -0.8973185800 0.0360304400 639.15748027 -0.0274035000 0.0535153800 0.9981909400 -83.0729463600 47 'point symmetry operation' ? ? -0.9826787900 -0.1845830400 -0.0164768700 605.40179760 0.1830824100 -0.9807503400 0.0678940900 480.85468613 -0.0286918000 0.0637014600 0.9975564700 -104.3183107500 48 'point symmetry operation' ? ? -0.9934209500 -0.1121014900 -0.0234110200 590.09002926 0.1102749000 -0.9915382100 0.0684940100 504.22742214 -0.0308912000 0.0654617300 0.9973768100 -69.6391344900 49 'point symmetry operation' ? ? -0.7922601600 -0.6099661500 0.0162826800 661.50397876 0.6097706600 -0.7904608900 0.0578906800 311.10918644 -0.0224405300 0.0557931800 0.9981901300 -88.1482238600 50 'point symmetry operation' ? ? -0.3422480000 -0.9392976900 0.0242106200 625.34696863 0.9395060400 -0.3417139800 0.0236635000 104.03409784 -0.0139539700 0.0308448100 0.9994267800 -102.4261714300 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 46 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 46 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 42 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _em_3d_fitting.entry_id 6TUQ _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value 180.97 _em_3d_fitting.ref_protocol 'BACKBONE TRACE' _em_3d_fitting.ref_space REAL _em_3d_fitting.target_criteria 'Correlation coefficient' _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 6TUQ _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm 'FOURIER SPACE' _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages 1 _em_3d_reconstruction.num_particles 95481 _em_3d_reconstruction.resolution 3.9 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type HELICAL _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details '1x Phosphate buffered saline' _em_buffer.pH 7.4 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Pseudomonas virus Pf1' _em_entity_assembly.source NATURAL _em_entity_assembly.type VIRUS _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_image_scans.entry_id 6TUQ _em_image_scans.id 1 _em_image_scans.dimension_height ? _em_image_scans.dimension_width ? _em_image_scans.frames_per_image 40 _em_image_scans.image_recording_id 1 _em_image_scans.sampling_size ? _em_image_scans.scanner_model ? _em_image_scans.used_frames_per_image 1-40 _em_image_scans.citation_id ? _em_image_scans.number_digital_images ? _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.details ? # _em_imaging.id 1 _em_imaging.entry_id 6TUQ _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure 'ZEMLIN TABLEAU' _em_imaging.c2_aperture_diameter 50.0 _em_imaging.calibrated_defocus_max -3000 _em_imaging.calibrated_defocus_min -1000 _em_imaging.calibrated_magnification 105000 _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_max -3000 _em_imaging.nominal_defocus_min -1000 _em_imaging.nominal_magnification 105000 _em_imaging.recording_temperature_maximum 80 _em_imaging.recording_temperature_minimum 80 _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details '20 second glow discharge at 15 mA in a LeicaEM ACE200' _em_sample_support.grid_material COPPER/RHODIUM _em_sample_support.grid_mesh_size 200 _em_sample_support.grid_type 'Quantifoil R2/2' _em_sample_support.method ? _em_sample_support.film_material ? # _em_virus_entity.entity_assembly_id 1 _em_virus_entity.empty YES _em_virus_entity.enveloped NO _em_virus_entity.virus_isolate STRAIN _em_virus_entity.virus_type VIRION _em_virus_entity.id 1 _em_virus_entity.virus_host_category ? _em_virus_entity.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 283 _em_vitrification.cryogen_name ETHANE _em_vitrification.details ;Samples for cryo-EM were prepared by pipetting 2.5 ul of the sample onto freshly glow-discharged Quantifoil grids (Cu/Rh R2/2, 200 mesh). Grids were blotted for 2.5 seconds with a blot force of -15, 0.5 second drain and 0 second wait times. ; _em_vitrification.humidity 100 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.entry_id 6TUQ _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 6TUQ _em_experiment.id 1 _em_experiment.aggregation_state FILAMENT _em_experiment.reconstruction_method HELICAL _em_experiment.entity_assembly_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 ILE N N N N 106 ILE CA C N S 107 ILE C C N N 108 ILE O O N N 109 ILE CB C N S 110 ILE CG1 C N N 111 ILE CG2 C N N 112 ILE CD1 C N N 113 ILE OXT O N N 114 ILE H H N N 115 ILE H2 H N N 116 ILE HA H N N 117 ILE HB H N N 118 ILE HG12 H N N 119 ILE HG13 H N N 120 ILE HG21 H N N 121 ILE HG22 H N N 122 ILE HG23 H N N 123 ILE HD11 H N N 124 ILE HD12 H N N 125 ILE HD13 H N N 126 ILE HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 MET N N N N 175 MET CA C N S 176 MET C C N N 177 MET O O N N 178 MET CB C N N 179 MET CG C N N 180 MET SD S N N 181 MET CE C N N 182 MET OXT O N N 183 MET H H N N 184 MET H2 H N N 185 MET HA H N N 186 MET HB2 H N N 187 MET HB3 H N N 188 MET HG2 H N N 189 MET HG3 H N N 190 MET HE1 H N N 191 MET HE2 H N N 192 MET HE3 H N N 193 MET HXT H N N 194 SER N N N N 195 SER CA C N S 196 SER C C N N 197 SER O O N N 198 SER CB C N N 199 SER OG O N N 200 SER OXT O N N 201 SER H H N N 202 SER H2 H N N 203 SER HA H N N 204 SER HB2 H N N 205 SER HB3 H N N 206 SER HG H N N 207 SER HXT H N N 208 THR N N N N 209 THR CA C N S 210 THR C C N N 211 THR O O N N 212 THR CB C N R 213 THR OG1 O N N 214 THR CG2 C N N 215 THR OXT O N N 216 THR H H N N 217 THR H2 H N N 218 THR HA H N N 219 THR HB H N N 220 THR HG1 H N N 221 THR HG21 H N N 222 THR HG22 H N N 223 THR HG23 H N N 224 THR HXT H N N 225 TYR N N N N 226 TYR CA C N S 227 TYR C C N N 228 TYR O O N N 229 TYR CB C N N 230 TYR CG C Y N 231 TYR CD1 C Y N 232 TYR CD2 C Y N 233 TYR CE1 C Y N 234 TYR CE2 C Y N 235 TYR CZ C Y N 236 TYR OH O N N 237 TYR OXT O N N 238 TYR H H N N 239 TYR H2 H N N 240 TYR HA H N N 241 TYR HB2 H N N 242 TYR HB3 H N N 243 TYR HD1 H N N 244 TYR HD2 H N N 245 TYR HE1 H N N 246 TYR HE2 H N N 247 TYR HH H N N 248 TYR HXT H N N 249 VAL N N N N 250 VAL CA C N S 251 VAL C C N N 252 VAL O O N N 253 VAL CB C N N 254 VAL CG1 C N N 255 VAL CG2 C N N 256 VAL OXT O N N 257 VAL H H N N 258 VAL H2 H N N 259 VAL HA H N N 260 VAL HB H N N 261 VAL HG11 H N N 262 VAL HG12 H N N 263 VAL HG13 H N N 264 VAL HG21 H N N 265 VAL HG22 H N N 266 VAL HG23 H N N 267 VAL HXT H N N 268 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 ILE N CA sing N N 100 ILE N H sing N N 101 ILE N H2 sing N N 102 ILE CA C sing N N 103 ILE CA CB sing N N 104 ILE CA HA sing N N 105 ILE C O doub N N 106 ILE C OXT sing N N 107 ILE CB CG1 sing N N 108 ILE CB CG2 sing N N 109 ILE CB HB sing N N 110 ILE CG1 CD1 sing N N 111 ILE CG1 HG12 sing N N 112 ILE CG1 HG13 sing N N 113 ILE CG2 HG21 sing N N 114 ILE CG2 HG22 sing N N 115 ILE CG2 HG23 sing N N 116 ILE CD1 HD11 sing N N 117 ILE CD1 HD12 sing N N 118 ILE CD1 HD13 sing N N 119 ILE OXT HXT sing N N 120 LEU N CA sing N N 121 LEU N H sing N N 122 LEU N H2 sing N N 123 LEU CA C sing N N 124 LEU CA CB sing N N 125 LEU CA HA sing N N 126 LEU C O doub N N 127 LEU C OXT sing N N 128 LEU CB CG sing N N 129 LEU CB HB2 sing N N 130 LEU CB HB3 sing N N 131 LEU CG CD1 sing N N 132 LEU CG CD2 sing N N 133 LEU CG HG sing N N 134 LEU CD1 HD11 sing N N 135 LEU CD1 HD12 sing N N 136 LEU CD1 HD13 sing N N 137 LEU CD2 HD21 sing N N 138 LEU CD2 HD22 sing N N 139 LEU CD2 HD23 sing N N 140 LEU OXT HXT sing N N 141 LYS N CA sing N N 142 LYS N H sing N N 143 LYS N H2 sing N N 144 LYS CA C sing N N 145 LYS CA CB sing N N 146 LYS CA HA sing N N 147 LYS C O doub N N 148 LYS C OXT sing N N 149 LYS CB CG sing N N 150 LYS CB HB2 sing N N 151 LYS CB HB3 sing N N 152 LYS CG CD sing N N 153 LYS CG HG2 sing N N 154 LYS CG HG3 sing N N 155 LYS CD CE sing N N 156 LYS CD HD2 sing N N 157 LYS CD HD3 sing N N 158 LYS CE NZ sing N N 159 LYS CE HE2 sing N N 160 LYS CE HE3 sing N N 161 LYS NZ HZ1 sing N N 162 LYS NZ HZ2 sing N N 163 LYS NZ HZ3 sing N N 164 LYS OXT HXT sing N N 165 MET N CA sing N N 166 MET N H sing N N 167 MET N H2 sing N N 168 MET CA C sing N N 169 MET CA CB sing N N 170 MET CA HA sing N N 171 MET C O doub N N 172 MET C OXT sing N N 173 MET CB CG sing N N 174 MET CB HB2 sing N N 175 MET CB HB3 sing N N 176 MET CG SD sing N N 177 MET CG HG2 sing N N 178 MET CG HG3 sing N N 179 MET SD CE sing N N 180 MET CE HE1 sing N N 181 MET CE HE2 sing N N 182 MET CE HE3 sing N N 183 MET OXT HXT sing N N 184 SER N CA sing N N 185 SER N H sing N N 186 SER N H2 sing N N 187 SER CA C sing N N 188 SER CA CB sing N N 189 SER CA HA sing N N 190 SER C O doub N N 191 SER C OXT sing N N 192 SER CB OG sing N N 193 SER CB HB2 sing N N 194 SER CB HB3 sing N N 195 SER OG HG sing N N 196 SER OXT HXT sing N N 197 THR N CA sing N N 198 THR N H sing N N 199 THR N H2 sing N N 200 THR CA C sing N N 201 THR CA CB sing N N 202 THR CA HA sing N N 203 THR C O doub N N 204 THR C OXT sing N N 205 THR CB OG1 sing N N 206 THR CB CG2 sing N N 207 THR CB HB sing N N 208 THR OG1 HG1 sing N N 209 THR CG2 HG21 sing N N 210 THR CG2 HG22 sing N N 211 THR CG2 HG23 sing N N 212 THR OXT HXT sing N N 213 TYR N CA sing N N 214 TYR N H sing N N 215 TYR N H2 sing N N 216 TYR CA C sing N N 217 TYR CA CB sing N N 218 TYR CA HA sing N N 219 TYR C O doub N N 220 TYR C OXT sing N N 221 TYR CB CG sing N N 222 TYR CB HB2 sing N N 223 TYR CB HB3 sing N N 224 TYR CG CD1 doub Y N 225 TYR CG CD2 sing Y N 226 TYR CD1 CE1 sing Y N 227 TYR CD1 HD1 sing N N 228 TYR CD2 CE2 doub Y N 229 TYR CD2 HD2 sing N N 230 TYR CE1 CZ doub Y N 231 TYR CE1 HE1 sing N N 232 TYR CE2 CZ sing Y N 233 TYR CE2 HE2 sing N N 234 TYR CZ OH sing N N 235 TYR OH HH sing N N 236 TYR OXT HXT sing N N 237 VAL N CA sing N N 238 VAL N H sing N N 239 VAL N H2 sing N N 240 VAL CA C sing N N 241 VAL CA CB sing N N 242 VAL CA HA sing N N 243 VAL C O doub N N 244 VAL C OXT sing N N 245 VAL CB CG1 sing N N 246 VAL CB CG2 sing N N 247 VAL CB HB sing N N 248 VAL CG1 HG11 sing N N 249 VAL CG1 HG12 sing N N 250 VAL CG1 HG13 sing N N 251 VAL CG2 HG21 sing N N 252 VAL CG2 HG22 sing N N 253 VAL CG2 HG23 sing N N 254 VAL OXT HXT sing N N 255 # loop_ _em_buffer_component.buffer_id _em_buffer_component.id _em_buffer_component.concentration _em_buffer_component.concentration_units _em_buffer_component.formula _em_buffer_component.name 1 1 8 g/l NaCl 'sodium chloride' 1 2 0.2 g/l KCl 'potassium chloride' 1 3 1.15 g/l Na2HPO4 'sodium phosphate dibasic' 1 4 0.2 g/l KH2PO4 'potassium phosphate monobasic' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details 'Wiener filter implemented in the RELION refinement algorithm' # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units ? _em_entity_assembly_molwt.value ? # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 2011081 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Pseudomonas virus Pf1' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.angular_rotation_per_subunit 3.14 _em_helical_entity.axial_rise_per_subunit 65.9 _em_helical_entity.axial_symmetry C1 _em_helical_entity.details ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 43 _em_image_recording.average_exposure_time 10 _em_image_recording.details ? _em_image_recording.detector_mode COUNTING _em_image_recording.film_or_detector_model 'GATAN K2 SUMMIT (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged 2 _em_image_recording.num_real_images 4110 # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector none _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name 'GIF Bioquantum' _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.energyfilter_slit_width 20 _em_imaging_optics.phase_plate OTHER _em_imaging_optics.sph_aberration_corrector none # _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.details ? _em_particle_selection.method ? _em_particle_selection.num_particles_selected 351381 _em_particle_selection.reference_model ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? RELION 2.0 1 ? ? 2 'IMAGE ACQUISITION' ? EPU ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? RELION 2.0 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? Coot ? ? 1 ? 8 OTHER ? ? ? ? ? ? 9 'INITIAL EULER ASSIGNMENT' ? RELION 2.0 1 ? ? 10 'FINAL EULER ASSIGNMENT' ? RELION 2.0 1 ? ? 11 CLASSIFICATION ? RELION 3.0 1 ? ? 12 RECONSTRUCTION ? RELION 3.0 1 ? ? 13 'MODEL REFINEMENT' ? PHENIX ? ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration 5 _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _em_virus_natural_host.id 1 _em_virus_natural_host.entity_assembly_id 1 _em_virus_natural_host.ncbi_tax_id 208964 _em_virus_natural_host.organism 'Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)' _em_virus_natural_host.strain ? # _em_virus_shell.id 1 _em_virus_shell.entity_assembly_id 1 _em_virus_shell.diameter 62 _em_virus_shell.name 'Coat protein B (CoaB)' _em_virus_shell.triangulation ? # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 202231/Z/16/Z _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 6TUQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_